4CUOA

Banyan peroxidase with glycosylation
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
306
structure length
305
Chain Sequence
QLTPTFYRSTCPNVTSIVRGVIQDALQTDLRIPASLIRLHFHDCFVNGCDGSLLLDNSDTIESEKQAAPNNNSARGFDVVDNIKTAVENACPGVVSCADILTIAAEQSVWLSGGPSWPVPLGRRDSLTANRTLANQTLPSPFLTLDQLKTDFSDQGLNTTDLVALSGAHTFGRAQCQFFSQRLYNFSATGSPDPTLNTTLLETLRNICPQGGNGSTITNLDQTTPDAFDNKYFSNLQTQYGILQTDQELFSTKGANTTAIVTKFSANQSAFFNSFVASMIKMGNIGVLTDEGEIRSNCRSVNGGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Post-Translational Modification and Extended Glycosylation Pattern of a Plant Latex Peroxidase of Native Source Characterized by X-Ray Crystallography.
pubmed doi rcsb
molecule keywords BANYAN PEROXIDASE
molecule tags Oxidoreductase
total genus 125
structure length 305
sequence length 306
ec nomenclature ec 1.11.1.7: Peroxidase.
pdb deposition date 2014-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00141 peroxidase Peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.420.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 2 Peroxidase, domain 2 4cuoA02
1.10.520.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 Peroxidase; domain 1 4cuoA01
4JPTA 5AOGA 1AEHA 4P4QA 2RC2X 1CPEA 2V23A 5FNBA 1AESA 4OQ7A 5ALAA 4A7MA 1H5FA 2B10A 1LGAA 1DJ5A 2EUQA 4JMVA 5JQRA 3X16A 2GHDX 4JMAA 1YZRA 1CCJA 5JHYA 4A71A 1W4YA 5KQKA 3ZCYA 2CCPA 2RBTX 4JMSA 5L05A 1ITKA 3HDLA 2RBXX 1JDRA 1BJ9A 5KSFA 1AETA 2CCAA 2V2EA 4XV6A 1U2JA 1QGJA 1AEKA 3FKGA 1UB2A 1B80A 2GHCX 1CMPA 4BLNA 4A6ZA 2B0ZA 4NVBA 3RRWA 1LY8A 1U74A 1GZBA 1KXMA 1H5EA 3M2DA 1LLPA 4BM4A 1CMQA 4NVGB 4BLYA 5EJXA 1H5MA 1HSRA 1U2LA 4G05A 5CIBA 1SOGA 2PCBA 5D6MA 5KQ2A 1AEMA 2VCNA 4JQKA 5SYXA 1SBMA 5ABOA 2ANZA 2AS3A 5ABQA 1U75A 1CCGA 1KXNA 2PCCA 2EUUA 4USCA 4JMTA 4BM1A 2YCGA 3M2FA 1H5CA 1B82A 1A2FA 5EJTA 4CZQA 4CCXA 5SYKA 3FM1A 2RBVX 1H58A 4NVAA 5SXQA 4NVOB 2BOQA 3CCPA 5SX0B 4BLLA 5AMMA 2Y5AA 5SW5A 3M2HA 1H5IA 4JM5A 3UT2A 4JQJA 4A5GA 1RYCA 2RBYX 4FCNA 2EUPA 3UW8A 1W4WA 4NVNB 5KQ6A 1OAFA 1Z53A 5CICA 1CYFA 1BEJA 3FM4A 1S73A 4CVIA 1AEBA 4NVJB 1KOKA 1CPGA 1LYCA 4NVDA 4JQNA 4CUOA 1BGPA 1KRJA 1MN1A 1CCKA 4JM8A 5SXRA 1LY9A 2JTIA 7CCPA 3ATJA 1CMUA 2E3BA 2GHEX 2GB8A 5SXXA 3WXOA 1ARVA 3VLKA 1CK6A 1SDQA 3M5QA 2CCDA 1MN2A 2XI6A 5SYVA 5CIDA 5SYLA 1H5HA 1JCIA 5KQIA 2AS6A 4NVMB 2B11A 1MKQA 1H5JA 4BM3A 1CPDA 5SW6A 5SYUA 3VLMA 4ATJA 2XIFA 1LYKA 4FDQA 4BLXA 1A2GA 1BVAA 3FM6A 5SYWA 2XIHA 3VLJA 5SYJA 1H3JA 2GHKX 2X08A 2CYPA 1CCCA 2EURA 3M26A 1FHFA 3RIWA 4CVJA 4NVFA 1YZPA 1AEUA 1BESA 1YYGA 1APXA 2E3AA 3FMUA 5SXTA 2ATJA 4NVKB 1H5DA 4BLKA 2WD4A 1CCAA 1SJ2A 1AC8A 1DSEA 1H5KA 1ARWA 1DSPA 1C8IA 4C51A 1GWUA 4FCSA 1GX2A 5CJHA 3M27A 1IYNA 1ARUA 2N18A 5SX7A 1S6VA 1AEQA 1CCBA 5KQHA 3M25A 5SXSA 2B12A 2W23A 