4CV3A

Crystal structure of e. coli fabi in complex with nadh and pt166
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
256
structure length
239
Chain Sequence
b'GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPICEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
publication title Rational Design of Broad Spectrum Antibacterial Activity Based on a Clinically Relevant Enoyl-Acyl Carrier Protein (Acp) Reductase Inhibitor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 85
structure length 239
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2014-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cv3A00
2C0CA 4WKGA 3AUAA 1LSUA 5GMOA 2XXJA 2C7VA 1H6DA 2YYYA 3GZNB 2O3JA 4IJKA 4IPTA 4BMSA 4NDNE 4RZIA 1MA0A 1HZZA 5TX7A 2RHCA 3MZ0A 3WLEA 3WXBA 1J4AA 3PHLA 2C59A 2R00A 3NKLA 3PJFA 3IKVA 1EE9A 2P5UA 1QLHA 5L9AA 1T25A 1U7TA 4W82A 4RORA 5JW6A 3GVHA 3WQQA 2VNSA 4PLYA 1X7DA 2VHVA 5EINA 5G0UA 3VH1A 3SJUA 4MVJD 3RD5A 1EFLA 4KQXA 5A03A 1PQPA 2EGGA 1P0CA 1A9YA 3INGA 4AJJA 5MGBA 4P4GA 1M6HA 3WQRA 4LCJA 3R6DA 3CEAA 1KEVA 1N1EA 3LLSA 1UP4A 5B4VA 3K96A 4NU6A 4TQGA 2FR1A 1XWFA 3MJVA 4JGBA 3JYNA 2UUOA 3C7DB 3DAPA 1I5RA 4FCCA 4LSMA 3CSDA 3W4KA 3GNSA 1K3TA 1ZSNA 1P0FA 4I8XA 2PZLA 5F1KA 4CMIA 2YJZA 4B3JA 3U4HA 1T2CA 4AJHA 1LQTA 1YE3A 3C24A 1JKIA 4S3MA 3ULKA 1NFFA 3H5AA 1PS9A 2ZYAA 3AK4A 4PG8A 1GZ3A 4FOSA 4P4NA 1PZGA 1D7OA 2Q3EA 3BMOA 1SEVA 3AI1A 2FSVA 4RQTA 2JD0A 3DR3A 4GKBA 1ADCA 5IF3A 1LQUA 3C8MA 2PR2A 3K8ZA 1N7HA 3H9EO 1ZIDA 4NNJA 4WLOA 3FSRA 1A5ZA 2GF2A 1LRKA 1G0NA 4WLEA 2PTGA 1TI7A 3MJCA 1V3VA 5FI3A 1DRWA 3BMNB 5GZ1A 2O2SA 4LCEA 2C82A 1H9AA 1KVSA 3F1KA 3QWHA 1C1DA 2GYYA 4RF5A 3I83A 1AN9A 4KWHA 1E6WA 2EKQA 3HHPA 3F4BA 1EEHA 1V6AA 2BFPA 4Q3CA 4UAGA 3DAFA 3GEMA 3RUFA 4XYEA 4A7PA 1LDNA 4R54A 2GN9A 3O8QA 2PKRA 2PZJA 5COQA 3BTOA 4I5GA 3ZH2A 4ALJA 2HK9A 5G0VA 4ZU3A 1UP7A 2V6FA 5DP2A 2AQKA 2J3HA 3M2TA 2VQ3A 1JA9A 4J9UE 4Y8VA 1RM5A 4N18A 4DYDA 4CV3A 1EK5A 3INRA 3V1UA 1DFIA 4E13A 2B0JA 1LDMA 2EW8A 3HFSA 2VHYA 1QXSA 4MVJI 3LDHA 4LISA 3ROKA 3G0OA 3ZW8A 2ZB4A 3WIEA 1BSVA 2B36A 2R2GA 2E37A 3EW7A 1HDRA 3FD8A 3NUGA 4BOYA 4D3FA 1FK8A 4YBZA 4O59O 1C0IA 1E7SA 4FJ2A 1QYCA 4DMMA 4RDIA 3H65A 