4CLNA

Structure of a recombinant calmodulin from drosophila melanogaster refined at 2.2-angstroms resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
148
structure length
148
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a recombinant calmodulin from Drosophila melanogaster refined at 2.2-A resolution.
pubmed rcsb
molecule keywords CALMODULIN
molecule tags Calcium binding protein
source organism Drosophila melanogaster
total genus 42
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1991-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4clnA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4clnA02
1DJZA 1Y0VH 2KI6D 5PALA 1EG4A 2M29A 1JBAA 1BODA 1ZMZA 2HF5A 2CCMA 3HCMA 4PHMA 1F71A 4GBAA 5DKQA 1RROA 4N5XA 1IQ5A 3OP0A 1CLMA 1RTP1 1SR6B 2F2PA 1AUIB 2LNKA 1DF0A 2I18A 4YGAA 3FWCA 1CLBA 4I5NB 5JOLA 2CBLA 2CT9A 2ZN9A 4Q04A 1FW4A 2Q91A 2D8NA 4IL1A 3TS5B 3E3RA 4NDDA 1CFCA 3I5IB 1R6PA 2LHLA 4WQ2A 4FTGA 3SG5A 1SCMC 3GOFA 1AVSA 2LVIA 3SG2A 2H2KA 2ZRTA 4ZCVA 3CLNA 3OB1B 5AFPA 3CZTX 3NSKA 4GNKB 1EXRA 2JXCA 4M2OA 1SNLA 1K9KA 3DF0B 3TZ1A 2LP2A 4YI9A 4GGFA 5HKYA 5CSNA 1FI5A 2KAVA 5AXIA 1A4PA 4GFTA 4AQIA 5KSZA 1DTLA 4M2PA 3NSLA 2WORA 1BMOA 2WC8A 2M97A 3A8RA 1TTXA 2I7AA 1B4CA 3WXAA 1IG5A 4CFRA 2KQ6A 4PALA 1RJVA 1QASA 1DJIA 2KNEA 2KSPA 3DVEA 1IRJA 4I5LB 3I5HC 1QX2A 3K21A 2F3YA 1OQPA 1L2OB 1KFUS 5F6TA 2JZIA 3D10A 3PN7B 1QIVA 1QIWA 1EL4A 5CSJA 4N1FA 4PE7A 2OS8B 4I5JA 2WCEA 1TNWA 4USLA 1JFJA 2L4IA 4MLWA 1J7RA 3GK2A 1F8HA 1DF0B 1MR8A 1YURA 3TUYB 1WLMA 2LLTA 4GUKA 4F0ZB 2K0JA 3H4SE 2GV5A 2HPSA 2BE4A 1B7TY 1PVAA 3AAJA 4YGCB 3EK8A 5HYDA 1TIZA 4NDCA 1UURA 1A29A 1XYDA 1CDPA 1XK4C 3GK4X 4ORBB 2IS9A 1PSBA 3VRQA 1M45A 2KI4B 2JNXA 2DOQA 5TNCA 4MBEA 3WHTB 3I5HB 2M0RA 2FCDA 3CS1A 2LV7A 4FQOA 5KTYA 3GK1A 3OX5A 2M7NA 3KO0A 1W7JB 1S6IA 1UHIA 3VRNA 1SRAA 1H8BA 5J3XA 2K7BA 2K7CA 2L0PA 4R1EA 2MHHA 5DKRA 1S5GZ 2EGDA 1NYAA 1DGVA 4P5OE 1SPYA 1JWDA 1TNXA 1G4YR 2KOTA 2KBMA 4MN0A 4UPGA 1FI6A 2AMIA 1N0YA 2PMYA 1CMGA 1AP4A 1YVLA 1RWYA 5ER5A 2LUXA 4QJ5B 1TOPA 5I8NA 1D1OA 1QJTA 1KWOC 2FJUB 2JRFA 3ICBA 1NSHA 3LK1A 1IKUA 3BQ3A 2M3WA 3DF0A 1PRWA 1J55A 3EK7A 4JPZB 3F45A 1NWDA 2BBNA 1OZSA 2EC6C 1W7IB 4MZJA 1R2UA 1CDMA 1AHRA 1GGZA 1Y1AA 1OMVA 1QLKA 2JTTA 4HRGA 1TCOB 4HRHA 4MVFA 1NPQA 4YBHB 2MBXA 4ETOA 3CR2A 4NQGA 2K2FA 4MEWA 4TNCA 2MRDA 1WDCC 2E30A 1KSOA 2JTZA 4CFQA 2HQ8A 1JUOA 2M1KB 1K8UA 3WHUB 4HREE 2M8UA 4PE4A 1MHOA 2PASA 4PDZA 1KWOB 1C7WA 2FOTA 2K7OA 1X02A 2M7LA 4C0JA 1YR5A 2KFGA 4WQ3A 4DRWA 1K9PA 2LLUA 2PRUA 3D0YA 4P2YB 1WRZA 2BBMA 2JT3A 2BCBA 1M63B 4QJ3B 1JFKA 1PVBA 2ZRSA 1PALA 2BKIB 2JQ6A 2PALA 2LLSA 1NX0A 3FS7A 1UP5A 2M49B 1S26D 1KQMB 1XA5A 3PFVA 3I5GC 1WDCB 1DJYA 3KF9A 1KK8C 1KFUL 2F3ZA 1Y1UA 3CGAA 1K90D 1WLZA 5AEQA 1DMOA 2V53A 1WY9A 4OR9B 1FF1A 2FCEA 2BL0C 2NZ0A 2KDHA 3SIBA 1QV1A 2Y1MA 2H61C 1B8RA 2NLNA 2RGIA 3KPXA 2WOSA 1QV0A 1MXLC 4YGEB 5CPVA 5AANA 4AQJA 1HT9A 3EKHA 3OB2B 2JXLA 1WRLA 1Y6WA 2M1UA 3O78A 4A4CA 2MA2A 5DKNA 1KQVA 1IWQA 2CNPA 1NX2A 1VRKA 2L2EA 1M31A 1ZACA 4OVNF 1SCMB 3CWGA 1CFFA 1QX7A 1XO5A 1XK4A 4JQ0D 4BY4A 1J7OA 2PVBA 2JOJA 1J7PA 2JULA 1QVIY 5FYXA 1YTZC 2KI6C 1BG1A 1KK8B 4MRXA 4OKHA 4C0KA 5I2LA 2KFHA 4ICBA 2MAZA 1KK7Y 1OMDA 1XFWO 4BY5A 1IQ3A 1LKJA 1WRKA 3NSIA 2AUCA 3D0YB 3PLFB 1H4BA 2OTGC 1RECA 2KAYA 4L9MA 1HQVA 1SK6D 1B7TZ 1TRFA 1UHKA 2ZFDA 3PM8A 5CSFA 3WNXB 2L98A 4AOMA 1ZFSA 2K61A 5B8IB 3AKBA 3EVUA 1UHJA 2A4JA 3CR4X 3LK0A 2LHIA 2F8PA 1PK0D 1YX8A 3VGOA 1UHHA 3EK4A 1S6JA 1TNQA 5D69A 4GGFC 4NDBA 5HLVA 3SIAA 4DIRA 3BUMB 3ZNIA 1ZOTB 5KU1A 1RFJA 4MZLA 3DVJA 1NCYA 2G2BA 1OZOA 1F70A 2MJWB 3A4UB 2KGRA 2HETA 3I5FC 5K89A 1CNPA 3SG4A 1OOJA 1NX3A 1M39A 4N1GA 3TDZA 5CSIA 4ZCUA 3TDUA 1CTRA 1B1GA 3AAKA 1XFVO 1UHNA 4ORCB 1NCXA 1BF5A 4PE1A 3EVRA 1SL8A 1NUBA 3M0WA 4OV2A 5ER4X 1A75B 5I2QA 1JC2A 3RM1A 2R2IA 1QXPA 2ISDA 3PALA 1ALVA 1E8AA 3JVTC 3SJSA 1DJGA 2PSRA 3PATA 5GQQC 4OCIA 1XFXO 1QX5B 3C1VA 5IBWA 1B8LA 3VROA 1K95A 1CLLA 2LANA 2BCXA 1NIWA 4HSZA 4MZKA 1ODBA 1KFXS 2LP3A 1B8CA 4PE0A 1NX1A 1YUSA 1CM4A 1MQ1A 3EVVA 4QJ4B 1C7VA 1JSAA 2CTNA 3IQOA 1SR6C 3AKAA 4GAOA 1LXFC 1QLSA 1SCVA 2K7DA 3CTNA 3LCPC 2E6WA 3JVTB 2COLB 2KFFA 4MRYA 4U8DA 2SCPA 2NXQA 2LUCA 3FWBA 3I5IC 2H61A 1FBVA 3MSEB 2I94A 1B47A 1CMFA 2KHNA 2F2OA 1DJWA 2JT8A 2WNDA 1SL7A 2EC6B 1YX7A 3DVKA 1DVIA 1CFPA 1GQMA 1CB1A 2M9GA 2L4HA 5HLOA 2WCFA 2JC2A 3BYAA 1SKTA 1YUUA 3SG7A 4YGBB 4XJKB 2Y1NA 1YRUB 1BOCA 2KYFA 2LC5A 4PHNA 3KHEA 1OSAA 4DS7A 1N2DA 2ZN8A 1NCZA 2HQWA 1ZUZA 4I5KA 2Y4QA 3JTDC 1NP8A 3BOWA 2GGZA 1RK9A 2JWWA 3BUXB 2MLEC 1FPWA 4MSPA 2KGBC 2LM5A 1PULA 1K93D 1U5IB 4CPVA 1IH0A 1K94A 2LVVA 1PSRA 1G8IA 3NXAA 1L2OC 3BUOB 2LVJA 3PN7C 1J1DA 1SYMA 1V1GA 3SG3A 3DVMA 1AJ4A 2OS8C 3BUWB 2QACA 1BT6A 3O4YA 1DGUA 3I5GB 1A75A 4CIDA 1LVCD 1IJ5A 1QVIZ 3TUYC 3BUNB 1G33A 2L51A 1BU3A 1A03A 5BPJA 1KK7Z 2O5GA 1Y1XA 3O2PA 1JF0A 1S3PA 1XFZO 2BL0B 3TDIA 1SY9A 2I2RE 1B9AA 1LA0A 2O60A 5G08A 3JTDB 1L7ZA 1AK8A 1TN4A 3CR5X 5AERA 4PCWA 1AJ5A 1XVJA 4WRIA 5I2OA 2ZNDA 1IJ6A 1UWOA 2KI4C 2EHBA 2NCOA 3O6BA 4A4BA 5HKZA 1ALWA 1QS7A 2JPTA 1DJXA 1SBJA 5D7FA 2KYCA 4YGDB 1TCFA 2QPTA 3QRXA 4DUQA 1CKKA 3PSRA 1BLQA 2LE9B 1M46A 3IQQA 2BCAA 4PHKA 1A2XA 1Q80A 3BOWB 1LINA 2VRGA 1TNPA 3EKJA 1OMRA 4PHJA 1OE9B 1JF2A 1CFDA 1K9UA 1MWNA 2F33A 2OTGB 1MF8B 2KBIA 1F55A 1F4OA 2OPOA 3ZWHA 1BJFA 1K2HA 3IF7A 2LCPA 2LVKA 1UUSA 1BR1B 1KFXL 1LA3A 2K8MB 1F4QA 1EG3A 1KCYA 5JJGA 3FIAA 4XJKA 4YI8A 1GJYA 2CXJA 3VRPA 2SASA 2B1UA 2ZKMX 1IGVA 1KSMA 1S36A 1YUTA 4GPLB 2LAPA 1EH2A 1S5GY 1C07A 1J1EA 2AAOA 3I5FB 2BECA 2KQYA 1CM1A 2NCPA 2LMUA 3OHMB 1N65A 1CDLA 2G9BA 2LMTA 1S6CA 4JWQA 3LLEA 1XFUO 2JU0A 3SG6A 1U5IA 4XYNA 1S1EA 1SMGA 3HX4A 1GGWA 1QTXA 2BE6A 2Y5IA 2K2AA 1DT7B 3NSOA 1EJ3A 3VRRA 2P6BB 4M2QA 4C0LA 1SL9A 1MUXA 1QATA 2JT0A 3LL8B 1XFYO 2BKHB 4ORAB 2ZNEA 1YRTB 1J7QA 1K96A 2L50A 4YRUA 2GGMA 2TN4A 3OX6A 3KEVA 1SW8A 1BR4B 1F54A 2KAXA 3BXKA 3DD4A 4GGNA 2MLFC 1CDNA 3TS5C 4D1EA 1YVHA 5HKWA 2L5XB 1DJHA 1V1FA 2Q4UA 3RLZA 4CLNA 1KQMC 2JNFA 2WCBA 4DCKA 4E68A 1MXEA 2LMVA