3CCXA 1ARXA 5JHXA 1QO4A 4C50A 5SX6A 3M8MA 5SX3A 2AS1A 4XVAA 5CIHA 6CCPA 4NVIB 4JMBA 5CCPA 2Y6AA 1OAGA 2RBZX 4JMWA 2RBWX 5SX0A 2GHHX 1BEQA 5KSKA 1AEOA 1AC4A 3RIVA 1H5LA 5SW4A 2GGNX 2VNZX 1ZBZA 1GW2A 2VO2X 1AA4A 5SX2A 4CZNA 5KQ3A 1AENA 4NVEA 1PA2A 2RC0X 4JPLA 4PAEA 2CL4X 4XV8A 3R98A 4BM0A 4GEDA 3ZCHA 2X07A 5CIFA 3VLLA 1DS4A 4JMZA 2AS4A 1CCLA 3M2EA 3M2GA 1CCEA 3E2OA 2IA8A 1MNPA 1QPAA 2EUSA 1CPFA 1GWTA 1AEEA 2VCFX 5SYYA 1CCPA 3ZCGA 5JPRA 5CIGA 1AEJA 1ZBYA 2VCSA 3E2NA 2E39A 2CEPA 5SYHA 2BCNA 3WNUA 3FJWA 1ARPA 2Y6BA 4NVHB 4XV7A 1SCHA 3M2IA 2XJ8A 4CZRA 3M2CA 3VLIA 4NVCA 3Q3UA 1DSGA 5AL9A 1DJ1A 7ATJA 3M23A 1STQA 1EBEA 4JM9A 2AS2A 2YLJA 4JPUA 5SX1A 3R99A 5CIEA 4BLZA 1AEVA 3VLHA 5FNEA 3M28A 4JQMA 1ATJA 2RBUX 4CZPA 4JB4A 2XJ5A 1MK8A 4XV5A 2AQDA 5ABNA 2ICVA 1AEGA 2EUNA 5L02A 1AEDA 2VKAA 1BEPA 4NFGA 1H57A 2XILA 1GZAA 1H5GA 1CCIA 5JHZA 2RC1X 4FEFA 3EXBA 1U2KA 2VNXX 1V0HX 6ATJA 4JM6A 1BEKA 1GWOA 1DSOA 1DCCA 2XJ6A 2EUTA 4CCPA 1ML2A 3M29A 5SXWA 3M2BA 4XV4A 1H55A 5SYIA 5L86A 4CZOA 1CMTA 1B85A 4A78A 1ARYA 1BEMA 1AEFA 1H5AA 4JN0A 1MKRA 1HCHA 3M2AA 4NVLA 4BM2A 5KQ0A 1KZMA 2EUOA 1YYDA
chains in the Genus database with same CATH superfamily
4JPTA 5AOGA 1AEHA 4P4QA 2RC2X 1CPEA 2V23A 5FNBA 1AESA 4OQ7A 5ALAA 4A7MA 1H5FA 2B10A 1LGAA 1DJ5A 2EUQA 4JMVA 5JQRA 3X16A 1ABVA 2GHDX 4JMAA 1YZRA 1CCJA 5JHYA 4A71A 1W4YA 5KQKA 2BO5A 3ZCYA 2CCPA 2RBTX 4JMSA 5L05A 1ITKA 3HDLA 2RBXX 1JDRA 1BJ9A 5KSFA 1AETA 2CCAA 2V2EA 4XV6A 1U2JA 1QGJA 1AEKA 3FKGA 1UB2A 1B80A 2GHCX 1CMPA 4H79A 4BLNA 4A6ZA 2B0ZA 4NVBA 3RRWA 1LY8A 1U74A 1GZBA 1KXMA 1H5EA 3M2DA 1LLPA 4BM4A 1CMQA 4NVGB 4JZAA 4BLYA 5EJXA 1H5MA 1HSRA 1U2LA 4G05A 5CIBA 1SOGA 2PCBA 5D6MA 5KQ2A 1AEMA 2VCNA 4JQKA 5SYXA 1SBMA 5ABOA 2ANZA 2AS3A 5ABQA 1U75A 1CCGA 1KXNA 2PCCA 2EUUA 4USCA 4JMTA 4BM1A 2YCGA 3M2FA 1H5CA 1B82A 1A2FA 5EJTA 4CZQA 4CCXA 5SYKA 3FM1A 2RBVX 1H58A 4NVAA 5SXQA 4NVOB 2BOQA 3CCPA 5SX0B 4BLLA 5AMMA 2Y5AA 5SW5A 3WA8A 3M2HA 1H5IA 4JM5A 3UT2A 4JQJA 4A5GA 1RYCA 2RBYX 4FCNA 2EUPA 3UW8A 1W4WA 4NVNB 5KQ6A 1OAFA 1Z53A 5CICA 1CYFA 1BEJA 3FM4A 1S73A 4CVIA 1AEBA 4NVJB 1KOKA 1CPGA 1LYCA 4NVDA 4JQNA 4CUOA 1BGPA 1KRJA 1MN1A 1CCKA 4JM8A 5SXRA 1LY9A 2JTIA 7CCPA 3ATJA 1CMUA 2E3BA 2GHEX 2GB8A 5SXXA 3WXOA 1ARVA 3VLKA 1CK6A 1SDQA 2ZCAA 3M5QA 2CCDA 1MN2A 4QYZB 2XI6A 5SYVA 3X1LF 5CIDA 5SYLA 5H9EB 1H5HA 1JCIA 5KQIA 2AS6A 4NVMB 2B11A 1MKQA 1H5JA 4BM3A 1CPDA 5SW6A 5SYUA 3VLMA 4ATJA 2XIFA 1LYKA 4FDQA 5H9FB 4BLXA 1A2GA 1BVAA 3FM6A 5SYWA 2XIHA 3VLJA 5SYJA 1H3JA 2GHKX 2X08A 2CYPA 1CCCA 2EURA 3M26A 1FHFA 3RIWA 4CVJA 2ZOPA 4NVFA 1YZPA 1AEUA 1BESA 1YYGA 1APXA 2E3AA 3FMUA 5SXTA 2ATJA 4NVKB 1H5DA 4BLKA 2WD4A 1CCAA 1SJ2A 1AC8A 1DSEA 1H5KA 1ARWA 1DSPA 1C8IA 4C51A 1GWUA 4FCSA 1GX2A 5CJHA 3M27A 1IYNA 1ARUA 2N18A 5SX7A 1S6VA 