1I33A 1UAGA 5H83A 3LF2A 4QO7A 1UXGA 3SX2A 4DBZA 1H6AA 1UDCA 5IAAA 1GPJA 4TZKA 4KWIA 2ZQZA 1YL6A 1AE1A 3EUWA 4IJWA 4J1NA 4XYLA 4Z3KA 3E5RA 4NMHA 4QX6A 2NQ8A 1D1TA 1BW9B 4R5MA 1R37A 3KSDO 4YJDA 1O0SA 2IYPA 5JLAA 3ZWBA 3D3WB 1GADO 1PU2A 4D79A 5JY1A 3BTUA 4XGNA 4F6LA 2HSDA 4JP2A 4ZGWA 1ZSVA 2DBQA 3JQ8A 3DBHA 1OC4A 3WNVA 4IUYA 4U6SA 2EP7A 3VPHA 2EWMA 3COSA 2JD1A 3DBVO 4GX0A 4IMRA 4RVFA 4ND2A 5G4KB 4YAKA 4CLRA 1XU7A 1YBVA 3VTFA 4U7WA 3PQFA 1LC3A 4PG4A 3RBZA 4JN6B 3HB5X 5AQ1A 4DQUA 2EW2A 3ZNNA 1JWBB 4G5HA 3AY6A 3UGKA 3U49A 2DKNA 1QP8A 3DTYA 2VRCA 4JJGA 1HDXA 4CMGA 2DT5A 2HAEA 4BV8A 3JYLA 1F06A 1KETA 2RH4A 4RPHA 1HEUA 4ALKA 2EG9A 1XA0A 4R1NA 3JQGB 1SOVA 3PVZA 4MKZA 1GCOA 3PYLA 3KYDB 2HRZA 3GNQA 3FBGA 4PZEA 1UZNA 2Y66A 2GO1A 3P5SA 4CLDA 1K6JA 3EY4A 3JQAB 3LLVA 4BO5A 4CMBA 3AW9A 1GQQA 2B4RO 3WIDA 3EHEA 3JD3A 3JQ9A 5A9SA 1EBFA 3LSYA 4FFRA 1T2FA 2FRDA 1HRDA 5IDQA 4BIIA 4K1LA 1X7GA 5JXWA 3DZIA 3KZVA 5DP1A 2YV1A 4GMFA 2OO5A 1H6CA 2NU7A 2AQIA 1YS4A 3ICPA 2PGDA 2OGUA 4AVYA 1XR3A 4WCDA 3AY3A 4MVJM 1FDVA 5L7YA 5BSEA 3FTPA 5H82A 1RYDA 1BXKA 3C7CB 2CD9A 2VT3A 4IJUA 4RGBA 1HYEA 3VOSA 4FB5A 3PFFA 4NBRA 1PGNA 1GZ6A 4OGWA 2A9FA 3PRJA 3RFVA 4F45A 3DAGA 2OL4A 1R6DA 3AUTA 3GVXA 3K2BA 4YJHA 1TLTA 2X0NA 4AL4A 3ZWAA 1Y8QA 2AQHA 4WCFA 2H6EA 4BNKA 3OP4A 3GN2A 4DPLA 2GGSA 4BO2A 5DNAA 1N5DA 4B7CA 1T26A 2YHIA 1FMCA 4XB1A 3P2OA 2ZKLA 4EDFA 3H6KA 4XJTA 1MC4A 4MOWA 2HDHA 4B3HA 5K6AA 2Y1FA 5DF1A 5C5IA 5DULA 4J6FA 4WK6A 1IE3A 4EJMA 1E5QA 3UHAA 3WYCA 3HG7A 4J4TA 3EVTA 4CMAA 1M76A 4IDEA 1WMBA 1ARZA 3NYWA 3MEQA 2AEFA 4WGGA 2D59A 2YFQA 4RL6A 3A9WA 4CM8A 4YAGA 2BFAA 2QIOA 4HFNA 4YRDA 3JYOA 4CMEA 2CDBA 3PIDA 5C37A 1U3TA 3S2IA 5A5EA 1G6KA 4AJKA 1G0OA 3GGOA 1H9BA 5I7SA 5JDIC 4OKIA 3R3JA 1A7AA 1UUFA 1Y6JA 4O5OA 2PA3A 4EUFA 1XU9A 2ET6A 4ND3A 1Q7BA 4XWYA 1B8UA 2SCUA 4NQZA 3AI2A 4YDRA 4CM4A 4HWKA 3RJ9A 1DC6A 1C1XA 3VC7A 4HNHA 3OECA 4D7AA 3L9WA 4FFLA 2BF7A 2B37A 2AE1A 3NT4A 2DFDA 2EERA 1BMDA 2I65A 4XGIA 1YO6A 4RF4A 1IY8A 3H9UA 5L45A 4M54A 4K28A 5CEJA 3GMDA 2GZ1A 4II3A 2VRCD 5DT9A 4BNUA 8ADHA 2VCYA 2HMTA 4JCOA 4XGKA 3B20A 3ZNPA 3CE6A 1LC0A 3AUSA 2WYVA 1SMKA 3JYQA 1BG6A 1A27A 1HWYA 2NUAA 1MFPA 3L6DA 4XQ9A 4MVJE 1E7MA 5G4LA 