chains in the Genus database with same CATH superfamily
1DJZA 1TUZA 1Y0VH 2KI6D 5PALA 1EG4A 2M29A 1JBAA 1BODA 1ZMZA 2HF5A 2CCMA 3HCMA 4PHMA 1F71A 3V2LA 4GBAA 3PM2A 3DY9A 5DKQA 3D77A 1RROA 4N5XA 2WC5A 1SSEB 1IQ5A 3OP0A 1CLMA 1RTP1 1SR6B 2F2PA 1AUIB 2LNKA 1DF0A 2I18A 4YGAA 3FWCA 1CLBA 4OZDA 4I5NB 5JOLA 2CBLA 2CT9A 2ZN9A 4Q04A 1FW4A 2Q91A 2D8NA 4IL1A 3TS5B 3E3RA 4NDDA 1CFCA 3I5IB 1R6PA 2LHLA 4WQ2A 4FTGA 3SG5A 1SCMC 3GOFA 1AVSA 2LVIA 3SG2A 2H2KA 3CDNA 2ZRTA 3UO9A 4ZCVA 3CLNA 3OB1B 5AFPA 3CZTX 3NSKA 3CZ0A 4GNKB 1EXRA 2JXCA 2WCLA 3R1VA 4M2OA 1SNLA 1K9KA 3DF0B 3TZ1A 2LP2A 4YI9A 3D75A 4GGFA 3B7AA 5HKYA 5CSNA 1FI5A 2KAVA 5AXIA 1A4PA 4GFTA 4AQIA 5KSZA 1DTLA 4M2PA 3N7HA 3NSLA 2WORA 1BMOA 2WC8A 2M97A 3A8RA 1TTXA 2I7AA 1B4CA 3NGVA 3WXAA 1IG5A 4CFRA 2KQ6A 3S0AA 4PALA 1RJVA 3DXLA 1QASA 1DJIA 2KNEA 2KSPA 3DVEA 1IRJA 4I5LB 3I5HC 1QX2A 3K21A 2F3YA 1OQPA 1L2OB 1KFUS 5F6TA 2JZIA 3D10A 3PN7B 1QIVA 1QIWA 4IJ7A 1EL4A 5CSJA 4N1FA 4PE7A 2OS8B 4I5JA 2WCEA 1TNWA 4USLA 1JFJA 2H8VA 2L4IA 4MLWA 1J7RA 1XFRA 3GK2A 1F8HA 1DF0B 1MR8A 3FE9A 1YURA 3TUYB 1WLMA 2LLTA 4GUKA 4F0ZB 2K0JA 3H4SE 2GV5A 2HPSA 2BE4A 1B7TY 1PVAA 3AAJA 4YGCB 3EK8A 5HYDA 1TIZA 4NDCA 1UURA 1A29A 1XYDA 1OOIX 1CDPA 2QEHA 1XK4C 3GK4X 4ORBB 2IS9A 1PSBA 3VRQA 1M45A 2KI4B 2JNXA 2DOQA 3FE6A 5TNCA 4MBEA 3SS4A 3I5HB 3WHTB 2M0RA 2FCDA 3CS1A 2LV7A 4FQOA 5KTYA 3GK1A 3OX5A 2M7NA 3KO0A 1W7JB 1S6IA 1UHIA 3VRNA 1SRAA 2BAPA 1H8BA 5J3XA 2K7BA 2K7CA 2L0PA 4R1EA 1ORGA 2MHHA 5DKRA 1S5GZ 2EGDA 1NYAA 1DGVA 4P5OE 1SPYA 3PJIA 1JWDA 1TNXA 1G4YR 2KOTA 2KBMA 4MN0A 4UPGA 1FI6A 2AMIA 1N0YA 2PMYA 3B86A 1CMGA 3SS3A 1YVLA 1AP4A 1RWYA 5ER5A 2LUXA 4QJ5B 1TOPA 5I8NA 1D1OA 1LS8A 1QJTA 1KWOC 2FJUB 2JRFA 3ICBA 1NSHA 3LK1A 1IKUA 3BQ3A 2M3WA 3DF0A 1PRWA 1J55A 3EK7A 5D3OA 4JPZB 3F45A 1NWDA 2BBNA 1OZSA 3K1EA 2EC6C 3BJHA 1W7IB 4MZJA 4PT1A 1R2UA 1CDMA 3SS5A 1AHRA 1GGZA 1Y1AA 1OMVA 1QLKA 2JTTA 4HRGA 1TCOB 3NHIA 4HRHA 1NPQA 4MVFA 3OGNA 4YBHB 3CR2A 4NQGA 3S0DA 4JD9A 2K2FA 4MEWA 4INXA 3B6XA 4TNCA 2MRDA 1WDCC 1OOFA 1KSOA 2E30A 2JTZA 2P70A 5I94A 2KLDA 4CFQA 2HQ8A 1JUOA 2M1KB 1K8UA 3WHUB 4HREE 2M8UA 4PE4A 1MHOA 2PASA 4PDZA 1KWOB 2K60A 1C7WA 2FOTA 2K7OA 1X02A 2M7LA 4C0JA 1YR5A 2KFGA 3S0BA 4WQ3A 4DRWA 2QEVA 1K9PA 2LLUA 2PRUA 2WC6A 3D0YA 3S0FA 4P2YB 1WRZA 2BBMA 2JT3A 2BCBA 1M63B 4QJ3B 1TWOA 3VB1A 1JFKA 1PVBA 2ZRSA 1PALA 2BKIB 2JQ6A 2PALA 2LLSA 1NX0A 3FS7A 1UP5A 2M49B 1S26D 4KYNA 1KQMB 1XA5A 3PFVA 3I5GC 1WDCB 1DJYA 3KF9A 1KK8C 1KFUL 2F3ZA 1Y1UA 3CGAA 1K90D 1WLZA 3D76A 5AEQA 1DMOA 2V53A 1WY9A 4OR9B 1FF1A 2FCEA 2BL0C 1TUJA 2KDHA 2NZ0A 3SIBA 1QV1A 2QEOA 2Y1MA 2H61C 1B8RA 2NLNA 3DYEA 2RGIA 4FQTA 1IIOA 3KPXA 2WOSA 1QV0A 1MXLC 4YGEB 5CPVA 5AANA 4AQJA 1HT9A 3EKHA 3OB2B 2JXLA 1WRLA 1Y6WA 2M1UA 3O78A 1Z4HA 2FJYA 2BNXA 2MA2A 4A4CA 5DKNA 1KQVA 1IWQA 2CNPA 1NX2A 1VRKA 2L2EA 1M31A 1ZACA 4OVNF 1SCMB 3CWGA 1CFFA 1QX7A 1XO5A 1XK4A 4JQ0D 4BY4A 3B87A 2PVBA 1J7OA 2JOJA 1J7PA 2JULA 1QVIY 5FYXA 5FI7A 1YTZC 2KI6C 1BG1A 4JKTA 1KK8B 4MRXA 4OKHA 4C0KA 5I2LA 2KFHA 3R1OA 4ICBA 2MAZA 1DQEA 1KK7Y 1OMDA 1OW4A 1XFWO 4BY5A 1IQ3A 1DEKA 1LKJA 1WRKA 3NSIA 2AUCA 3D0YB 3PLFB 1OOGA 1H4BA 2OTGC 1RECA 2KAYA 4L9MA 1HQVA 1SK6D 1B7TZ 1TRFA 1UHKA 2ZFDA 3PM8A 5CSFA 3WNXB 2L98A 4F7FA 1DELA 4AOMA 1ZFSA 2K61A 3BFHA 5B8IB 5HL1A 3AKBA 3EVUA 1UHJA 2A4JA 3CR4X 3LK0A 3D78A 2LHIA 2F8PA 1PK0D 1YX8A 2L5YA 1UHHA 3EK4A 3VGOA 1S6JA 1TNQA 5D69A 1T14A 4GGFC 4NDBA 5HLVA 3SIAA 3RZSA 4DIRA 3BUMB 3ZNIA 1ZOTB 5KU1A 1RFJA 4MZLA 2WCJA 3DVJA 1NCYA 1C3ZA 2G2BA 1OZOA 1F70A 2MJWB 3A4UB 2KGRA 2HETA 3I5FC 5K89A 1CNPA 3SG4A 1OOJA 1NX3A 1M39A 4N1GA 3TDZA 5CSIA 4ZCUA 3TDUA 1CTRA 3BFAA 1B1GA 3BFBA 3AAKA 1XFVO 1UHNA 4ORCB 3IVTA 1NCXA 1BF5A 4PE1A 3EVRA 1SL8A 1NUBA 3M0WA 4OV2A 5ER4X 1A75B 3L4AA 5I2QA 1JC2A 3RM1A 2R2IA 1QXPA 2ISDA 3PALA 1ALVA 1E8AA 3JVTC 3SJSA 1DJGA 2PSRA 3PATA 5GQQC 2GTEA 4OCIA 1XFXO 1QX5B 3C1VA 5IBWA 3S0GA 1B8LA 3Q8IA 3L47A 3VROA 1K95A 1CLLA 2LANA 2BCXA 3FE8A 2P71A 1NIWA 4HSZA 2KLEA 1Z2CB 4MZKA 5DICA 1ODBA 1KFXS 3OBVA 2LP3A 1B8CA 2WCKA 4PE0A 1NX1A 1YUSA 1CM4A 1MQ1A 3EVVA 4QJ4B 1C7VA 1JSAA 2CTNA 3IQOA 1SR6C 2WCHA 3AKAA 4GAOA 1LXFC 1QLSA 1SCVA 2K7DA 3CTNA 3LCPC 2E6WA 3JVTB 2COLB 2KFFA 2MBXA 4MRYA 4U8DA 2SCPA 2NXQA 2LUCA 3FWBA 3I5IC 2H61A 3QMEA 1FBVA 3MSEB 2I94A 1B47A 1CMFA 2KHNA 2F2OA 2YGUA 1DC1A 1DJWA 2JT8A 2WNDA 1SL7A 2EC6B 1YX7A 3DVKA 1DVIA 1CFPA 1GQMA 1CB1A 2M9GA 2L4HA 5HLOA 2WCFA 2JC2A 3BYAA 2L2CA 1SKTA 1YUUA 3SG7A 4YGBB 4XJKB 3O4XA 2Y1NA 1YRUB 1BOCA 1W9ZA 2KYFA 2LC5A 4PHNA 3KHEA 1OSAA 4DS7A 1N2DA 2ZN8A 1NCZA 2HQWA 3EG5B 1ZUZA 4I5KA 2ERBA 2Y4QA 3NHTA 3JTDC 1NP8A 3BOWA 2GGZA 1RK9A 2JWWA 3BUXB 2MLEC 3R72A 1FPWA 4MSPA 2KGBC 2LM5A 1QWVA 1PULA 1K93D 1U5IB 4CPVA 1IH0A 1K94A 3D74A 2LVVA 1PSRA 1G8IA 3NXAA 1L2OC 3BUOB 2LVJA 3PN7C 1J1DA 1SYMA 1V1GA 3SG3A 3DVMA 1AJ4A 2OS8C 3BUWB 2QACA 