1AEQA 1CCBA 5KQHA 3M25A 5SXSA 2B12A 2W23A 3CCXA 1ARXA 5JHXA 1QO4A 4C50A 5SX6A 3M8MA 5SX3A 2AS1A 4XVAA 5CIHA 6CCPA 4NVIB 4JMBA 5CCPA 2Y6AA 2WSSS 1OAGA 2RBZX 4JMWA 2RBWX 5SX0A 2GHHX 1BEQA 5KSKA 1AEOA 1AC4A 3RIVA 1H5LA 5SW4A 2GGNX 2VNZX 1ZBZA 1GW2A 2VO2X 1AA4A 5SX2A 4CZNA 5KQ3A 1AENA 4NVEA 1PA2A 2RC0X 4JPLA 4PAEA 2CL4X 4XV8A 3R98A 4BM0A 4GEDA 3ZCHA 2X07A 5CIFA 3VLLA 1DS4A 4JMZA 2AS4A 1CCLA 3M2EA 3M2GA 1CCEA 3E2OA 2IA8A 1MNPA 1QPAA 2EUSA 1CPFA 1GWTA 4U7UB 1AEEA 2VCFX 5SYYA 1CCPA 3ZCGA 5JPRA 5CIGA 1AEJA 1ZBYA 2VCSA 3E2NA 2E39A 2CEPA 5SYHA 2BCNA 3WNUA 3FJWA 1ARPA 2Y6BA 4NVHB 4XV7A 1SCHA 3M2IA 2XJ8A 4CZRA 3M2CA 3VLIA 4NVCA 3Q3UA 1DSGA 4H7AA 5AL9A 1DJ1A 7ATJA 3M23A 1STQA 1EBEA 4JM9A 2AS2A 2YLJA 5CD4J 4JPUA 5SX1A 3R99A 5CIEA 4BLZA 1AEVA 3VLHA 5FNEA 3M28A 4JQMA 1ATJA 2OEBA 2RBUX 4CZPA 4JB4A 2XJ5A 1MK8A 4XV5A 2AQDA 5ABNA 2ICVA 1AEGA 2EUNA 5L02A 1AEDA 2VKAA 1BEPA 4NFGA 1H57A 2XILA 1GZAA 1H5GA 2JMXA 1CCIA 5JHZA 4GKFA 2RC1X 4FEFA 3EXBA 1U2KA 2VNXX 1V0HX 6ATJA 4JM6A 1BEKA 1GWOA 1DSOA 1DCCA 2XJ6A 2A7UB 2EUTA 4CCPA 1ML2A 3M29A 5SXWA 3M2BA 4XV4A 1H55A 5SYIA 5L86A 4CZOA 1CMTA 1B85A 4A78A 1ARYA 1BEMA 1AEFA 1H5AA 4JN0A 1MKRA 1HCHA 3M2AA 4NVLA 4BM2A 5KQ0A 1KZMA 2EUOA 1YYDA
chains in the Genus database with same CATH topology
4JPTA 5AOGA 1AEHA 4P4QA 2RC2X 1CPEA 2V23A 5FNBA 1AESA 4OQ7A 5ALAA 4A7MA 1H5FA 2B10A 1LGAA 1DJ5A 2EUQA 4JMVA 5JQRA 3X16A 2GHDX 4JMAA 1YZRA 1CCJA 5JHYA 4A71A 1W4YA 5KQKA 3ZCYA 2CCPA 2RBTX 4JMSA 5L05A 1ITKA 3HDLA 2RBXX 1JDRA 1BJ9A 5KSFA 1AETA 2CCAA 2V2EA 4XV6A 1U2JA 1QGJA 1AEKA 3FKGA 1UB2A 1B80A 2GHCX 1CMPA 4H79A 4BLNA 4A6ZA 2B0ZA 4NVBA 3RRWA 1LY8A 1U74A 1GZBA 1KXMA 1H5EA 3M2DA 1LLPA 4BM4A 1CMQA 4NVGB 4JZAA 4BLYA 5EJXA 1H5MA 1HSRA 1U2LA 4G05A 5CIBA 1SOGA 2PCBA 5D6MA 5KQ2A 1AEMA 2VCNA 4JQKA 5SYXA 1SBMA 5ABOA 2ANZA 2AS3A 5ABQA 1U75A 1CCGA 1KXNA 2PCCA 2EUUA 4USCA 4JMTA 4BM1A 2YCGA 3M2FA 1H5CA 1B82A 1A2FA 5EJTA 4CZQA 4CCXA 5SYKA 3FM1A 2RBVX 1H58A 4NVAA 5SXQA 4NVOB 2BOQA 3CCPA 5SX0B 4BLLA 5AMMA 2Y5AA 5SW5A 3WA8A 3M2HA 1H5IA 4JM5A 3UT2A 4JQJA 4A5GA 1RYCA 2RBYX 4FCNA 2EUPA 3UW8A 1W4WA 4NVNB 5KQ6A 1OAFA 1Z53A 5CICA 1CYFA 1BEJA 3FM4A 1S73A 4CVIA 1AEBA 4NVJB 1KOKA 1CPGA 1LYCA 4NVDA 4JQNA 4CUOA 1BGPA 1KRJA 1MN1A 1CCKA 4JM8A 5SXRA 1LY9A 2JTIA 7CCPA 3ATJA 1CMUA 2E3BA 2GHEX 2GB8A 5SXXA 3WXOA 1ARVA 3VLKA 1CK6A 1SDQA 2ZCAA 3M5QA 2CCDA 1MN2A 4QYZB 2XI6A 5SYVA 5CIDA 5SYLA 5H9EB 1H5HA 1JCIA 5KQIA 2AS6A 4NVMB 2B11A 1MKQA 1H5JA 4BM3A 1CPDA 5SW6A 5SYUA 3VLMA 4ATJA 2XIFA 1LYKA 4FDQA 5H9FB 4BLXA 1A2GA 1BVAA 3FM6A 5SYWA 2XIHA 3VLJA 5SYJA 1H3JA 2GHKX 2X08A 2CYPA 1CCCA 2EURA 3M26A 1FHFA 3RIWA 4CVJA 4NVFA 1YZPA 1AEUA 1BESA 1YYGA 1APXA 2E3AA 3FMUA 5SXTA 2ATJA 4NVKB 1H5DA 4BLKA 2WD4A 1CCAA 1SJ2A 1AC8A 1DSEA 1H5KA 1ARWA 1DSPA 1C8IA 