1ZW1A 2V7PA 4UVHA 1JVSA 2D8AA 2CSUA 2POQX 3GOHA 4RPJA 4TWRA 4UUNA 1CWUA 3TWOA 3U9LA 4RV9A 3ZHZA 1T4BA 1ZK2A 4WLVA 3PGJA 5LDHA 3HDHA 4TRJA 2DFVA 1UR5A 1F8GA 2FPIA 1KIFA 2C07A 1CRWG 5JAQA 1H0KA 3Q11A 1B16A 5ER6A 1LSJA 2A35A 3W4JA 5IXYA 3UVEA 4PG7A 5IN5A 3X2EA 4DQXA 4BS9A 3IS3A 2O4CA 3DL2A 3JQ6A 1LDEA 2F00A 1DB3A 1GYQA 4YVFA 1KOLA 1NHWA 1TT7A 2PFGA 3KHUA 3WOHA 3PP8A 5A04A 1EDOA 1X14A 3DBLB 3OEWA 3RSHA 3HADA 1PZFA 2EHDA 3ZU5A 3OHSX 4OYRA 3AOEA 5T5QA 3KSZO 1CIVA 4F46A 3Q0EA 4E5YA 2IRWA 4BNGA 4YXFA 5IDWA 3ITDA 2UYYA 1Y8RA 3NEPX 4DPMA 4EBFA 1ZK0A 2Y67A 1YB4A 5IJZA 2Y1GA 1ENZA 3GHHA 1PJCA 5IZCA 1ZBQA 3LF1A 1HDGO 1T24A 4W4TA 4BNFA 1GZ4A 1YH3A 3OIDA 3O9ZA 5ITVA 3VDRA 5AXCA 3M1LA 2W2LA 3BA1A 2BGMA 2FZWA 1M2WA 2X58A 4LMRA 4OXNA 3KOUA 3QY9A 3C7AA 4YWJA 4UVEA 5G0WA 3VPSA 3KETA 3DZGA 1N92A 2WD7A 1Q2XA 1DIAA 5COAA 3RUEA 2VUSA 1YKFA 4XKJA 4R9RA 1SZJG 4BB5A 2JJYA 1OFGA 2PWZA 1EUDA 2GLXA 4IS2A 4LK3A 4M89A 3NDJA 3V5NA 3ZU2A 4B7XA 4D45A 3OH8A 4ND5A 4P22A 3PHHA 3R1IA 1N7GA 1IZ0A 3PGXA 1KY5A 1E1KA 3GRPA 2IXAA 3EYWA 2ZYDA 5THQA 3D4PA 3EZYA 4PFJA 2H1SA 3MWEB 3ADPA 4MIEA 2BI8A 2Z1MA 3GLQA 5L4NA 1PL7A 2R6JA 3H3JA 1B14A 5I9MA 3MCVA 3OFSA 1P77A 2AXQA 3Q3CA 4GLOA 2FHSA 4PLTA 4QFCA 1H5QA 1Q0LA 2VN8A 4A0SA 3E9QA 1ISJA 1K0UA 3GVPA 1GV1A 1J0XO 4CM9D 2Q45A 5KIAA 1U1IA 3L0DA 3VPFA 1I24A 3UKOA 1HZJA 4IDAA 3NT5A 3RVDA 4N5MA 4XYBA 1I3LA 4WEOA 4RPLA 4M49A 1YOVA 1EFKA 1WAMA 4O0LA 2O7SA 1IZ9A 2GASA 1U4OA 2NACA 3QWBA 4GGPA 1ULUA 2PD4A 5B1YA 3H9GA 2JKVA 1HE2A 1SBYA 4GX1A 4CQLA 2VUTA 2CDCA 4ZJUA 4IZIA 1V3UA 3UOGA 4A03A 4NFSA 4CUJA 2IODA 3SVTA 3ZZNA 4PLWA 3QHAA 1FDTA 3IJRA 3IJPA 4KUEA 1EUZA 3ETEA 1U2DA 3DO5A 2DAPA 3TFOA 4H3VA 3ONEA 3U3XA 4BO3A 5TRTA 3DOCA 2I6TA 2OORA 3E48A 3W1VA 4MVJP 4MP8A 3TQHA 1UDAA 2AE2A 3EC7A 3GUYA 3BMOB 3KYCB 3NDIA 5DOZA 5HS6A 3I9NA 3PJDA 4MJLA 2Q99A 5KTKA 1PR9A 4OSPA 1ZXBA 1HSZA 2TMGA 2AG8A 4CR8A 2Z1NA 4R1UA 4J9VA 3U4IA 4FBGA 4E3ZA 4KDFA 3C3XA 3FWZA 4RF3A 2OFPA 2VWHA 4BGVA 4ILKA 2WE7A 4G65A 2GZ3A 3D3EA 5EL0A 2HQ1A 2WJPA 4XQCA 5CEFA 4TVOA 1ZEMA 5JCXA 5GZ3A 4K9DA 3WTBA 2VZ8A 1SC6A 4D3DA 5KJ6A 1GYRA 4AJ4A 1I3MA 2HMSA 4HP8A 4E2WA 5TSDA 1WW8A 4YQYA 1NWCA 5AVOA 4HNGA 5ENVA 4FGSA 3KLPX 1TT5A 4JXKA 2BHLA 