1BT6A 3O4YA 1DGUA 3I5GB 1A75A 3CYZA 4CIDA 5EL2A 1LVCD 1IJ5A 1QVIZ 3TUYC 3BUNB 1G33A 2L51A 1BU3A 5FI6A 1A03A 5BPJA 1KK7Z 2O5GA 1Y1XA 3O2PA 1JF0A 1S3PA 1XFZO 2BL0B 3TDIA 1SY9A 4ETOA 2I2RE 1B9AA 1LA0A 2O60A 5G08A 3JTDB 1L7ZA 1AK8A 1TN4A 1OOHA 3CR5X 5AERA 4PCWA 1AJ5A 1XVJA 4WRIA 5I2OA 2ZNDA 1IJ6A 1UWOA 2KI4C 2EHBA 2PYQA 5FI2A 2NCOA 3O6BA 4A4BA 5HKZA 1ALWA 1QS7A 2JPTA 1DJXA 1SBJA 5D7FA 3CZ1A 2KYCA 4YGDB 1TCFA 2QPTA 3QRXA 4DUQA 1CKKA 3PSRA 1BLQA 2LE9B 1M46A 2PQLA 3IQQA 2BCAA 4PHKA 1C3YA 3CZ2A 1A2XA 1Q80A 3R1PA 3BOWB 1LINA 2VRGA 3UNWA 1TNPA 3EKJA 1OMRA 4PHJA 1OE9B 1JF2A 1CFDA 1K9UA 1MWNA 2F33A 2OTGB 1MF8B 3B88A 2KBIA 1F55A 1F4OA 2OPOA 3ZWHA 3D73A 1BJFA 1K2HA 3IF7A 2LCPA 2LVKA 1UUSA 1P28A 1BR1B 1KFXL 1LA3A 2K8MB 1F4QA 1EG3A 1KCYA 5JJGA 3FIAA 4XJKA 4YI8A 1GJYA 2CXJA 2QDIA 3VRPA 2SASA 2B1UA 3S0EA 2ZKMX 1IGVA 1KSMA 1S36A 1YUTA 4GPLB 2KPHA 2LAPA 1EH2A 1S5GY 1C07A 1J1EA 2AAOA 3I5FB 2BECA 2KQYA 1CM1A 2NCPA 2LMUA 3CABA 3OHMB 1N65A 1CDLA 2G9BA 2LMTA 1S6CA 4INWA 4JWQA 3LLEA 1XFUO 2JU0A 2QEBA 1U5IA 3SG6A 4XYNA 1S1EA 1SMGA 3HX4A 1GGWA 1QTXA 2BE6A 2Y5IA 2K2AA 1DT7B 3L4LA 1EJ3A 3NSOA 2P6BB 4M2QA 3VRRA 4C0LA 1SL9A 1MUXA 1QATA 2JT0A 3LL8B 1XFYO 2BKHB 4ORAB 2ZNEA 1YRTB 1J7QA 1K96A 2JPOA 2L50A 2GGMA 2TN4A 3OX6A 3KEVA 4YRUA 1SW8A 1BR4B 1F54A 2KAXA 3BXKA 3DD4A 4GGNA 2MLFC 2WCMA 1CDNA 3TS5C 4D1EA 1YVHA 5HKWA 2L5XB 3DZTA 1GM0A 1DJHA 1V1FA 2Q4UA 3RLZA 4CLNA 1KQMC 2JNFA 2WCBA 4DCKA 4E68A 1MXEA 2LMVA
chains in the Genus database with same CATH topology
1DJZA 1Y0VH 2KI6D 5PALA 1EG4A 2M29A 1JBAA 1BODA 1ZMZA 2HF5A 2CCMA 3HCMA 4PHMA 1F71A 4GBAA 5DKQA 1RROA 4N5XA 1IQ5A 3OP0A 1CLMA 1RTP1 1SR6B 2F2PA 1AUIB 2LNKA 1DF0A 2I18A 4YGAA 3FWCA 1CLBA 4I5NB 5JOLA 2CBLA 2CT9A 2ZN9A 4Q04A 1FW4A 2Q91A 2D8NA 4IL1A 3TS5B 3E3RA 4NDDA 1CFCA 3I5IB 1R6PA 2LHLA 4WQ2A 4FTGA 3SG5A 1SCMC 3GOFA 1AVSA 2LVIA 3SG2A 2H2KA 2ZRTA 4ZCVA 3CLNA 3OB1B 5AFPA 3CZTX 3NSKA 4GNKB 1EXRA 2JXCA 4M2OA 1SNLA 1K9KA 3DF0B 3TZ1A 2LP2A 4YI9A 4GGFA 5HKYA 5CSNA 1FI5A 2KAVA 5AXIA 1A4PA 4GFTA 4AQIA 5KSZA 1DTLA 4M2PA 3NSLA 2WORA 1BMOA 2WC8A 2M97A 3A8RA 1TTXA 2I7AA 1B4CA 3WXAA 1IG5A 4CFRA 2KQ6A 4PALA 1RJVA 1QASA 1DJIA 2KNEA 2KSPA 3DVEA 1IRJA 4I5LB 3I5HC 1QX2A 3K21A 2F3YA 1OQPA 1L2OB 1KFUS 5F6TA 2JZIA 3D10A 3PN7B 1QIVA 1QIWA 1EL4A 5CSJA 4N1FA 4PE7A 2OS8B 4I5JA 2WCEA 1TNWA 4USLA 1JFJA 2L4IA 4MLWA 1J7RA 3GK2A 1F8HA 1DF0B 1MR8A 1YURA 3TUYB 1WLMA 2LLTA 4GUKA 4F0ZB 2K0JA 3H4SE 2GV5A 2HPSA 2BE4A 1B7TY 1PVAA 3AAJA 4YGCB 3EK8A 5HYDA 1TIZA 4NDCA 1UURA 1A29A 1XYDA 1CDPA 1XK4C 3GK4X 4ORBB 2IS9A 1PSBA 3VRQA 1M45A 2KI4B 2JNXA 2DOQA 5TNCA 4MBEA 3WHTB 3I5HB 2M0RA 2FCDA 3CS1A 2LV7A 4FQOA 5KTYA 3GK1A 3OX5A 2M7NA 3KO0A 1W7JB 1S6IA 1UHIA 3VRNA 1SRAA 1H8BA 5J3XA 2K7BA 2K7CA 2L0PA 4R1EA 2MHHA 5DKRA 1S5GZ 2EGDA 1NYAA 1DGVA 4P5OE 1SPYA 1JWDA 1TNXA 1G4YR 2KOTA 2KBMA 4MN0A 4UPGA 1FI6A 2AMIA 1N0YA 2PMYA 1CMGA 1AP4A 1YVLA 1RWYA 5ER5A 2LUXA 4QJ5B 1TOPA 5I8NA 1D1OA 1QJTA 1KWOC 2FJUB 2JRFA 3ICBA 1NSHA 3LK1A 1IKUA 3BQ3A 2M3WA 3DF0A 1PRWA 1J55A 3EK7A 4JPZB 3F45A 1NWDA 2BBNA 1OZSA 2EC6C 1W7IB 4MZJA 1R2UA 1CDMA 1AHRA 1GGZA 1Y1AA 1OMVA 1QLKA 2JTTA 4HRGA 1TCOB 4HRHA 4MVFA 1NPQA 4YBHB 2MBXA 4ETOA 3CR2A 4NQGA 2K2FA 4MEWA 4TNCA 2MRDA 1WDCC 2E30A 1KSOA 2JTZA 4CFQA 2HQ8A 1JUOA 2M1KB 1K8UA 3WHUB 4HREE 2M8UA 4PE4A 1MHOA 2PASA 4PDZA 1KWOB 1C7WA 2FOTA 2K7OA 1X02A 2M7LA 4C0JA 1YR5A 2KFGA 4WQ3A 4DRWA 1K9PA 2LLUA 2PRUA 3D0YA 4P2YB 1WRZA 2BBMA 2JT3A 2BCBA 1M63B 4QJ3B 1JFKA 1PVBA 2ZRSA 1PALA 2BKIB 2JQ6A 2PALA 2LLSA 1NX0A 3FS7A 1UP5A 2M49B 1S26D 1KQMB 1XA5A 3PFVA 3I5GC 1WDCB 1DJYA 3KF9A 1KK8C 1KFUL 2F3ZA 1Y1UA 3CGAA 1K90D 1WLZA 5AEQA 1DMOA 2V53A 1WY9A 4OR9B 1FF1A 2FCEA 2BL0C 2NZ0A 2KDHA 3SIBA 1QV1A 2Y1MA 2H61C 1B8RA 2NLNA 2RGIA 3KPXA 2WOSA 1QV0A 1MXLC 4YGEB 5CPVA 5AANA 4AQJA 1HT9A 3EKHA 3OB2B 2JXLA 1WRLA 1Y6WA 2M1UA 3O78A 4A4CA 2MA2A 5DKNA 1KQVA 1IWQA 2CNPA 1NX2A 1VRKA 2L2EA 1M31A 1ZACA 4OVNF 1SCMB 3CWGA 1CFFA 1QX7A 1XO5A 1XK4A 4JQ0D 4BY4A 1J7OA 2PVBA 2JOJA 1J7PA 2JULA 1QVIY 5FYXA 1YTZC 2KI6C 1BG1A 1KK8B 4MRXA 4OKHA 4C0KA 5I2LA 2KFHA 4ICBA 2MAZA 1KK7Y 1OMDA 1XFWO 4BY5A 1IQ3A 1LKJA 1WRKA 3NSIA 2AUCA 3D0YB 3PLFB 1H4BA 2OTGC 1RECA 2KAYA 4L9MA 1HQVA 1SK6D 1B7TZ 1TRFA 1UHKA 2ZFDA 3PM8A 5CSFA 3WNXB 2L98A 4AOMA 1ZFSA 2K61A 5B8IB 3AKBA 3EVUA 1UHJA 2A4JA 3CR4X 3LK0A 2LHIA 2F8PA 1PK0D 1YX8A 3VGOA 1UHHA 3EK4A 1S6JA 1TNQA 5D69A 4GGFC 4NDBA 5HLVA 3SIAA 4DIRA 3BUMB 3ZNIA 1ZOTB 5KU1A 1RFJA 4MZLA 3DVJA 1NCYA 2G2BA 1OZOA 1F70A 2MJWB 3A4UB 2KGRA 2HETA 3I5FC 5K89A 1CNPA 3SG4A 1OOJA 1NX3A 1M39A 4N1GA 3TDZA 5CSIA 4ZCUA 3TDUA 1CTRA 1B1GA 3AAKA 1XFVO 1UHNA 4ORCB 1NCXA 1BF5A 4PE1A 3EVRA 1SL8A 1NUBA 3M0WA 4OV2A 5ER4X 1A75B 5I2QA 1JC2A 3RM1A 2R2IA 1QXPA 2ISDA 3PALA 1ALVA 1E8AA 3JVTC 3SJSA 1DJGA 2PSRA 3PATA 5GQQC 4OCIA 1XFXO 1QX5B 3C1VA 5IBWA 1B8LA 3VROA 1K95A 1CLLA 2LANA 2BCXA 1NIWA 4HSZA 4MZKA 1ODBA 1KFXS 2LP3A 1B8CA 4PE0A 1NX1A 1YUSA 1CM4A 1MQ1A 3EVVA 4QJ4B 1C7VA 1JSAA 2CTNA 3IQOA 1SR6C 3AKAA 4GAOA 1LXFC 1QLSA 1SCVA 2K7DA 3CTNA 3LCPC 2E6WA 3JVTB 2COLB 2KFFA 4MRYA 4U8DA 2SCPA 2NXQA 2LUCA 3FWBA 3I5IC 2H61A 1FBVA 3MSEB 2I94A 1B47A 1CMFA 2KHNA 2F2OA 1DJWA 2JT8A 2WNDA 1SL7A 2EC6B 1YX7A 3DVKA 1DVIA 1CFPA 1GQMA 1CB1A 2M9GA 2L4HA 5HLOA 2WCFA 2JC2A 3BYAA 1SKTA 1YUUA 3SG7A 4YGBB 4XJKB 2Y1NA 1YRUB 1BOCA 2KYFA 2LC5A 4PHNA 3KHEA 1OSAA 4DS7A 1N2DA 2ZN8A 1NCZA 2HQWA 1ZUZA 4I5KA 2Y4QA 3JTDC 1NP8A 3BOWA 2GGZA 1RK9A 2JWWA 3BUXB 2MLEC 