4C51A 1GWUA 4FCSA 1GX2A 5CJHA 3M27A 1IYNA 1ARUA 2N18A 5SX7A 1S6VA 1AEQA 1CCBA 5KQHA 3M25A 5SXSA 2B12A 2W23A 3CCXA 1ARXA 5JHXA 1QO4A 4C50A 5SX6A 3M8MA 5SX3A 2AS1A 4XVAA 5CIHA 6CCPA 4NVIB 4JMBA 5CCPA 2Y6AA 1OAGA 2RBZX 4JMWA 2RBWX 5SX0A 2GHHX 1BEQA 5KSKA 1AEOA 1AC4A 3RIVA 1H5LA 5SW4A 2GGNX 2VNZX 1ZBZA 1GW2A 2VO2X 1AA4A 5SX2A 4CZNA 5KQ3A 1AENA 4NVEA 1PA2A 2RC0X 4JPLA 4PAEA 2CL4X 4XV8A 3R98A 4BM0A 4GEDA 3ZCHA 2X07A 5CIFA 3VLLA 1DS4A 4JMZA 2AS4A 1CCLA 3M2EA 3M2GA 1CCEA 3E2OA 2IA8A 1MNPA 1QPAA 2EUSA 1CPFA 1GWTA 4U7UB 1AEEA 2VCFX 5SYYA 1CCPA 3ZCGA 5JPRA 5CIGA 1AEJA 1ZBYA 2VCSA 3E2NA 2E39A 2CEPA 5SYHA 2BCNA 3WNUA 3FJWA 1ARPA 2Y6BA 4NVHB 4XV7A 1SCHA 3M2IA 2XJ8A 4CZRA 3M2CA 3VLIA 4NVCA 3Q3UA 1DSGA 4H7AA 5AL9A 1DJ1A 7ATJA 3M23A 1STQA 1EBEA 4JM9A 2AS2A 2YLJA 5CD4J 4JPUA 5SX1A 3R99A 5CIEA 4BLZA 1AEVA 3VLHA 5FNEA 3M28A 4JQMA 1ATJA 2RBUX 4CZPA 4JB4A 2XJ5A 1MK8A 4XV5A 2AQDA 5ABNA 2ICVA 1AEGA 2EUNA 5L02A 1AEDA 2VKAA 1BEPA 4NFGA 1H57A 2XILA 1GZAA 1H5GA 1CCIA 5JHZA 2RC1X 4FEFA 3EXBA 1U2KA 2VNXX 1V0HX 6ATJA 4JM6A 1BEKA 1GWOA 1DSOA 1DCCA 2XJ6A 2EUTA 4CCPA 1ML2A 3M29A 5SXWA 3M2BA 4XV4A 1H55A 5SYIA 5L86A 4CZOA 1CMTA 1B85A 4A78A 1ARYA 1BEMA 1AEFA 1H5AA 4JN0A 1MKRA 1HCHA 3M2AA 4NVLA 4BM2A 5KQ0A 1KZMA 2EUOA 1YYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JPT A;  5AOG A;  1AEH A;  4P4Q A;  2RC2 X;  1CPE A;  2V23 A;  5FNB A;  1AES A;  4OQ7 A;  5ALA A;  4A7M A;  1H5F A;  2B10 A;  1LGA A;  1DJ5 A;  2EUQ A;  4JMV A;  5JQR A;  3X16 A;  2GHD X;  4JMA A;  1YZR A;  1CCJ A;  5JHY A;  4A71 A;  1W4Y A;  5KQK A;  3ZCY A;  2CCP A;  2RBT X;  4JMS A;  5L05 A;  1ITK A;  3HDL A;  2RBX X;  1JDR A;  1BJ9 A;  5KSF A;  1AET A;  2CCA A;  2V2E A;  4XV6 A;  1U2J A;  1QGJ A;  1AEK A;  3FKG A;  1UB2 A;  1B80 A;  2GHC X;  1CMP A;  4BLN A;  4A6Z A;  2B0Z A;  4NVB A;  3RRW A;  1LY8 A;  1U74 A;  1GZB A;  1KXM A;  1H5E A;  3M2D A;  1LLP A;  4BM4 A;  1CMQ A;  4NVG B;  4BLY A;  5EJX A;  1H5M A;  1HSR A;  1U2L A;  4G05 A;  5CIB A;  1SOG A;  2PCB A;  5D6M A;  5KQ2 A;  1AEM A;  2VCN A;  4JQK A;  5SYX A;  1SBM A;  5ABO A;  2ANZ A;  2AS3 A;  5ABQ A;  1U75 A;  1CCG A;  1KXN A;  2PCC A;  2EUU A;  4USC A;  4JMT A;  4BM1 A;  2YCG A;  3M2F A;  1H5C A;  1B82 A;  1A2F A;  5EJT A;  4CZQ A;  4CCX A;  5SYK A;  3FM1 A;  2RBV X;  1H58 A;  4NVA A;  5SXQ A;  4NVO B;  2BOQ A;  3CCP A;  5SX0 B;  4BLL A;  5AMM A;  2Y5A A;  5SW5 A;  3M2H A;  1H5I A;  4JM5 A;  3UT2 A;  4JQJ A;  4A5G A;  1RYC A;  2RBY X;  4FCN A;  2EUP A;  3UW8 A;  1W4W A;  4NVN B;  5KQ6 A;  1OAF A;  1Z53 A;  5CIC A;  1CYF A;  1BEJ A;  3FM4 A;  1S73 A;  4CVI A;  1AEB A;  4NVJ B;  1KOK A;  1CPG A;  1LYC A;  4NVD A;  4JQN A;  4CUO A;  1BGP A;  1KRJ A;  1MN1 A;  1CCK A;  4JM8 A;  5SXR A;  1LY9 A;  2JTI A;  7CCP