1VI2A 2I5PO 2NVWA 2PK3A 1I30A 3HWRA 2GDZA 4O1MA 2RAFA 1QYXA 4NFHA 3WWYA 4RCVA 4BNYA 1EMDA 3BIOA 4XD2A 1R4MA 4XDYA 4BNMA 4WECA 4LVCA 1D8AA 2GN8A 1V8BA 3O8QB 3WGTA 3TN7A 1DRVA 1ULSA 1I32A 4ZQGA 3VZQA 1YVEI 4ROSA 4W9NC 4YPOA 4Y6RA 5BNTA 2Q46A 3FWNA 1LDBA 1KEWA 4JJFA 4U8GA 4E2XA 3RUDA 3OQ6A 3FI9A 5KWEA 2B5VA 4LRTB 4JK3A 4CR6A 5G0TA 1JDJA 3SLKA 5JDCC 1P3DA 1LLDA 1ZK3A 1NPYA 2AW5A 2WEKA 4CMKA 3F6YA 1P1KA 5JO9A 2DU8A 2Q1SA 3L6OO 3FNEA 2PLAA 5JPIA 3QP9A 4GMGA 1A4UA 1E7QA 5DBIA 2ZTVA 4Z0PA 1XSEA 3AM5A 4YJGA 4J1TA 2W2KA 3TOZA 1BVUA 4L4SA 3EAGA 4FJ0A 3JYPA 1PGOA 4BKPA 3LT2A 5L3ZA 3S2GA 4NK5A 1LRLA 3NTRA 1DC4A 1KS9A 5ILOA 3A4VA 4CPDA 2Y93A 1YBMA 5CPBA 1X0XA 3AFNA 2VYND 2VTEA 4PRKA 2WD8A 1Y81A 3A06A 5F1OA 1CJCA 1V0JA 4J49A 4LMPA 5BR7A 3DFZA 4B4OA 4CL3A 2J3KA 1CERA 2P91A 3IIEA 3MWDB 5TGDA 4MP6A 3D4NA 1E3EA 3BMCB 3JCZA 4N5LA 3TZ6A 3WWZA 4E33A 4XA8A 4HXYA 2EV9A 5ADHA 3U4CA 1QV6A 3I5MA 5JFOA 1DOHA 1VJ1A 3RC7A 5CG1A 3Q1LA 3JQ8B 2NWQA 1IULA 2J8ZA 4H16A 1XYGA 1EQUA 4TZTA 3GFBA 2G82A 1ML3A 4MVJG 1LSSA 4CQMA 5T8KC 4BGEA 3H9QA 1B7GO 3R0IA 4AJOA 3WDSA 1L1FA 4CLRB 3OSUA 1HKUA 3KLMX 5BSFA 4GSKA 4A26A 3OF2A 3WSWA 4BO6A 3ZWMA 1E1LA 2EIHA 2TMDA 2J3IA 3JQBA 4B7UA 4BQPA 4QTZA 4JBHA 1VKNA 4L8VA 5JCJD 3F3SA 2E4AA 4R51A 4UVDA 3PDUA 4H15A 4M1QA 3AWDA 1W73A 3WGYA 1LRJA 2J6IA 1E1MA 3GPDG 2I76A 3GH3A 5TLSA 1CDOA 3SC6A 1UZMA 1ISMA 3W8FA 2X7HA 3ZU4A 1E5LA 1ENPA 3NRCA 2QRKA 3NDRA 2X86A 4OHUA 1ENYA 1T2DA 5A5FA 4Q3NA 4UUMA 1GTMA 4U0KA 4A27A 1QYWA 2NTNA 4OH1A 1R4NB 3IC5A 4R41A 3ZI0A 4A73A 2PH5A 3HUDA 4TRRA 2H63A 3RFTA 2OHXA 1MG0A 1S6YA 5L95A 2Q1WA 1ZXLA 4WUVA 4W6ZA 2W98A 1RPNA 3NJ4A 2ZTLA 3ETDA 1B8VA 2QG4A 3VPXA 1VJTA 1QYVA 4TSKA 3D0OA 1ADFA 2NNLD 4GGOA 4DYVA 1ORRA 3PTZA 1NWHA 4Y9DA 4R68A 1F0YA 2IEDA 2V6GA 2PY6A 1ZZEA 1WPQA 4Z9YA 3ZN2A 3TNLA 3CPSA 4CL8A 4AJEA 5CDGA 1EE2A 4FC7A 1EVJA 2A92A 4WNIA 3GDGA 1BTOA 3KXDA 5AXBA 4YAIA 3PHIA 1VPDA 3SEFA 1TA4A 4AICA 4RQUA 1HDCA 1ZH8A 1GPDG 5EPOA 2YUTA 4D3SA 1YQDA 4A10A 4RVSA 3RUHA 1PWZA 5FFFA 3GDFA 3GNTA 2QHXA 3RC9A 1OBFO 4ZRNA 3TDKA 1KVQA 2PD6A 2GD1O 3OJOA 4EGFA 4YJHB 3QWIA 4LVUA 2O3SA 8LDHA 1LUAA 1QYDA 1ZK1A 3H3FA 3RASA 3SBOA 1Z75A 5A3VA 5BNFA 1LXCA 1XGKA 5KNLA 2WSBA 1HXHA 