1FPWA 4MSPA 2KGBC 2LM5A 1PULA 1K93D 1U5IB 4CPVA 1IH0A 1K94A 2LVVA 1PSRA 1G8IA 3NXAA 1L2OC 3BUOB 2LVJA 3PN7C 1J1DA 1SYMA 1V1GA 3SG3A 3DVMA 1AJ4A 2OS8C 3BUWB 2QACA 1BT6A 3O4YA 1DGUA 3I5GB 1A75A 4CIDA 1LVCD 1IJ5A 1QVIZ 3TUYC 3BUNB 1G33A 2L51A 1BU3A 1A03A 5BPJA 1KK7Z 2O5GA 1Y1XA 3O2PA 1JF0A 1S3PA 1XFZO 2BL0B 3TDIA 1SY9A 2I2RE 1B9AA 1LA0A 2O60A 5G08A 3JTDB 1L7ZA 1AK8A 1TN4A 3CR5X 5AERA 4PCWA 1AJ5A 1XVJA 4WRIA 5I2OA 2ZNDA 1IJ6A 1UWOA 2KI4C 2EHBA 2NCOA 3O6BA 4A4BA 5HKZA 1ALWA 1QS7A 2JPTA 1DJXA 1SBJA 5D7FA 2KYCA 4YGDB 1TCFA 2QPTA 3QRXA 4DUQA 1CKKA 3PSRA 1BLQA 2LE9B 1M46A 3IQQA 2BCAA 4PHKA 1A2XA 1Q80A 3BOWB 1LINA 2VRGA 1TNPA 3EKJA 1OMRA 4PHJA 1OE9B 1JF2A 1CFDA 1K9UA 1MWNA 2F33A 2OTGB 1MF8B 2KBIA 1F55A 1F4OA 2OPOA 3ZWHA 1BJFA 1K2HA 3IF7A 2LCPA 2LVKA 1UUSA 1BR1B 1KFXL 1LA3A 2K8MB 1F4QA 1EG3A 1KCYA 5JJGA 3FIAA 4XJKA 4YI8A 1GJYA 2CXJA 3VRPA 2SASA 2B1UA 2ZKMX 1IGVA 1KSMA 1S36A 1YUTA 4GPLB 2LAPA 1EH2A 1S5GY 1C07A 1J1EA 2AAOA 3I5FB 2BECA 2KQYA 1CM1A 2NCPA 2LMUA 3OHMB 1N65A 1CDLA 2G9BA 2LMTA 1S6CA 4JWQA 3LLEA 1XFUO 2JU0A 3SG6A 1U5IA 4XYNA 1S1EA 1SMGA 3HX4A 1GGWA 1QTXA 2BE6A 2Y5IA 2K2AA 1DT7B 3NSOA 1EJ3A 3VRRA 2P6BB 4M2QA 4C0LA 1SL9A 1MUXA 1QATA 2JT0A 3LL8B 1XFYO 2BKHB 4ORAB 2ZNEA 1YRTB 1J7QA 1K96A 2L50A 4YRUA 2GGMA 2TN4A 3OX6A 3KEVA 1SW8A 1BR4B 1F54A 2KAXA 3BXKA 3DD4A 4GGNA 2MLFC 1CDNA 3TS5C 4D1EA 1YVHA 5HKWA 2L5XB 1DJHA 1V1FA 2Q4UA 3RLZA 4CLNA 1KQMC 2JNFA 2WCBA 4DCKA 4E68A 1MXEA 2LMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJZ A;  1Y0V H;  2KI6 D;  5PAL A;  1EG4 A;  2M29 A;  1JBA A;  1BOD A;  1ZMZ A;  2HF5 A;  2CCM A;  3HCM A;  4PHM A;  1F71 A;  4GBA A;  5DKQ A;  1RRO A;  4N5X A;  1IQ5 A;  3OP0 A;  1CLM A;  1RTP 1;  1SR6 B;  2F2P A;  1AUI B;  2LNK A;  1DF0 A;  2I18 A;  4YGA A;  3FWC A;  1CLB A;  4I5N B;  5JOL A;  2CBL A;  2CT9 A;  2ZN9 A;  4Q04 A;  1FW4 A;  2Q91 A;  2D8N A;  4IL1 A;  3TS5 B;  3E3R A;  4NDD A;  1CFC A;  3I5I B;  1R6P A;  2LHL A;  4WQ2 A;  4FTG A;  3SG5 A;  1SCM C;  3GOF A;  1AVS A;  2LVI A;  3SG2 A;  2H2K A;  2ZRT A;  4ZCV A;  3CLN A;  3OB1 B;  5AFP A;  3CZT X;  3NSK A;  4GNK B;  1EXR A;  2JXC A;  4M2O A;  1SNL A;  1K9K A;  3DF0 B;  3TZ1 A;  2LP2 A;  4YI9 A;  4GGF A;  5HKY A;  5CSN A;  1FI5 A;  2KAV A;  5AXI A;  1A4P A;  4GFT A;  4AQI A;  5KSZ A;  1DTL A;  4M2P A;  3NSL A;  2WOR A;  1BMO A;  2WC8 A;  2M97 A;  3A8R A;  1TTX A;  2I7A A;  1B4C A;  3WXA A;  1IG5 A;  4CFR A;  2KQ6 A;  4PAL A;  1RJV A;  1QAS A;  1DJI A;  2KNE A;  2KSP A;  3DVE A;  1IRJ A;  4I5L B;  3I5H C;  1QX2 A;  3K21 A;  2F3Y A;  1OQP A;  1L2O B;  1KFU S;  5F6T A;  2JZI A;  3D10 A;  3PN7 B;  1QIV A;  1QIW A;  1EL4 A;  5CSJ A;  4N1F A;  4PE7 A;  2OS8 B;  4I5J A;  2WCE A;  1TNW A;  4USL A;  1JFJ A;  2L4I A;  4MLW A;  1J7R A;  3GK2 A;  1F8H A;  1DF0 B;  1MR8 A;  1YUR A;  3TUY B;  1WLM A;  2LLT A;  4GUK A;  4F0Z B;  2K0J A;  3H4S E;  2GV5 A;  2HPS A;  2BE4 A;  1B7T Y;  1PVA A;  3AAJ A;  4YGC B;  3EK8 A;  5HYD A;  1TIZ A;  4NDC A;  1UUR A;  1A29 A;  1XYD A;  1CDP A;  1XK4 C;  3GK4 X;  4ORB B;  2IS9 A;  1PSB A;  3VRQ A;  1M45 A;  2KI4 B;  2JNX A;  2DOQ A;  5TNC A;  4MBE A;  3WHT B;  3I5H B;  2M0R A;  2FCD A;  3CS1 A;  2LV7 A;  4FQO A;  5KTY A;  3GK1 A;  3OX5 A;  2M7N A;  3KO0 A;  1W7J B;  1S6I A;  1UHI A;  3VRN A;  1SRA A;  1H8B A;  5J3X A;  2K7B A;  2K7C A;  2L0P A;  4R1E A;  2MHH A;  5DKR A;  1S5G Z;  2EGD A;  1NYA A;  1DGV A;  4P5O E;  1SPY A;  1JWD A;  1TNX A;  1G4Y R;  2KOT A;  2KBM A;  4MN0 A;  4UPG A;  1FI6 A;  2AMI A;  1N0Y A;  2PMY A;  1CMG A;  1AP4 A;  1YVL A;  1RWY A;  5ER5 A;  2LUX A;  4QJ5 B;  1TOP A;  5I8N A;  1D1O A;  1QJT A;  1KWO C;  2FJU B;  2JRF A;  3ICB A;  1NSH A;  3LK1 A;  1IKU A;  3BQ3 A;  2M3W A;  3DF0 A;  1PRW A;  1J55 A;  3EK7 A;  4JPZ B;  3F45 A;  1NWD A;  2BBN A;  1OZS A;  2EC6 C;  1W7I B;  4MZJ A;  1R2U A;  1CDM A;  1AHR A;  1GGZ A;  1Y1A A;  1OMV A;  1QLK A;  2JTT A;  4HRG A;  1TCO B;  4HRH A;  4MVF A;  1NPQ A;  4YBH B;  2MBX A;  4ETO A;  3CR2 A;  4NQG A;  2K2F A;  4MEW A;  4TNC A;  2MRD A;  1WDC C;  2E30 A;  1KSO A;  2JTZ A;  4CFQ A;  2HQ8 A;  1JUO A;  2M1K B;  1K8U A;  3WHU B;  4HRE E;  2M8U A;  4PE4 A;  1MHO A;  2PAS A;  4PDZ A;  1KWO B;  1C7W A;  2FOT A;  2K7O A;  1X02 A;  2M7L A;  4C0J A;  1YR5 A;  2KFG A;  4WQ3 A;  4DRW A;  1K9P A;  2LLU A;  2PRU A;  3D0Y A;  4P2Y B;  1WRZ A;  2BBM A;  2JT3 A;  2BCB A;  1M63 B;  4QJ3 B;  1JFK A;  1PVB A;  2ZRS A;  1PAL A;  2BKI B;  2JQ6 A;  2PAL A;  2LLS A;  1NX0 A;  3FS7 A;  1UP5 A;  2M49 B;  1S26 D;  1KQM B;  1XA5 A;  3PFV A;  3I5G C;  1WDC B;  1DJY A;  3KF9 A;  1KK8 C;  1KFU L;  2F3Z A;  1Y1U A;  3CGA A;  1K90 D;  1WLZ A;  5AEQ A;  1DMO A;  2V53 A;  1WY9 A;  4OR9 B;  1FF1 A;  2FCE A;  2BL0 C;  2NZ0 A;  2KDH A;  3SIB A;  1QV1 A;  2Y1M A;  2H61 C;  1B8R A;  2NLN A;  2RGI A;  3KPX A;  2WOS A;  1QV0 A;  1MXL C;  4YGE B;  5CPV A;  5AAN A;  4AQJ A;  1HT9 A;  3EKH A;  3OB2 B;  2JXL A;  1WRL A;  1Y6W A;  2M1U A;  3O78 A;  4A4C A;  2MA2 A;  5DKN A;  1KQV A;  1IWQ A;  2CNP A;  1NX2 A;  1VRK A;  2L2E A;  1M31 A;  1ZAC A;  4OVN F;  1SCM B;  3CWG A;  1CFF A;  1QX7 A;  1XO5 A;  1XK4 A;  4JQ0 D;  4BY4 A;  1J7O A;  2PVB A;  2JOJ A;  1J7P A;  2JUL A;  1QVI Y;  5FYX A;  1YTZ C;  2KI6 C;  1BG1 A;  1KK8 B;  4MRX A;  4OKH A;  4C0K A;  5I2L A;  2KFH A;  4ICB A;  2MAZ A;  1KK7 Y;  1OMD A;  1XFW O;  4BY5 A;  1IQ3 A;  1LKJ A;  1WRK A;  3NSI