A;  3ATJ A;  1CMU A;  2E3B A;  2GHE X;  2GB8 A;  5SXX A;  3WXO A;  1ARV A;  3VLK A;  1CK6 A;  1SDQ A;  3M5Q A;  2CCD A;  1MN2 A;  2XI6 A;  5SYV A;  5CID A;  5SYL A;  1H5H A;  1JCI A;  5KQI A;  2AS6 A;  4NVM B;  2B11 A;  1MKQ A;  1H5J A;  4BM3 A;  1CPD A;  5SW6 A;  5SYU A;  3VLM A;  4ATJ A;  2XIF A;  1LYK A;  4FDQ A;  4BLX A;  1A2G A;  1BVA A;  3FM6 A;  5SYW A;  2XIH A;  3VLJ A;  5SYJ A;  1H3J A;  2GHK X;  2X08 A;  2CYP A;  1CCC A;  2EUR A;  3M26 A;  1FHF A;  3RIW A;  4CVJ A;  4NVF A;  1YZP A;  1AEU A;  1BES A;  1YYG A;  1APX A;  2E3A A;  3FMU A;  5SXT A;  2ATJ A;  4NVK B;  1H5D A;  4BLK A;  2WD4 A;  1CCA A;  1SJ2 A;  1AC8 A;  1DSE A;  1H5K A;  1ARW A;  1DSP A;  1C8I A;  4C51 A;  1GWU A;  4FCS A;  1GX2 A;  5CJH A;  3M27 A;  1IYN A;  1ARU A;  2N18 A;  5SX7 A;  1S6V A;  1AEQ A;  1CCB A;  5KQH A;  3M25 A;  5SXS A;  2B12 A;  2W23 A;  3CCX A;  1ARX A;  5JHX A;  1QO4 A;  4C50 A;  5SX6 A;  3M8M A;  5SX3 A;  2AS1 A;  4XVA A;  5CIH A;  6CCP A;  4NVI B;  4JMB A;  5CCP A;  2Y6A A;  1OAG A;  2RBZ X;  4JMW A;  2RBW X;  5SX0 A;  2GHH X;  1BEQ A;  5KSK A;  1AEO A;  1AC4 A;  3RIV A;  1H5L A;  5SW4 A;  2GGN X;  2VNZ X;  1ZBZ A;  1GW2 A;  2VO2 X;  1AA4 A;  5SX2 A;  4CZN A;  5KQ3 A;  1AEN A;  4NVE A;  1PA2 A;  2RC0 X;  4JPL A;  4PAE A;  2CL4 X;  4XV8 A;  3R98 A;  4BM0 A;  4GED A;  3ZCH A;  2X07 A;  5CIF A;  3VLL A;  1DS4 A;  4JMZ A;  2AS4 A;  1CCL A;  3M2E A;  3M2G A;  1CCE A;  3E2O A;  2IA8 A;  1MNP A;  1QPA A;  2EUS A;  1CPF A;  1GWT A;  1AEE A;  2VCF X;  5SYY A;  1CCP A;  3ZCG A;  5JPR A;  5CIG A;  1AEJ A;  1ZBY A;  2VCS A;  3E2N A;  2E39 A;  2CEP A;  5SYH A;  2BCN A;  3WNU A;  3FJW A;  1ARP A;  2Y6B A;  4NVH B;  4XV7 A;  1SCH A;  3M2I A;  2XJ8 A;  4CZR A;  3M2C A;  3VLI A;  4NVC A;  3Q3U A;  1DSG A;  5AL9 A;  1DJ1 A;  7ATJ A;  3M23 A;  1STQ A;  1EBE A;  4JM9 A;  2AS2 A;  2YLJ A;  4JPU A;  5SX1 A;  3R99 A;  5CIE A;  4BLZ A;  1AEV A;  3VLH A;  5FNE A;  3M28 A;  4JQM A;  1ATJ A;  2RBU X;  4CZP A;  4JB4 A;  2XJ5 A;  1MK8 A;  4XV5 A;  2AQD A;  5ABN A;  2ICV A;  1AEG A;  2EUN A;  5L02 A;  1AED A;  2VKA A;  1BEP A;  4NFG A;  1H57 A;  2XIL A;  1GZA A;  1H5G A;  1CCI A;  5JHZ A;  2RC1 X;  4FEF A;  3EXB A;  1U2K A;  2VNX X;  1V0H X;  6ATJ A;  4JM6 A;  1BEK A;  1GWO A;  1DSO A;  1DCC A;  2XJ6 A;  2EUT A;  4CCP A;  1ML2 A;  3M29 A;  5SXW A;  3M2B A;  4XV4 A;  1H55 A;  5SYI A;  5L86 A;  4CZO A;  1CMT A;  1B85 A;  4A78 A;  1ARY A;  1BEM A;  1AEF A;  1H5A A;  4JN0 A;  1MKR A;  1HCH A;  3M2A A;  4NVL A;  4BM2 A;  5KQ0 A;  1KZM A;  2EUO A;  1YYD A; 
#chains in the Genus database with same CATH topology