1NVGA 4I5DA 4JX8A 1XLTA 5JSFA 4EUEA 1F14A 3WGZA 1MP0A 3FF4A 3RU7A 1H94A 5C7OO 5CDYA 3DQPA 5F5LA 1FXSA 1IPFA 1DSSG 3ICCA 3IQDB 1U8FO 3MJ4A 3WYBA 3WGQA 2VHWA 4CJXA 4RLSA 1NX6A 1B3BA 4IS3A 3DHNA 3SLGA 4CV1A 4ALIA 1X1EA 4AJNA 4OOFA 5JYDA 4WEQA 1AUPA 1LSOA 4M86A 5TT1A 4E5MA 1VL6A 2HMWA 3GZNA 1NQ5A 3H9JA 4IIUA 4OAQA 3EVNA 5F3RA 2QQ5A 2Y05A 3SJ7A 5JS6A 2V6BA 4CM8B 3E82A 4NJMB 3ENKA 1MFZA 1UH5A 2GUGA 5JDIA 2IE0A 1LI4A 2FP4A 3I9OA 4G81A 2BI7A 3BHJA 4ZD6A 4K6CA 2RIRA 4IXWA 3GN1A 4EW6A 2FPGA 4YRAA 1U9JA 4D0SA 2GSDA 1JKJA 1T2EA 2ZB8A 3M2PA 3HFGA 4Z0TA 3PJEA 4PCVA 2Y68A 1E7RA 5JBIA 5EMHA 4CUKA 2Q2WA 2V6MA 2WE8A 1F12A 2O3TA 5ILGA 2H9IA 4CM4B 4R3WA 3GRKA 2X22A 2BMAA 2CDAA 2DQ4A 5I9NA 4ID9A 3D5TA 2ZCUA 2HJRA 4J90A 4OIMA 3LT4A 4QT0A 3GAFA 1DIRA 2GR9A 2X9NA 4N7RA 1DLIA 4HADA 3JD2A 3JD0A 3PHGA 3RBXA 3E03A 7MDHA 5EERA 4W7HA 3WYEA 1WMAA 2Z5LA 2XAAA 5EN4A 3WGHA 1ZJYA 3RJ5A 3ZGYA 4Z6KA 5BSHA 4RLHA 3KRTA 4BNNA 3PJGA 2CY0A 2AQ8A 3E18A 2P9CA 2VOEA 1P1HA 1I2CA 1OZAA 3UCEA 3QVTA 2NTVA 1BXZA 3LQFA 3HSKA 4KDEA 4URFA 3VZPA 4CM5A 4U6QA 4XB2A 2BGKA 3ZHXA 1WDMA 1QSGA 3G79A 3O38A 5KJEA 4B8ZA 1B26A 1YB1A 4OQZA 5EQDA 4J7UA 3BAZA 4CUZA 2BLLA 3IUSA 1BVRA 1NYTA 3NGLA 4Z0HO 1M75A 4ZQBA 1KEUA 4D0RA 2H5LA 3BMQA 1ZKMA 2WM3A 5T64A 3DFUA 3DHEA 4XCVA 5B4UA 3H2SA 4BO0A 3W4IA 5JNLA 3ZWVA 5J23A 5EESA 3PLRA 4K6FA 1NVTA 5EJ2A 3PYMA 3GC6A 1WWKA 4IM7A 1GYPA 2FWMX 1HDZA 4OL9A 3M1AA 2DUUA 4IGFA 1K6XA 2WWRA 1WVGA 3U0BA 5DOVA 2DPHA 2EJVA 1ZCJA 3WMXA 1NAHA 1DAPA 3PI7A 3OJEA 4X54A 4IZHA 1PEDA 2WYUA 4OXYA 1L7DA 1KY4A 2B4TO 2NQTA 3HDYA 3UCFA 4OXKA 1VSVA 5I8ZA 3TRIA 3TPCA 2Y1EA 5F1PA 5I9LA 1GDHA 1NVMB 2O3RA 3MJSA 1W6UA 5DBFA 3GDOA 3LT1A 4GLLA 3FPCA 4I5EA 4L4RA 3VTZA 4BQRA 1FF9A 3E9MA 3WICA 4CLOB 1V9LA 2JCYA 1E3JA 1T4DA 3GZ4A 1QLJA 2HRBA 5A9TA 3UF0A 1PJSA 2O7QA 2QX7A 3ZV5A 4IDDA 1I36A 1X1TA 1MGOA 4MO2A 1NPTO 1E1NA 1Z74A 2JCXA 3RKUA 1OC2A 3EMKA 4NBWA 4BHTA 4DXHA 4E31A 5KJCA 4OSOA 2EP5A 1HLDA 2DUWA 3FR8A 1PGQA 1EQ2A 2YDXA 1WNTA 1O89A 1MLDA 2HK7A 3L9XA 4GX5A 5G0SA 3JQFA 2NVBA 4C4OA 5L4SA 2VWGA 4JJIA 1YJ8A 3TZCA 1E3LA 3ON5A 1B8PA 1EZ4A 1V3TA 2AG5A 4D46A 2AMFA 5KKAA 4YJFB 4PLZA 1W4ZA 1NM5A 2ZB3A 4YCAA 1DEHA 3TZKA 1LNQA 4WJZA 3WGOA 4D42A 