A;  2AUC A;  3D0Y B;  3PLF B;  1H4B A;  2OTG C;  1REC A;  2KAY A;  4L9M A;  1HQV A;  1SK6 D;  1B7T Z;  1TRF A;  1UHK A;  2ZFD A;  3PM8 A;  5CSF A;  3WNX B;  2L98 A;  4AOM A;  1ZFS A;  2K61 A;  5B8I B;  3AKB A;  3EVU A;  1UHJ A;  2A4J A;  3CR4 X;  3LK0 A;  2LHI A;  2F8P A;  1PK0 D;  1YX8 A;  3VGO A;  1UHH A;  3EK4 A;  1S6J A;  1TNQ A;  5D69 A;  4GGF C;  4NDB A;  5HLV A;  3SIA A;  4DIR A;  3BUM B;  3ZNI A;  1ZOT B;  5KU1 A;  1RFJ A;  4MZL A;  3DVJ A;  1NCY A;  2G2B A;  1OZO A;  1F70 A;  2MJW B;  3A4U B;  2KGR A;  2HET A;  3I5F C;  5K89 A;  1CNP A;  3SG4 A;  1OOJ A;  1NX3 A;  1M39 A;  4N1G A;  3TDZ A;  5CSI A;  4ZCU A;  3TDU A;  1CTR A;  1B1G A;  3AAK A;  1XFV O;  1UHN A;  4ORC B;  1NCX A;  1BF5 A;  4PE1 A;  3EVR A;  1SL8 A;  1NUB A;  3M0W A;  4OV2 A;  5ER4 X;  1A75 B;  5I2Q A;  1JC2 A;  3RM1 A;  2R2I A;  1QXP A;  2ISD A;  3PAL A;  1ALV A;  1E8A A;  3JVT C;  3SJS A;  1DJG A;  2PSR A;  3PAT A;  5GQQ C;  4OCI A;  1XFX O;  1QX5 B;  3C1V A;  5IBW A;  1B8L A;  3VRO A;  1K95 A;  1CLL A;  2LAN A;  2BCX A;  1NIW A;  4HSZ A;  4MZK A;  1ODB A;  1KFX S;  2LP3 A;  1B8C A;  4PE0 A;  1NX1 A;  1YUS A;  1CM4 A;  1MQ1 A;  3EVV A;  4QJ4 B;  1C7V A;  1JSA A;  2CTN A;  3IQO A;  1SR6 C;  3AKA A;  4GAO A;  1LXF C;  1QLS A;  1SCV A;  2K7D A;  3CTN A;  3LCP C;  2E6W A;  3JVT B;  2COL B;  2KFF A;  4MRY A;  4U8D A;  2SCP A;  2NXQ A;  2LUC A;  3FWB A;  3I5I C;  2H61 A;  1FBV A;  3MSE B;  2I94 A;  1B47 A;  1CMF A;  2KHN A;  2F2O A;  1DJW A;  2JT8 A;  2WND A;  1SL7 A;  2EC6 B;  1YX7 A;  3DVK A;  1DVI A;  1CFP A;  1GQM A;  1CB1 A;  2M9G A;  2L4H A;  5HLO A;  2WCF A;  2JC2 A;  3BYA A;  1SKT A;  1YUU A;  3SG7 A;  4YGB B;  4XJK B;  2Y1N A;  1YRU B;  1BOC A;  2KYF A;  2LC5 A;  4PHN A;  3KHE A;  1OSA A;  4DS7 A;  1N2D A;  2ZN8 A;  1NCZ A;  2HQW A;  1ZUZ A;  4I5K A;  2Y4Q A;  3JTD C;  1NP8 A;  3BOW A;  2GGZ A;  1RK9 A;  2JWW A;  3BUX B;  2MLE C;  1FPW A;  4MSP A;  2KGB C;  2LM5 A;  1PUL A;  1K93 D;  1U5I B;  4CPV A;  1IH0 A;  1K94 A;  2LVV A;  1PSR A;  1G8I A;  3NXA A;  1L2O C;  3BUO B;  2LVJ A;  3PN7 C;  1J1D A;  1SYM A;  1V1G A;  3SG3 A;  3DVM A;  1AJ4 A;  2OS8 C;  3BUW B;  2QAC A;  1BT6 A;  3O4Y A;  1DGU A;  3I5G B;  1A75 A;  4CID A;  1LVC D;  1IJ5 A;  1QVI Z;  3TUY C;  3BUN B;  1G33 A;  2L51 A;  1BU3 A;  1A03 A;  5BPJ A;  1KK7 Z;  2O5G A;  1Y1X A;  3O2P A;  1JF0 A;  1S3P A;  1XFZ O;  2BL0 B;  3TDI A;  1SY9 A;  2I2R E;  1B9A A;  1LA0 A;  2O60 A;  5G08 A;  3JTD B;  1L7Z A;  1AK8 A;  1TN4 A;  3CR5 X;  5AER A;  4PCW A;  1AJ5 A;  1XVJ A;  4WRI A;  5I2O A;  2ZND A;  1IJ6 A;  1UWO A;  2KI4 C;  2EHB A;  2NCO A;  3O6B A;  4A4B A;  5HKZ A;  1ALW A;  1QS7 A;  2JPT A;  1DJX A;  1SBJ A;  5D7F A;  2KYC A;  4YGD B;  1TCF A;  2QPT A;  3QRX A;  4DUQ A;  1CKK A;  3PSR A;  1BLQ A;  2LE9 B;  1M46 A;  3IQQ A;  2BCA A;  4PHK A;  1A2X A;  1Q80 A;  3BOW B;  1LIN A;  2VRG A;  1TNP A;  3EKJ A;  1OMR A;  4PHJ A;  1OE9 B;  1JF2 A;  1CFD A;  1K9U A;  1MWN A;  2F33 A;  2OTG B;  1MF8 B;  2KBI A;  1F55 A;  1F4O A;  2OPO A;  3ZWH A;  1BJF A;  1K2H A;  3IF7 A;  2LCP A;  2LVK A;  1UUS A;  1BR1 B;  1KFX L;  1LA3 A;  2K8M B;  1F4Q A;  1EG3 A;  1KCY A;  5JJG A;  3FIA A;  4XJK A;  4YI8 A;  1GJY A;  2CXJ A;  3VRP A;  2SAS A;  2B1U A;  2ZKM X;  1IGV A;  1KSM A;  1S36 A;  1YUT A;  4GPL B;  2LAP A;  1EH2 A;  1S5G Y;  1C07 A;  1J1E A;  2AAO A;  3I5F B;  2BEC A;  2KQY A;  1CM1 A;  2NCP A;  2LMU A;  3OHM B;  1N65 A;  1CDL A;  2G9B A;  2LMT A;  1S6C A;  4JWQ A;  3LLE A;  1XFU O;  2JU0 A;  3SG6 A;  1U5I A;  4XYN A;  1S1E A;  1SMG A;  3HX4 A;  1GGW A;  1QTX A;  2BE6 A;  2Y5I A;  2K2A A;  1DT7 B;  3NSO A;  1EJ3 A;  3VRR A;  2P6B B;  4M2Q A;  4C0L A;  1SL9 A;  1MUX A;  1QAT A;  2JT0 A;  3LL8 B;  1XFY O;  2BKH B;  4ORA B;  2ZNE A;  1YRT B;  1J7Q A;  1K96 A;  2L50 A;  4YRU A;  2GGM A;  2TN4 A;  3OX6 A;  3KEV A;  1SW8 A;  1BR4 B;  1F54 A;  2KAX A;  3BXK A;  3DD4 A;  4GGN A;  2MLF C;  1CDN A;  3TS5 C;  4D1E A;  1YVH A;  5HKW A;  2L5X B;  1DJH A;  1V1F A;  2Q4U A;  3RLZ A;  4CLN A;  1KQM C;  2JNF A;  2WCB A;  4DCK A;  4E68 A;  1MXE A;  2LMV A; 
#chains in the Genus database with same CATH topology
 1DJZ A;  1TUZ A;  1Y0V H;  2KI6 D;  5PAL A;  1EG4 A;  2M29 A;  1JBA A;  1BOD A;  1ZMZ A;  2HF5 A;  2CCM A;  3HCM A;  4PHM A;  1F71 A;  3V2L A;  4GBA A;  3PM2 A;  3DY9 A;  5DKQ A;  3D77 A;  1RRO A;  4N5X A;  2WC5 A;  1SSE B;  1IQ5 A;  3OP0 A;  1CLM A;  1RTP 1;  1SR6 B;  2F2P A;  1AUI B;  2LNK A;  1DF0 A;  2I18 A;  4YGA A;  3FWC A;  1CLB A;  4OZD A;  4I5N B;  5JOL A;  2CBL A;  2CT9 A;  2ZN9 A;  4Q04 A;  1FW4 A;  2Q91 A;  2D8N A;  4IL1 A;  3TS5 B;  3E3R A;  4NDD A;  1CFC A;  3I5I B;  1R6P A;  2LHL A;  4WQ2 A;  4FTG A;  3SG5 A;  1SCM C;  3GOF A;  1AVS A;  2LVI A;  3SG2 A;  2H2K A;  3CDN A;  2ZRT A;  3UO9 A;  4ZCV A;  3CLN A;  3OB1 B;  5AFP A;  3CZT X;  3NSK A;  3CZ0 A;  4GNK B;  1EXR A;  2JXC A;  2WCL A;  3R1V A;  4M2O A;  1SNL A;  1K9K A;  3DF0 B;  3TZ1 A;  2LP2 A;  4YI9 A;  3D75 A;  4GGF A;  3B7A A;  5HKY A;  5CSN A;  1FI5 A;  2KAV A;  5AXI A;  1A4P A;  4GFT A;  4AQI A;  5KSZ A;  1DTL A;  4M2P A;  3N7H A;  3NSL A;  2WOR A;  1BMO A;  2WC8 A;  2M97 A;  3A8R A;  1TTX A;  2I7A A;  1B4C A;  3NGV A;  3WXA A;  1IG5 A;  4CFR A;  2KQ6 A;  3S0A A;  4PAL A;  1RJV A;  3DXL A;  1QAS A;  1DJI A;  2KNE A;  2KSP A;  3DVE A;  1IRJ A;  4I5L B;  3I5H C;  1QX2 A;  3K21 A;  