4CTIA

Escherichia coli envz histidine kinase catalytic part fused to archaeoglobus fulgidus af1503 hamp domain
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
257
structure length
207
Chain Sequence
TITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEDLNAVLGEVIAEIETALYKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPAWFQVEDDGPSGTGLGLAIVQRIVDNHNGMLELGLSIRAWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic Snapshot of the Escherichia Coli Envz Histidine Kinase in an Active Conformation.
pubmed doi rcsb
molecule tags Signaling protein
source organism Archaeoglobus fulgidus
molecule keywords OSMOLARITY SENSOR PROTEIN ENVZ, AF1503
total genus 66
structure length 207
sequence length 257
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...