1UXHA 4CR7A 3L4BC 1DFGA 1G1AA 3F47A 4UEKA 5FI5A 5ITWA 4HBGA 1NFQA 4MIOA 3WTCA 4EEZA 1I0ZA 3V8BA 4HKTA 4YB8A 1JW9B 3S55A 3VPGA 5CFZA 1XQ1A 3Q9UA 3OQBA 4RPKA 1DIGA 4HY3A 2E6UX 1XELA 4LSWA 2CVQA 3RQSA 1M67A 4KUHA 1C0LA 4IQ0A 5B12A 3ABIA 3ST7A 3PQEA 2P4QA 4E6PA 3OBBA 3KEOA 5JC1A 3BXXA 2W4QA 1K2WA 2X0RA 4NBUA 3GG2A 3PWKA 1I8TA 3ONFA 3LC2O 4KMSA 2GERA 3GHYA 2BFOA 2DBVO 3QSGA 4NBVA 3JQ7A 5G4KA 4DL9A 4EJ0A 1K89A 3PZRA 3L77A 3R3SA 3H2ZA 1XIVA 3SXPA 3L4SO 3UICA 1YWGO 2QYSA 2UVDA 2VHXA 5IG2A 3E1KA 1Q7GA 3GMSA 3W8EA 2X8LA 3DBRA 2ZYGA 3GAZA 5KJFA 1XCBA 4ONEA 2YQ4A 4I5FA 2Y0DA 2B4QA 3H8VA 4DIOA 1EBUA 3NJ8A 2EF1A 4ZRMA 2GN6A 3E6AA 3ANMA 1LTHR 1Q0QA 2I66A 5JMPA 4R4JA 5A9RA 1FDSA 3CZRA 4UREA 3B6ZA 4B8WA 4YT4A 4DVJA 3JQGA 1E3WA 3WG9A 2ZTUA 1BHSA 3KYDA 4JQCA 2RH8A 4XQEA 5HS4A 2HJSA 1X15A 2PH3A 3QV1A 4G2NA 1I2ZA 2NM0A 3I9JA 1OOEA 3LK7A 5KVQA 1ID1A 5AOVA 2WYWA 3TZQA 4R5HA 3LT0A 3H4VA 1E3IA 2NTJA 3JQAA 2P5YA 1P1JA 1HYGA 2DTDA 1GUFA 3WLFA 2ZK7A 4ALNA 2C20A 1HDOA 3AUUA 1LDGA 3ZWCA 5A02A 3KEQA 4UVIA 1SB8A 2UUPA 4HX5A 3S1LA 3F4LA 1ZK4A 4FGWA 4J4HA 3H5RA 1QV7A 3Q6IA 3BHMA 3WBFA 3E9NA 3Q2IA 4L74A 2IYOA 1E92A 1ADBA 4Y6PA 4CMCA 3KBOA 4I9HA 1F17A 3GR6A 1ZVMA 4W9NA 1WZEA 4R3NA 2D0IA 1C0PA 2XXBA 1HYHA 2YQ5A 4XJSA 1HE4A 1D3AA 2Q4EA 1NQAO 3QW2A 5I7FA 4YACA 1PR3A 1MXHA 2ZATA 1U3WA 3NV9A 1MC5A 3ZNQA 2VYVA 3WS7A 2VWPA 4GWKA 2P9EA 3RCBA 4IQ8A 4S1VA 3V2HA 3VZSA 5JDCA 3FNHA 4P8RA 1CETA 3C1AA 1I3NA 3K2EA 4ND4A 4ITUA 2FR8A 3ZWWA 4NHEA 3P7MA 4JP3A 1W8DA 3FTNA 2RHRA 5ES3A 3QJ5A 1EVYA 1DJQA 3PPIA 2X9VA 1JAXA 1GR0A 3NTOA 4J2OA 5AYVA 4O63O 1BWSA 1EUCA 2ZB7A 4KUGA 4AG3A 3PK0A 2PKQO 2NVUA 2FY8A 2W2KB 3L6EA 1JKFA 4IIVA 4BL5A 1QR6A 1ZEJA 2CVZA 4MVJF 1IUKA 2JHFA 3K30A 1C3VA 1U3VA 1NFRA 2JFHA 4YRBA 4J4BA 4XR9A 1PX0A 4XQGA 3U62A 4M8SA 3ZNOA 3UW3A 4GI2A 1YXMA 1U7HA 2HLPA 4FFMA 3TL3A 3IMFA 1EDZA 4L76A 3GUCA 6ADHA 3OETA 2ILTA 3KUXA 4QFDA 1VL0A 4CMEC 3D7LA 3AI3A 1P44A 4J43A 3WQSB 3G3EA 1VL8A 1GV0A 5CDTA 1IHXA 3OICA 4L4XA 4R16A 5L53A 1A71A 4DQVA 1R15A 4FPXA 1N9GA 3NGXA 3F5SA 4PG6A 4OQYA 2X1HA 4MVJA 1B2LA 1DDOA 1R12A 3D1LA 2NV6A 4MDHA 4CMIB 4DGSA 4BNVA 5L40A 4UUPA 2CUKA 3EGOA 4GH5A 3UFXA 4Q39A 5U1PA 5IN4A 2B69A 4GPD1 3GF4A 2B5WA 2IDZA 