2F3Y A;  1OQP A;  1L2O B;  1KFU S;  5F6T A;  2JZI A;  3D10 A;  3PN7 B;  1QIV A;  1QIW A;  4IJ7 A;  1EL4 A;  5CSJ A;  4N1F A;  4PE7 A;  2OS8 B;  4I5J A;  2WCE A;  1TNW A;  4USL A;  1JFJ A;  2H8V A;  2L4I A;  4MLW A;  1J7R A;  1XFR A;  3GK2 A;  1F8H A;  1DF0 B;  1MR8 A;  3FE9 A;  1YUR A;  3TUY B;  1WLM A;  2LLT A;  4GUK A;  4F0Z B;  2K0J A;  3H4S E;  2GV5 A;  2HPS A;  2BE4 A;  1B7T Y;  1PVA A;  3AAJ A;  4YGC B;  3EK8 A;  5HYD A;  1TIZ A;  4NDC A;  1UUR A;  1A29 A;  1XYD A;  1OOI X;  1CDP A;  2QEH A;  1XK4 C;  3GK4 X;  4ORB B;  2IS9 A;  1PSB A;  3VRQ A;  1M45 A;  2KI4 B;  2JNX A;  2DOQ A;  3FE6 A;  5TNC A;  4MBE A;  3SS4 A;  3I5H B;  3WHT B;  2M0R A;  2FCD A;  3CS1 A;  2LV7 A;  4FQO A;  5KTY A;  3GK1 A;  3OX5 A;  2M7N A;  3KO0 A;  1W7J B;  1S6I A;  1UHI A;  3VRN A;  1SRA A;  2BAP A;  1H8B A;  5J3X A;  2K7B A;  2K7C A;  2L0P A;  4R1E A;  1ORG A;  2MHH A;  5DKR A;  1S5G Z;  2EGD A;  1NYA A;  1DGV A;  4P5O E;  1SPY A;  3PJI A;  1JWD A;  1TNX A;  1G4Y R;  2KOT A;  2KBM A;  4MN0 A;  4UPG A;  1FI6 A;  2AMI A;  1N0Y A;  2PMY A;  3B86 A;  1CMG A;  3SS3 A;  1YVL A;  1AP4 A;  1RWY A;  5ER5 A;  2LUX A;  4QJ5 B;  1TOP A;  5I8N A;  1D1O A;  1LS8 A;  1QJT A;  1KWO C;  2FJU B;  2JRF A;  3ICB A;  1NSH A;  3LK1 A;  1IKU A;  3BQ3 A;  2M3W A;  3DF0 A;  1PRW A;  1J55 A;  3EK7 A;  5D3O A;  4JPZ B;  3F45 A;  1NWD A;  2BBN A;  1OZS A;  3K1E A;  2EC6 C;  3BJH A;  1W7I B;  4MZJ A;  4PT1 A;  1R2U A;  1CDM A;  3SS5 A;  1AHR A;  1GGZ A;  1Y1A A;  1OMV A;  1QLK A;  2JTT A;  4HRG A;  1TCO B;  3NHI A;  4HRH A;  1NPQ A;  4MVF A;  3OGN A;  4YBH B;  3CR2 A;  4NQG A;  3S0D A;  4JD9 A;  2K2F A;  4MEW A;  4INX A;  3B6X A;  4TNC A;  2MRD A;  1WDC C;  1OOF A;  1KSO A;  2E30 A;  2JTZ A;  2P70 A;  5I94 A;  2KLD A;  4CFQ A;  2HQ8 A;  1JUO A;  2M1K B;  1K8U A;  3WHU B;  4HRE E;  2M8U A;  4PE4 A;  1MHO A;  2PAS A;  4PDZ A;  1KWO B;  2K60 A;  1C7W A;  2FOT A;  2K7O A;  1X02 A;  2M7L A;  4C0J A;  1YR5 A;  2KFG A;  3S0B A;  4WQ3 A;  4DRW A;  2QEV A;  1K9P A;  2LLU A;  2PRU A;  2WC6 A;  3D0Y A;  3S0F A;  4P2Y B;  1WRZ A;  2BBM A;  2JT3 A;  2BCB A;  1M63 B;  4QJ3 B;  1TWO A;  3VB1 A;  1JFK A;  1PVB A;  2ZRS A;  1PAL A;  2BKI B;  2JQ6 A;  2PAL A;  2LLS A;  1NX0 A;  3FS7 A;  1UP5 A;  2M49 B;  1S26 D;  4KYN A;  1KQM B;  1XA5 A;  3PFV A;  3I5G C;  1WDC B;  1DJY A;  3KF9 A;  1KK8 C;  1KFU L;  2F3Z A;  1Y1U A;  3CGA A;  1K90 D;  1WLZ A;  3D76 A;  5AEQ A;  1DMO A;  2V53 A;  1WY9 A;  4OR9 B;  1FF1 A;  2FCE A;  2BL0 C;  1TUJ A;  2KDH A;  2NZ0 A;  3SIB A;  1QV1 A;  2QEO A;  2Y1M A;  2H61 C;  1B8R A;  2NLN A;  3DYE A;  2RGI A;  4FQT A;  1IIO A;  3KPX A;  2WOS A;  1QV0 A;  1MXL C;  4YGE B;  5CPV A;  5AAN A;  4AQJ A;  1HT9 A;  3EKH A;  3OB2 B;  2JXL A;  1WRL A;  1Y6W A;  2M1U A;  3O78 A;  1Z4H A;  2FJY A;  2BNX A;  2MA2 A;  4A4C A;  5DKN A;  1KQV A;  1IWQ A;  2CNP A;  1NX2 A;  1VRK A;  2L2E A;  1M31 A;  1ZAC A;  4OVN F;  1SCM B;  3CWG A;  1CFF A;  1QX7 A;  1XO5 A;  1XK4 A;  4JQ0 D;  4BY4 A;  3B87 A;  2PVB A;  1J7O A;  2JOJ A;  1J7P A;  2JUL A;  1QVI Y;  5FYX A;  5FI7 A;  1YTZ C;  2KI6 C;  1BG1 A;  4JKT A;  1KK8 B;  4MRX A;  4OKH A;  4C0K A;  5I2L A;  2KFH A;  3R1O A;  4ICB A;  2MAZ A;  1DQE A;  1KK7 Y;  1OMD A;  1OW4 A;  1XFW O;  4BY5 A;  1IQ3 A;  1DEK A;  1LKJ A;  1WRK A;  3NSI A;  2AUC A;  3D0Y B;  3PLF B;  1OOG A;  1H4B A;  2OTG C;  1REC A;  2KAY A;  4L9M A;  1HQV A;  1SK6 D;  1B7T Z;  1TRF A;  1UHK A;  2ZFD A;  3PM8 A;  5CSF A;  3WNX B;  2L98 A;  4F7F A;  1DEL A;  4AOM A;  1ZFS A;  2K61 A;  3BFH A;  5B8I B;  5HL1 A;  3AKB A;  3EVU A;  1UHJ A;  2A4J A;  3CR4 X;  3LK0 A;  3D78 A;  2LHI A;  2F8P A;  1PK0 D;  1YX8 A;  2L5Y A;  1UHH A;  3EK4 A;  3VGO A;  1S6J A;  1TNQ A;  5D69 A;  1T14 A;  4GGF C;  4NDB A;  5HLV A;  3SIA A;  3RZS A;  4DIR A;  3BUM B;  3ZNI A;  1ZOT B;  5KU1 A;  1RFJ A;  4MZL A;  2WCJ A;  3DVJ A;  1NCY A;  1C3Z A;  2G2B A;  1OZO A;  1F70 A;  2MJW B;  3A4U B;  2KGR A;  2HET A;  3I5F C;  5K89 A;  1CNP A;  3SG4 A;  1OOJ A;  1NX3 A;  1M39 A;  4N1G A;  3TDZ A;  5CSI A;  4ZCU A;  3TDU A;  1CTR A;  3BFA A;  1B1G A;  3BFB A;  3AAK A;  1XFV O;  1UHN A;  4ORC B;  3IVT A;  1NCX A;  1BF5 A;  4PE1 A;  3EVR A;  1SL8 A;  1NUB A;  3M0W A;  4OV2 A;  5ER4 X;  1A75 B;  3L4A A;  5I2Q A;  1JC2 A;  3RM1 A;  2R2I A;  1QXP A;  2ISD A;  3PAL A;  1ALV A;  1E8A A;  3JVT C;  3SJS A;  1DJG A;  2PSR A;  3PAT A;  5GQQ C;  2GTE A;  4OCI A;  1XFX O;  1QX5 B;  3C1V A;  5IBW A;  3S0G A;  1B8L A;  3Q8I A;  3L47 A;  3VRO A;  1K95 A;  1CLL A;  2LAN A;  2BCX A;  3FE8 A;  2P71 A;  1NIW A;  4HSZ A;  2KLE A;  1Z2C B;  4MZK A;  5DIC A;  1ODB A;  1KFX S;  3OBV A;  2LP3 A;  1B8C A;  2WCK A;  4PE0 A;  1NX1 A;  1YUS A;  1CM4 A;  1MQ1 A;  3EVV A;  4QJ4 B;  1C7V A;  1JSA A;  2CTN A;  3IQO A;  1SR6 C;  2WCH A;  3AKA A;  4GAO A;  1LXF C;  1QLS A;  1SCV A;  2K7D A;  3CTN A;  3LCP C;  2E6W A;  3JVT B;  2COL B;  2KFF A;  2MBX A;  4MRY A;  4U8D A;  2SCP A;  2NXQ A;  2LUC A;  3FWB A;  3I5I C;  2H61 A;  3QME A;  1FBV A;  3MSE B;  2I94 A;  1B47 A;  1CMF A;  2KHN A;  2F2O A;  2YGU A;  1DC1 A;  1DJW A;  2JT8 A;  2WND A;  1SL7 A;  2EC6 B;  1YX7 A;  3DVK A;  1DVI A;  1CFP A;  1GQM A;  1CB1 A;  2M9G A;  2L4H A;  5HLO A;  2WCF A;  2JC2 A;  3BYA A;  2L2C A;  1SKT A;  1YUU A;  3SG7 A;  4YGB B;  4XJK B;  3O4X A;  2Y1N A;  1YRU B;  1BOC A;  1W9Z A;  2KYF A;  2LC5 A;  