 4JPT A;  5AOG A;  1AEH A;  4P4Q A;  2RC2 X;  1CPE A;  2V23 A;  5FNB A;  1AES A;  4OQ7 A;  5ALA A;  4A7M A;  1H5F A;  2B10 A;  1LGA A;  1DJ5 A;  2EUQ A;  4JMV A;  5JQR A;  3X16 A;  1ABV A;  2GHD X;  4JMA A;  1YZR A;  1CCJ A;  5JHY A;  4A71 A;  1W4Y A;  5KQK A;  2BO5 A;  3ZCY A;  2CCP A;  2RBT X;  4JMS A;  5L05 A;  1ITK A;  3HDL A;  2RBX X;  1JDR A;  1BJ9 A;  5KSF A;  1AET A;  2CCA A;  2V2E A;  4XV6 A;  1U2J A;  1QGJ A;  1AEK A;  3FKG A;  1UB2 A;  1B80 A;  2GHC X;  1CMP A;  4H79 A;  4BLN A;  4A6Z A;  2B0Z A;  4NVB A;  3RRW A;  1LY8 A;  1U74 A;  1GZB A;  1KXM A;  1H5E A;  3M2D A;  1LLP A;  4BM4 A;  1CMQ A;  4NVG B;  4JZA A;  4BLY A;  5EJX A;  1H5M A;  1HSR A;  1U2L A;  4G05 A;  5CIB A;  1SOG A;  2PCB A;  5D6M A;  5KQ2 A;  1AEM A;  2VCN A;  4JQK A;  5SYX A;  1SBM A;  5ABO A;  2ANZ A;  2AS3 A;  5ABQ A;  1U75 A;  1CCG A;  1KXN A;  2PCC A;  2EUU A;  4USC A;  4JMT A;  4BM1 A;  2YCG A;  3M2F A;  1H5C A;  1B82 A;  1A2F A;  5EJT A;  4CZQ A;  4CCX A;  5SYK A;  3FM1 A;  2RBV X;  1H58 A;  4NVA A;  5SXQ A;  4NVO B;  2BOQ A;  3CCP A;  5SX0 B;  4BLL A;  5AMM A;  2Y5A A;  5SW5 A;  3WA8 A;  3M2H A;  1H5I A;  4JM5 A;  3UT2 A;  4JQJ A;  4A5G A;  1RYC A;  2RBY X;  4FCN A;  2EUP A;  3UW8 A;  1W4W A;  4NVN B;  5KQ6 A;  1OAF A;  1Z53 A;  5CIC A;  1CYF A;  1BEJ A;  3FM4 A;  1S73 A;  4CVI A;  1AEB A;  4NVJ B;  1KOK A;  1CPG A;  1LYC A;  4NVD A;  4JQN A;  4CUO A;  1BGP A;  1KRJ A;  1MN1 A;  1CCK A;  4JM8 A;  5SXR A;  1LY9 A;  2JTI A;  7CCP A;  3ATJ A;  1CMU A;  2E3B A;  2GHE X;  2GB8 A;  5SXX A;  3WXO A;  1ARV A;  3VLK A;  1CK6 A;  1SDQ A;  2ZCA A;  3M5Q A;  2CCD A;  1MN2 A;  4QYZ B;  2XI6 A;  5SYV A;  3X1L F;  5CID A;  5SYL A;  5H9E B;  1H5H A;  1JCI A;  5KQI A;  2AS6 A;  4NVM B;  2B11 A;  1MKQ A;  1H5J A;  4BM3 A;  1CPD A;  5SW6 A;  5SYU A;  3VLM A;  4ATJ A;  2XIF A;  1LYK A;  4FDQ A;  5H9F B;  4BLX A;  1A2G A;  1BVA A;  3FM6 A;  5SYW A;  2XIH A;  3VLJ A;  5SYJ A;  1H3J A;  2GHK X;  2X08 A;  2CYP A;  1CCC A;  2EUR A;  3M26 A;  1FHF A;  3RIW A;  4CVJ A;  2ZOP A;  4NVF A;  1YZP A;  1AEU A;  1BES A;  1YYG A;  1APX A;  2E3A A;  3FMU A;  5SXT A;  2ATJ A;  4NVK B;  1H5D A;  4BLK A;  2WD4 A;  1CCA A;  1SJ2 A;  1AC8 A;  1DSE A;  1H5K A;  1ARW A;  1DSP A;  1C8I A;  4C51 A;  1GWU A;  4FCS A;  1GX2 A;  5CJH A;  3M27 A;  1IYN A;  1ARU A;  2N18 A;  5SX7 A;  1S6V A;  1AEQ A;  1CCB A;  5KQH A;  3M25 A;  5SXS A;  2B12 A;  2W23 A;  3CCX A;  1ARX A;  5JHX A;  1QO4 A;  4C50 A;  5SX6 A;  3M8M A;  5SX3 A;  2AS1 A;  4XVA A;  5CIH A;  6CCP A;  4NVI B;  4JMB A;  5CCP A;  2Y6A A;  2WSS S;  1OAG A;  2RBZ X;  4JMW A;  2RBW X;  5SX0 A;  2GHH X;  1BEQ A;  5KSK A;  1AEO A;  1AC4 A;  3RIV A;  1H5L A;  5SW4 A;  2GGN X;  2VNZ X;  1ZBZ A;  1GW2 A;  2VO2 X;  1AA4 A;  5SX2 A;  4CZN A;  5KQ3 A;  1AEN A;  4NVE A;  1PA2 A;  2RC0 X;  4JPL A;  4PAE A;  2CL4 X;  4XV8 A;  3R98 A;  4BM0 A;  4GED