1AHHA 2O3QA 1SOWA 1AHIA 3CUKA 1PJTA 3GG9A 5A05A 1MUUA 2FN7A 4LGVA 3B1JA 5JAIA 4CM1A 1YBAA 2NU6A 2QZZA 4CMHA 4XR4A 2HU2A 3PWZA 2X5KO 4A2CA 1DBVO 1O95A 2C54A 1O8CA 2HMVA 4BKUA 4BKRA 2OBYA 5TF4A 3GT0A 2Q50A 3RC2A 3RI3A 4IBOA 1NTOA 1SAYA 4NPCA 4PLFA 5IDXA 2X4GA 3GEDA 3QRWA 3S8MA 2YFHA 3T4XA 4QO8A 4BNLA 3LC1O 3ETGA 4D43A 3I23A 1E7YA 5KCZA 3DZFA 1D1SA 5L7TA 4B3IA 1S7CA 1C1DB 4BGIA 1N8KA 4I1IA 1IL0A 3MOGA 3PZBA 1Z6ZA 1PQWA 1CQIA 2W2LD 1WP4A 1GEEA 2XOXA 3ZWYA 2CFCA 4TRMA 4UUOA 3UXYA 4DLLA 2X5OA 4XIYA 4XRGA 4PLPA 1GUZA 4QECA 5IZ4A 3ZU3A 4CV0A 4E32A 1WLYA 3CXRA 1LEHA 2OP1A 4FFPA 3DZJA 1TVEA 5TJHA 2FZEA 5CDSA 2BFMA 1KC3A 2Q2VA 2FMUA 4QSMA 2J3JA 2PNFA 2Y1OA 4PG5A 1NXQA 4J3FA 3G17A 4I9UA 4RVDA 5EIOA 1HDYA 3L07A 4QUKA 9LDTA 5LDGA 2Z95A 1Y5RA 2OUIA 2NU8A 4MKXA 4DRYA 4YTEA 1U4SA 4IJVA 1P74A 4ZQEA 1H2BA 1Q1NA 3DMTC 1Z82A 3DDNA 4NIMA 3BYZA 3DZHA 3GK3A 1UDBA 1XG5A 1C14A 1C0KA 1NNUA 3IAHA 3BZUA 4EZBA 1KBZA 3OQ1A 4PLCA 3S2FA 3I9LA 4IY1A 1N1GA 3GQVA 4XX0A 3AM3A 5AXAA 1GFSA 5CG2A 3C1OA 1OI7A 3DB2A 1YL7A 2GCGA 5FF9A 1W0CA 2GZ2A 2B35A 2X23A 1CF2O 3BTSA 1PJ2A 3ITKA 5DCYA 4EI2A 3U5TA 2DPGA 4KTTE 1SPXA 3IUPA 3QVXA 2NADA 3JTMA 3K92A 4RVGA 4YYZA 1ISHA 1QORA 1X0VA 2OMEA 4DWVA 2NU9A 2CZCA 3N74A 1NQTA 1YDWA 4L73A 2FR0A 4R1TA 5FEUA 4DC1A 4ND1A 4M87A 2PD3A 1TB4A 1BXGA 2EGHA 3STHA 2C2YA 3DBHB 3E8XA 4GX2A 4U5QA 1HETA 4BKQA 1R0KA 2P68A 4FC6A 4LRSB 2ZJ1A 3TL2A 5TS3A 2JFFA 2IXBA 1ZNQO 4FFNA 3ZWXA 4J1SA 5A3JA 1EVZA 4PZCA 5A1TA 4NI5A 2DVMA 1Y1PA 2P9GA 1NR1A 3G49A 3WJAA 4ZN6A 5A06A 3AU9A 3JV7A 3HDQA 3K5PA 5T57A 5HRUA 4WPGA 3DONA 2QYTA 4YA6A 3VH2A 2ZIZA 3U09A 1ONPA 1GUYA 3W6UA 4FIZA 4DMLA 3I52A 1ZO8A 5CHEA 1LJ8A 3ZV3A 4BB6A 2Y1CA 2BH9A 4E4YA 4JBGA 4BO4A 3CIFA 4ZQFA 3N58A 3AU8A 5L7WA 1MX3A 4BKOA 3HZZA 1CYDA 2HCTA 3GEGA 1DC3A 3KYCA 4UULA 3I3OA 2CNBA 3VH3A 5LCXA 3WNQA 1VM6A 1IHYA 2I3AA 4GAEA 3WBBA 2RCYA 1PWXA 3RIHA 4YR9A 5A9SB 3DXFA 4FOOA 1XHLA 2G0TA 3VDQA 1NR7A 4WLUA 2OBNA 1HT0A 3ZDFA 5DN9A 1KERA 1YDEA 3BMQB 5DBGA 1P1IA 4GWGA 4BO8A 1B3RA 4ESOA 2JHGA 4RVUA 1A4IA 4L0QA 4W99A 5CAEA 3AJRA 3PIIA 3RUIA 1U8XX 1U5CA 4QQRA 3BHIA 2RBEA 1CQJA 4XYGA 5JO0A 1R16A 4AJPA 3MJEA 3NT2A 4NBTA 1P45A 4F6CA 3FN4A 4JLWA 4UEJA 1HE5A 2DBRA 