4PHN A;  3KHE A;  1OSA A;  4DS7 A;  1N2D A;  2ZN8 A;  1NCZ A;  2HQW A;  3EG5 B;  1ZUZ A;  4I5K A;  2ERB A;  2Y4Q A;  3NHT A;  3JTD C;  1NP8 A;  3BOW A;  2GGZ A;  1RK9 A;  2JWW A;  3BUX B;  2MLE C;  3R72 A;  1FPW A;  4MSP A;  2KGB C;  2LM5 A;  1QWV A;  1PUL A;  1K93 D;  1U5I B;  4CPV A;  1IH0 A;  1K94 A;  3D74 A;  2LVV A;  1PSR A;  1G8I A;  3NXA A;  1L2O C;  3BUO B;  2LVJ A;  3PN7 C;  1J1D A;  1SYM A;  1V1G A;  3SG3 A;  3DVM A;  1AJ4 A;  2OS8 C;  3BUW B;  2QAC A;  1BT6 A;  3O4Y A;  1DGU A;  3I5G B;  1A75 A;  3CYZ A;  4CID A;  5EL2 A;  1LVC D;  1IJ5 A;  1QVI Z;  3TUY C;  3BUN B;  1G33 A;  2L51 A;  1BU3 A;  5FI6 A;  1A03 A;  5BPJ A;  1KK7 Z;  2O5G A;  1Y1X A;  3O2P A;  1JF0 A;  1S3P A;  1XFZ O;  2BL0 B;  3TDI A;  1SY9 A;  4ETO A;  2I2R E;  1B9A A;  1LA0 A;  2O60 A;  5G08 A;  3JTD B;  1L7Z A;  1AK8 A;  1TN4 A;  1OOH A;  3CR5 X;  5AER A;  4PCW A;  1AJ5 A;  1XVJ A;  4WRI A;  5I2O A;  2ZND A;  1IJ6 A;  1UWO A;  2KI4 C;  2EHB A;  2PYQ A;  5FI2 A;  2NCO A;  3O6B A;  4A4B A;  5HKZ A;  1ALW A;  1QS7 A;  2JPT A;  1DJX A;  1SBJ A;  5D7F A;  3CZ1 A;  2KYC A;  4YGD B;  1TCF A;  2QPT A;  3QRX A;  4DUQ A;  1CKK A;  3PSR A;  1BLQ A;  2LE9 B;  1M46 A;  2PQL A;  3IQQ A;  2BCA A;  4PHK A;  1C3Y A;  3CZ2 A;  1A2X A;  1Q80 A;  3R1P A;  3BOW B;  1LIN A;  2VRG A;  3UNW A;  1TNP A;  3EKJ A;  1OMR A;  4PHJ A;  1OE9 B;  1JF2 A;  1CFD A;  1K9U A;  1MWN A;  2F33 A;  2OTG B;  1MF8 B;  3B88 A;  2KBI A;  1F55 A;  1F4O A;  2OPO A;  3ZWH A;  3D73 A;  1BJF A;  1K2H A;  3IF7 A;  2LCP A;  2LVK A;  1UUS A;  1P28 A;  1BR1 B;  1KFX L;  1LA3 A;  2K8M B;  1F4Q A;  1EG3 A;  1KCY A;  5JJG A;  3FIA A;  4XJK A;  4YI8 A;  1GJY A;  2CXJ A;  2QDI A;  3VRP A;  2SAS A;  2B1U A;  3S0E A;  2ZKM X;  1IGV A;  1KSM A;  1S36 A;  1YUT A;  4GPL B;  2KPH A;  2LAP A;  1EH2 A;  1S5G Y;  1C07 A;  1J1E A;  2AAO A;  3I5F B;  2BEC A;  2KQY A;  1CM1 A;  2NCP A;  2LMU A;  3CAB A;  3OHM B;  1N65 A;  1CDL A;  2G9B A;  2LMT A;  1S6C A;  4INW A;  4JWQ A;  3LLE A;  1XFU O;  2JU0 A;  2QEB A;  1U5I A;  3SG6 A;  4XYN A;  1S1E A;  1SMG A;  3HX4 A;  1GGW A;  1QTX A;  2BE6 A;  2Y5I A;  2K2A A;  1DT7 B;  3L4L A;  1EJ3 A;  3NSO A;  2P6B B;  4M2Q A;  3VRR A;  4C0L A;  1SL9 A;  1MUX A;  1QAT A;  2JT0 A;  3LL8 B;  1XFY O;  2BKH B;  4ORA B;  2ZNE A;  1YRT B;  1J7Q A;  1K96 A;  2JPO A;  2L50 A;  2GGM A;  2TN4 A;  3OX6 A;  3KEV A;  4YRU A;  1SW8 A;  1BR4 B;  1F54 A;  2KAX A;  3BXK A;  3DD4 A;  4GGN A;  2MLF C;  2WCM A;  1CDN A;  3TS5 C;  4D1E A;  1YVH A;  5HKW A;  2L5X B;  3DZT A;  1GM0 A;  1DJH A;  1V1F A;  2Q4U A;  3RLZ A;  4CLN A;  1KQM C;  2JNF A;  2WCB A;  4DCK A;  4E68 A;  1MXE A;  2LMV A; 
#chains in the Genus database with same CATH homology
 1DJZ A;  1Y0V H;  2KI6 D;  5PAL A;  1EG4 A;  2M29 A;  1JBA A;  1BOD A;  1ZMZ A;  2HF5 A;  2CCM A;  3HCM A;  4PHM A;  1F71 A;  4GBA A;  5DKQ A;  1RRO A;  4N5X A;  1IQ5 A;  3OP0 A;  1CLM A;  1RTP 1;  1SR6 B;  2F2P A;  1AUI B;  2LNK A;  1DF0 A;  2I18 A;  4YGA A;  3FWC A;  1CLB A;  4I5N B;  5JOL A;  2CBL A;  2CT9 A;  2ZN9 A;  4Q04 A;  1FW4 A;  2Q91 A;  2D8N A;  4IL1 A;  3TS5 B;  3E3R A;  4NDD A;  1CFC A;  3I5I B;  1R6P A;  2LHL A;  4WQ2 A;  4FTG A;  3SG5 A;  1SCM C;  3GOF A;  1AVS A;  2LVI A;  3SG2 A;  2H2K A;  2ZRT A;  4ZCV A;  3CLN A;  3OB1 B;  5AFP A;  3CZT X;  3NSK A;  4GNK B;  1EXR A;  2JXC A;  4M2O A;  1SNL A;  1K9K A;  3DF0 B;  3TZ1 A;  2LP2 A;  4YI9 A;  4GGF A;  5HKY A;  5CSN A;  1FI5 A;  2KAV A;  5AXI A;  1A4P A;  4GFT A;  4AQI A;  5KSZ A;  1DTL A;  4M2P A;  3NSL A;  2WOR A;  1BMO A;  2WC8 A;  2M97 A;  3A8R A;  1TTX A;  2I7A A;  1B4C A;  3WXA A;  1IG5 A;  4CFR A;  2KQ6 A;  4PAL A;  1RJV A;  1QAS A;  1DJI A;  2KNE A;  2KSP A;  3DVE A;  1IRJ A;  4I5L B;  3I5H C;  1QX2 A;  3K21 A;  2F3Y A;  1OQP A;  1L2O B;  1KFU S;  5F6T A;  2JZI A;  3D10 A;  3PN7 B;  1QIV A;  1QIW A;  1EL4 A;  5CSJ A;  4N1F A;  4PE7 A;  2OS8 B;  4I5J A;  2WCE A;  1TNW A;  4USL A;  1JFJ A;  2L4I A;  4MLW A;  1J7R A;  3GK2 A;  1F8H A;  1DF0 B;  1MR8 A;  1YUR A;  3TUY B;  1WLM A;  2LLT A;  4GUK A;  4F0Z B;  2K0J A;  3H4S E;  2GV5 A;  2HPS A;  2BE4 A;  1B7T Y;  1PVA A;  3AAJ A;  4YGC B;  3EK8 A;  5HYD A;  1TIZ A;  4NDC A;  1UUR A;  1A29 A;  1XYD A;  1CDP A;  1XK4 C;  3GK4 X;  4ORB B;  2IS9 A;  1PSB A;  3VRQ A;  1M45 A;  2KI4 B;  2JNX A;  2DOQ A;  5TNC A;  4MBE A;  3WHT B;  3I5H B;  2M0R A;  2FCD A;  3CS1 A;  2LV7 A;  4FQO A;  5KTY A;  3GK1 A;  3OX5 A;  2M7N A;  3KO0 A;  1W7J B;  1S6I A;  1UHI A;  3VRN A;  1SRA A;  1H8B A;  5J3X A;  2K7B A;  2K7C A;  2L0P A;  4R1E A;  2MHH A;  5DKR A;  1S5G Z;  2EGD A;  1NYA A;  1DGV A;  4P5O E;  1SPY A;  1JWD A;  1TNX A;  1G4Y R;  2KOT A;  2KBM A;  4MN0 A;  4UPG A;  1FI6 A;  2AMI A;  1N0Y A;  2PMY A;  1CMG A;  1AP4 A;  1YVL A;  1RWY A;  5ER5 A;  2LUX A;  4QJ5 B;  1TOP A;  5I8N A;  1D1O A;  1QJT A;  1KWO C;  2FJU B;  2JRF A;  3ICB A;  1NSH A;  3LK1 A;  1IKU A;  3BQ3 A;  2M3W A;  3DF0 A;  1PRW A;  1J55 A;  3EK7 A;  4JPZ B;  3F45 A;  1NWD A;  2BBN A;  1OZS A;  2EC6 C;  1W7I B;  4MZJ A;  1R2U A;  1CDM A;  1AHR A;  1GGZ A;  1Y1A A;  1OMV A;  1QLK A;  2JTT A;  4HRG A;  1TCO B;  4HRH A;  4MVF A;  1NPQ A;  4YBH B;  2MBX A;  4ETO A;  3CR2 A;  4NQG A;  2K2F A;  4MEW A;  4TNC A;  2MRD A;  1WDC C;  2E30 A;  1KSO A;  2JTZ A;  4CFQ A;  2HQ8 A;  1JUO A;  2M1K B;  1K8U A;  3WHU B;  4HRE E;  2M8U A;  4PE4 A;  