A;  3ZCH A;  2X07 A;  5CIF A;  3VLL A;  1DS4 A;  4JMZ A;  2AS4 A;  1CCL A;  3M2E A;  3M2G A;  1CCE A;  3E2O A;  2IA8 A;  1MNP A;  1QPA A;  2EUS A;  1CPF A;  1GWT A;  4U7U B;  1AEE A;  2VCF X;  5SYY A;  1CCP A;  3ZCG A;  5JPR A;  5CIG A;  1AEJ A;  1ZBY A;  2VCS A;  3E2N A;  2E39 A;  2CEP A;  5SYH A;  2BCN A;  3WNU A;  3FJW A;  1ARP A;  2Y6B A;  4NVH B;  4XV7 A;  1SCH A;  3M2I A;  2XJ8 A;  4CZR A;  3M2C A;  3VLI A;  4NVC A;  3Q3U A;  1DSG A;  4H7A A;  5AL9 A;  1DJ1 A;  7ATJ A;  3M23 A;  1STQ A;  1EBE A;  4JM9 A;  2AS2 A;  2YLJ A;  5CD4 J;  4JPU A;  5SX1 A;  3R99 A;  5CIE A;  4BLZ A;  1AEV A;  3VLH A;  5FNE A;  3M28 A;  4JQM A;  1ATJ A;  2OEB A;  2RBU X;  4CZP A;  4JB4 A;  2XJ5 A;  1MK8 A;  4XV5 A;  2AQD A;  5ABN A;  2ICV A;  1AEG A;  2EUN A;  5L02 A;  1AED A;  2VKA A;  1BEP A;  4NFG A;  1H57 A;  2XIL A;  1GZA A;  1H5G A;  2JMX A;  1CCI A;  5JHZ A;  4GKF A;  2RC1 X;  4FEF A;  3EXB A;  1U2K A;  2VNX X;  1V0H X;  6ATJ A;  4JM6 A;  1BEK A;  1GWO A;  1DSO A;  1DCC A;  2XJ6 A;  2A7U B;  2EUT A;  4CCP A;  1ML2 A;  3M29 A;  5SXW A;  3M2B A;  4XV4 A;  1H55 A;  5SYI A;  5L86 A;  4CZO A;  1CMT A;  1B85 A;  4A78 A;  1ARY A;  1BEM A;  1AEF A;  1H5A A;  4JN0 A;  1MKR A;  1HCH A;  3M2A A;  4NVL A;  4BM2 A;  5KQ0 A;  1KZM A;  2EUO A;  1YYD A; 
#chains in the Genus database with same CATH homology
 4JPT A;  5AOG A;  1AEH A;  4P4Q A;  2RC2 X;  1CPE A;  2V23 A;  5FNB A;  1AES A;  4OQ7 A;  5ALA A;  4A7M A;  1H5F A;  2B10 A;  1LGA A;  1DJ5 A;  2EUQ A;  4JMV A;  5JQR A;  3X16 A;  2GHD X;  4JMA A;  1YZR A;  1CCJ A;  5JHY A;  4A71 A;  1W4Y A;  5KQK A;  3ZCY A;  2CCP A;  2RBT X;  4JMS A;  5L05 A;  1ITK A;  3HDL A;  2RBX X;  1JDR A;  1BJ9 A;  5KSF A;  1AET A;  2CCA A;  2V2E A;  4XV6 A;  1U2J A;  1QGJ A;  1AEK A;  3FKG A;  1UB2 A;  1B80 A;  2GHC X;  1CMP A;  4H79 A;  4BLN A;  4A6Z A;  2B0Z A;  4NVB A;  3RRW A;  1LY8 A;  1U74 A;  1GZB A;  1KXM A;  1H5E A;  3M2D A;  1LLP A;  4BM4 A;  1CMQ A;  4NVG B;  4JZA A;  4BLY A;  5EJX A;  1H5M A;  1HSR A;  1U2L A;  4G05 A;  5CIB A;  1SOG A;  2PCB A;  5D6M A;  5KQ2 A;  1AEM A;  2VCN A;  4JQK A;  5SYX A;  1SBM A;  5ABO A;  2ANZ A;  2AS3 A;  5ABQ A;  1U75 A;  1CCG A;  1KXN A;  2PCC A;  2EUU A;  4USC A;  4JMT A;  4BM1 A;  2YCG A;  3M2F A;  1H5C A;  1B82 A;  1A2F A;  5EJT A;  4CZQ A;  4CCX A;  5SYK A;  3FM1 A;  2RBV X;  1H58 A;  4NVA A;  5SXQ A;  4NVO B;  2BOQ A;  3CCP A;  5SX0 B;  4BLL A;  5AMM A;  2Y5A A;  5SW5 A;  3WA8 A;  3M2H A;  1H5I A;  4JM5 A;  3UT2 A;  4JQJ A;  4A5G A;  1RYC A;  2RBY X;  4FCN A;  2EUP A;  3UW8 A;  1W4W A;  4NVN B;  5KQ6 A;  1OAF A;  1Z53 A;  5CIC A;  1CYF A;  1BEJ A;  3FM4 A;  1S73 A;  4CVI A;  1AEB A;  4NVJ B;  1KOK A;  1CPG A;  1LYC A;  4NVD A;  4JQN A;  4CUO A;  1BGP