1MHO A;  2PAS A;  4PDZ A;  1KWO B;  1C7W A;  2FOT A;  2K7O A;  1X02 A;  2M7L A;  4C0J A;  1YR5 A;  2KFG A;  4WQ3 A;  4DRW A;  1K9P A;  2LLU A;  2PRU A;  3D0Y A;  4P2Y B;  1WRZ A;  2BBM A;  2JT3 A;  2BCB A;  1M63 B;  4QJ3 B;  1JFK A;  1PVB A;  2ZRS A;  1PAL A;  2BKI B;  2JQ6 A;  2PAL A;  2LLS A;  1NX0 A;  3FS7 A;  1UP5 A;  2M49 B;  1S26 D;  1KQM B;  1XA5 A;  3PFV A;  3I5G C;  1WDC B;  1DJY A;  3KF9 A;  1KK8 C;  1KFU L;  2F3Z A;  1Y1U A;  3CGA A;  1K90 D;  1WLZ A;  5AEQ A;  1DMO A;  2V53 A;  1WY9 A;  4OR9 B;  1FF1 A;  2FCE A;  2BL0 C;  2NZ0 A;  2KDH A;  3SIB A;  1QV1 A;  2Y1M A;  2H61 C;  1B8R A;  2NLN A;  2RGI A;  3KPX A;  2WOS A;  1QV0 A;  1MXL C;  4YGE B;  5CPV A;  5AAN A;  4AQJ A;  1HT9 A;  3EKH A;  3OB2 B;  2JXL A;  1WRL A;  1Y6W A;  2M1U A;  3O78 A;  4A4C A;  2MA2 A;  5DKN A;  1KQV A;  1IWQ A;  2CNP A;  1NX2 A;  1VRK A;  2L2E A;  1M31 A;  1ZAC A;  4OVN F;  1SCM B;  3CWG A;  1CFF A;  1QX7 A;  1XO5 A;  1XK4 A;  4JQ0 D;  4BY4 A;  1J7O A;  2PVB A;  2JOJ A;  1J7P A;  2JUL A;  1QVI Y;  5FYX A;  1YTZ C;  2KI6 C;  1BG1 A;  1KK8 B;  4MRX A;  4OKH A;  4C0K A;  5I2L A;  2KFH A;  4ICB A;  2MAZ A;  1KK7 Y;  1OMD A;  1XFW O;  4BY5 A;  1IQ3 A;  1LKJ A;  1WRK A;  3NSI A;  2AUC A;  3D0Y B;  3PLF B;  1H4B A;  2OTG C;  1REC A;  2KAY A;  4L9M A;  1HQV A;  1SK6 D;  1B7T Z;  1TRF A;  1UHK A;  2ZFD A;  3PM8 A;  5CSF A;  3WNX B;  2L98 A;  4AOM A;  1ZFS A;  2K61 A;  5B8I B;  3AKB A;  3EVU A;  1UHJ A;  2A4J A;  3CR4 X;  3LK0 A;  2LHI A;  2F8P A;  1PK0 D;  1YX8 A;  3VGO A;  1UHH A;  3EK4 A;  1S6J A;  1TNQ A;  5D69 A;  4GGF C;  4NDB A;  5HLV A;  3SIA A;  4DIR A;  3BUM B;  3ZNI A;  1ZOT B;  5KU1 A;  1RFJ A;  4MZL A;  3DVJ A;  1NCY A;  2G2B A;  1OZO A;  1F70 A;  2MJW B;  3A4U B;  2KGR A;  2HET A;  3I5F C;  5K89 A;  1CNP A;  3SG4 A;  1OOJ A;  1NX3 A;  1M39 A;  4N1G A;  3TDZ A;  5CSI A;  4ZCU A;  3TDU A;  1CTR A;  1B1G A;  3AAK A;  1XFV O;  1UHN A;  4ORC B;  1NCX A;  1BF5 A;  4PE1 A;  3EVR A;  1SL8 A;  1NUB A;  3M0W A;  4OV2 A;  5ER4 X;  1A75 B;  5I2Q A;  1JC2 A;  3RM1 A;  2R2I A;  1QXP A;  2ISD A;  3PAL A;  1ALV A;  1E8A A;  3JVT C;  3SJS A;  1DJG A;  2PSR A;  3PAT A;  5GQQ C;  4OCI A;  1XFX O;  1QX5 B;  3C1V A;  5IBW A;  1B8L A;  3VRO A;  1K95 A;  1CLL A;  2LAN A;  2BCX A;  1NIW A;  4HSZ A;  4MZK A;  1ODB A;  1KFX S;  2LP3 A;  1B8C A;  4PE0 A;  1NX1 A;  1YUS A;  1CM4 A;  1MQ1 A;  3EVV A;  4QJ4 B;  1C7V A;  1JSA A;  2CTN A;  3IQO A;  1SR6 C;  3AKA A;  4GAO A;  1LXF C;  1QLS A;  1SCV A;  2K7D A;  3CTN A;  3LCP C;  2E6W A;  3JVT B;  2COL B;  2KFF A;  4MRY A;  4U8D A;  2SCP A;  2NXQ A;  2LUC A;  3FWB A;  3I5I C;  2H61 A;  1FBV A;  3MSE B;  2I94 A;  1B47 A;  1CMF A;  2KHN A;  2F2O A;  1DJW A;  2JT8 A;  2WND A;  1SL7 A;  2EC6 B;  1YX7 A;  3DVK A;  1DVI A;  1CFP A;  1GQM A;  1CB1 A;  2M9G A;  2L4H A;  5HLO A;  2WCF A;  2JC2 A;  3BYA A;  1SKT A;  1YUU A;  3SG7 A;  4YGB B;  4XJK B;  2Y1N A;  1YRU B;  1BOC A;  2KYF A;  2LC5 A;  4PHN A;  3KHE A;  1OSA A;  4DS7 A;  1N2D A;  2ZN8 A;  1NCZ A;  2HQW A;  1ZUZ A;  4I5K A;  2Y4Q A;  3JTD C;  1NP8 A;  3BOW A;  2GGZ A;  1RK9 A;  2JWW A;  3BUX B;  2MLE C;  1FPW A;  4MSP A;  2KGB C;  2LM5 A;  1PUL A;  1K93 D;  1U5I B;  4CPV A;  1IH0 A;  1K94 A;  2LVV A;  1PSR A;  1G8I A;  3NXA A;  1L2O C;  3BUO B;  2LVJ A;  3PN7 C;  1J1D A;  1SYM A;  1V1G A;  3SG3 A;  3DVM A;  1AJ4 A;  2OS8 C;  3BUW B;  2QAC A;  1BT6 A;  3O4Y A;  1DGU A;  3I5G B;  1A75 A;  4CID A;  1LVC D;  1IJ5 A;  1QVI Z;  3TUY C;  3BUN B;  1G33 A;  2L51 A;  1BU3 A;  1A03 A;  5BPJ A;  1KK7 Z;  2O5G A;  1Y1X A;  3O2P A;  1JF0 A;  1S3P A;  1XFZ O;  2BL0 B;  3TDI A;  1SY9 A;  2I2R E;  1B9A A;  1LA0 A;  2O60 A;  5G08 A;  3JTD B;  1L7Z A;  1AK8 A;  1TN4 A;  3CR5 X;  5AER A;  4PCW A;  1AJ5 A;  1XVJ A;  4WRI A;  5I2O A;  2ZND A;  1IJ6 A;  1UWO A;  2KI4 C;  2EHB A;  2NCO A;  3O6B A;  4A4B A;  5HKZ A;  1ALW A;  1QS7 A;  2JPT A;  1DJX A;  1SBJ A;  5D7F A;  2KYC A;  4YGD B;  1TCF A;  2QPT A;  3QRX A;  4DUQ A;  1CKK A;  3PSR A;  1BLQ A;  2LE9 B;  1M46 A;  3IQQ A;  2BCA A;  4PHK A;  1A2X A;  1Q80 A;  3BOW B;  1LIN A;  2VRG A;  1TNP A;  3EKJ A;  1OMR A;  4PHJ A;  1OE9 B;  1JF2 A;  1CFD A;  1K9U A;  1MWN A;  2F33 A;  2OTG B;  1MF8 B;  2KBI A;  1F55 A;  1F4O A;  2OPO A;  3ZWH A;  1BJF A;  1K2H A;  3IF7 A;  2LCP A;  2LVK A;  1UUS A;  1BR1 B;  1KFX L;  1LA3 A;  2K8M B;  1F4Q A;  1EG3 A;  1KCY A;  5JJG A;  3FIA A;  4XJK A;  4YI8 A;  1GJY A;  2CXJ A;  3VRP A;  2SAS A;  2B1U A;  2ZKM X;  1IGV A;  1KSM A;  1S36 A;  1YUT A;  4GPL B;  2LAP A;  1EH2 A;  1S5G Y;  1C07 A;  1J1E A;  2AAO A;  3I5F B;  2BEC A;  2KQY A;  1CM1 A;  2NCP A;  2LMU A;  3OHM B;  1N65 A;  1CDL A;  2G9B A;  2LMT A;  1S6C A;  4JWQ A;  3LLE A;  1XFU O;  2JU0 A;  3SG6 A;  1U5I A;  4XYN A;  1S1E A;  1SMG A;  3HX4 A;  1GGW A;  1QTX A;  2BE6 A;  2Y5I A;  2K2A A;  1DT7 B;  3NSO A;  1EJ3 A;  3VRR A;  2P6B B;  4M2Q A;  4C0L A;  1SL9 A;  1MUX A;  1QAT A;  2JT0 A;  3LL8 B;  1XFY O;  2BKH B;  4ORA B;  2ZNE A;  1YRT B;  1J7Q A;  1K96 A;  2L50 A;  4YRU A;  2GGM A;  2TN4 A;  3OX6 A;  3KEV A;  1SW8 A;  1BR4 B;  1F54 A;  2KAX A;  3BXK A;  3DD4 A;  4GGN A;  2MLF C;  1CDN A;  3TS5 C;  4D1E A;  1YVH A;  5HKW A;  2L5X B;  1DJH A;  1V1F A;  2Q4U A;  3RLZ A;  4CLN A;  1KQM C;  2JNF A;  2WCB A;  4DCK A;  4E68 A;  1MXE A;  2LMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...