A;  1KRJ A;  1MN1 A;  1CCK A;  4JM8 A;  5SXR A;  1LY9 A;  2JTI A;  7CCP A;  3ATJ A;  1CMU A;  2E3B A;  2GHE X;  2GB8 A;  5SXX A;  3WXO A;  1ARV A;  3VLK A;  1CK6 A;  1SDQ A;  2ZCA A;  3M5Q A;  2CCD A;  1MN2 A;  4QYZ B;  2XI6 A;  5SYV A;  5CID A;  5SYL A;  5H9E B;  1H5H A;  1JCI A;  5KQI A;  2AS6 A;  4NVM B;  2B11 A;  1MKQ A;  1H5J A;  4BM3 A;  1CPD A;  5SW6 A;  5SYU A;  3VLM A;  4ATJ A;  2XIF A;  1LYK A;  4FDQ A;  5H9F B;  4BLX A;  1A2G A;  1BVA A;  3FM6 A;  5SYW A;  2XIH A;  3VLJ A;  5SYJ A;  1H3J A;  2GHK X;  2X08 A;  2CYP A;  1CCC A;  2EUR A;  3M26 A;  1FHF A;  3RIW A;  4CVJ A;  4NVF A;  1YZP A;  1AEU A;  1BES A;  1YYG A;  1APX A;  2E3A A;  3FMU A;  5SXT A;  2ATJ A;  4NVK B;  1H5D A;  4BLK A;  2WD4 A;  1CCA A;  1SJ2 A;  1AC8 A;  1DSE A;  1H5K A;  1ARW A;  1DSP A;  1C8I A;  4C51 A;  1GWU A;  4FCS A;  1GX2 A;  5CJH A;  3M27 A;  1IYN A;  1ARU A;  2N18 A;  5SX7 A;  1S6V A;  1AEQ A;  1CCB A;  5KQH A;  3M25 A;  5SXS A;  2B12 A;  2W23 A;  3CCX A;  1ARX A;  5JHX A;  1QO4 A;  4C50 A;  5SX6 A;  3M8M A;  5SX3 A;  2AS1 A;  4XVA A;  5CIH A;  6CCP A;  4NVI B;  4JMB A;  5CCP A;  2Y6A A;  1OAG A;  2RBZ X;  4JMW A;  2RBW X;  5SX0 A;  2GHH X;  1BEQ A;  5KSK A;  1AEO A;  1AC4 A;  3RIV A;  1H5L A;  5SW4 A;  2GGN X;  2VNZ X;  1ZBZ A;  1GW2 A;  2VO2 X;  1AA4 A;  5SX2 A;  4CZN A;  5KQ3 A;  1AEN A;  4NVE A;  1PA2 A;  2RC0 X;  4JPL A;  4PAE A;  2CL4 X;  4XV8 A;  3R98 A;  4BM0 A;  4GED A;  3ZCH A;  2X07 A;  5CIF A;  3VLL A;  1DS4 A;  4JMZ A;  2AS4 A;  1CCL A;  3M2E A;  3M2G A;  1CCE A;  3E2O A;  2IA8 A;  1MNP A;  1QPA A;  2EUS A;  1CPF A;  1GWT A;  4U7U B;  1AEE A;  2VCF X;  5SYY A;  1CCP A;  3ZCG A;  5JPR A;  5CIG A;  1AEJ A;  1ZBY A;  2VCS A;  3E2N A;  2E39 A;  2CEP A;  5SYH A;  2BCN A;  3WNU A;  3FJW A;  1ARP A;  2Y6B A;  4NVH B;  4XV7 A;  1SCH A;  3M2I A;  2XJ8 A;  4CZR A;  3M2C A;  3VLI A;  4NVC A;  3Q3U A;  1DSG A;  4H7A A;  5AL9 A;  1DJ1 A;  7ATJ A;  3M23 A;  1STQ A;  1EBE A;  4JM9 A;  2AS2 A;  2YLJ A;  5CD4 J;  4JPU A;  5SX1 A;  3R99 A;  5CIE A;  4BLZ A;  1AEV A;  3VLH A;  5FNE A;  3M28 A;  4JQM A;  1ATJ A;  2RBU X;  4CZP A;  4JB4 A;  2XJ5 A;  1MK8 A;  4XV5 A;  2AQD A;  5ABN A;  2ICV A;  1AEG A;  2EUN A;  5L02 A;  1AED A;  2VKA A;  1BEP A;  4NFG A;  1H57 A;  2XIL A;  1GZA A;  1H5G A;  1CCI A;  5JHZ A;  2RC1 X;  4FEF A;  3EXB A;  1U2K A;  2VNX X;  1V0H X;  6ATJ A;  4JM6 A;  1BEK A;  1GWO A;  1DSO A;  1DCC A;  2XJ6 A;  2EUT A;  4CCP A;  1ML2 A;  3M29 A;  5SXW A;  3M2B A;  4XV4 A;  1H55 A;  5SYI A;  5L86 A;  4CZO A;  1CMT A;  1B85 A;  4A78 A;  1ARY A;  1BEM A;  1AEF A;  1H5A A;  4JN0 A;  1MKR A;  1HCH A;  3M2A A;  4NVL A;  4BM2 A;  5KQ0 A;  1KZM A;  2EUO A;  1YYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...