2VZ9A 5L51A 3DOOA 1RYEA 1AXEA 1T1SA 2PZKA 1JVBA 3W6ZA 4NJOA 1Y8QB 3LVFO 4YT8A 1J49A 5JE8A 2X5JO 4WCFB 1I01A 2NSDA 4RVHA 1PQUA 1NAIA 1E3SA 3BTVA 3P2YA 2OXIA 4IDBA 1A72A 2YHIB 1V35A 1BRMA 4IGEA 1BDBA 2DM6A 3KM0A 3OA0A 2J5KA 3VKVA 3FR7A 1U2GA 5JAZA 3JQCA 4Q3AA 4TMFA 5DDIP 4JROA 4IINA 2YV3A 3KB6A 5JY6A 4TKLA 4YEDA 2BELA 4GVXA 1RKXA 4CLEA 2D5CA 4AJ2A 4IDCA 4FFOA 2I67A 2OP0A 5CDUA 1UAYA 3L4BA 3ORFA 4NK4A 1LX6A 2LDXA 5IXSA 1NBOA 4IDGA 1QMGA 1Y7TA 4Q3BA 4NFYA 4RPGA 3V1TC 3PLNA 4TVBA 3ROQA 2PGLA 3CINA 1O9BA 3DTTA 4QXMA 4OKNA 4FR5A 1PJ3A 2D5AA 1PZEA 1R66A 3VAZA 2R00C 1N2SA 2WDZA 1EVIA 2YY7A 3MTJA 1HE3A 4XIJA 3WJ7A 4CQMD 3PQDA 4FDAA 1DXYA 3KSUA 1JWAB 2WMDA 5GZ6A 2EKPA 1PIWA 3A14A 4Z3DA 4CM6A 3CMCO 5T6BA 5TJ9A 3TOXA 1Y5MA 4HFRA 4ZICA 1C1XB 1O6ZA 3BMCA 3CMMA 4PGFA 3UN1A 4BNHA 3GVCA 1D4FA 2DC1A 4PLVA 4CLHA 1Q7CA 3F46A 1H2HA 4E5NA 1GL3A 3QWFA 1SO8A 4UEOA 1PTJA 1PSDA 3D4OA 1IYZA 4E12A 4BVAA 2JL1A 4R01A 3ZV6A 2E82A 1JQBA 3N7UA 4JBIA 2VOJA 1PL8A 4NU5A 1ONOA 4K26A 4NZ9A 4DREA 3F9IA 3JQ7B 4DUPA 2G17A 2EXXA 1UJMA 3GY0A 2IZ0A 3IP1A 1RM4A 3RU9A 3JD4A 4ALMA 3QIVA 4Q9NA 4AJLA 2BRUA 2PKQP 3K31A 2BKAA 3DBRB 2Q4BA 4IMPA 3ZW9A 1NHGA 3JQBC 3ANLA 4A5OA 3FHLA 4PLGA 3IL2A 4GL4A 3ZHYA 3CKYA 4OJNA 1OMOA 3T7CA 3RUCA 3FNFA 2Y0EA 1DRUA 1JAYA 3T7EA 1GD1O 4MIYA 1NQOA 4B79A 1PJQA 4AFNA 3QLJA 3PWSA 3UUWA 5I7EA 2C7GA 3NTQA 1E3WB 3QVOA 3ZV4A 4I9NA 4O6VA 3RAJA 4XYMA 5K9ZA 1R4NA 5ENDA 3I6IA 2CVOA 4ZQHA 3IKTA 1BGVA 5K0ZA 2X6TA 1PJBA 1PJLA 2E49A 4MPDA 1TXGA 3OMLA 4EJ6A 1XKQA 3LZ6A 3BMNA 2O23A 1SEPA 2JFGA 4IDFA 1A7KA 3W8DA 1DIBA 3CZMA 3DZKA 1ISFA 2HKIA 4ZVVA 1GQ2A 2PZMA 1Y8RB 3DEYX 2VHZA 3ZHBA 2B83A 2DBZA 3B1FA 4DIFA 5JAMA 4OM8A 3T4EA 5I8WA 1KVTA 2D3TA 3IP3A 4KZPA 1MXFA 4Q3DA 3QQPA 4Z9XA 1NASA 4HFMA 5HWSA 4BUCA 4B4UA 2X0JA 1O5IA 4Y98A 2WD7B 2QRLA 3V2UA 1QG6A 2G76A 2QW8A 3B70A 1AXGA 2DTXA 5I7VA 3VKUA 4CODB 1SNYA 1Z73A 4GVLA 4KP7A 1PZHA 4RDHA 1KVUA 2JAPA 2ZCVA 4TRNA 1DPGA 1YQGA 3WFJA 5HBRA 3DC2A 4WLFA 1F8FA 5CPFA 2CF6A 2YW9A 2DLDA 5L4LA 1DC5A 1E6UA 3WSVA 3NAQA 3PFWO 3QE3A 1ZMTA 1O94A 2BD0A 4C7JA 5KKCA 4EYEA 1H93A 3F1LA 3FNGA 4E5PA 5U4QA 4FQ8A 3PDJA 2XF8A 5TC4A 2JAHA 2HK8A 4AJIA 4OO3A 3DHYA 4LN1A 4ZA2A 1Y9AA 3P19A 4RZHA 2Y1DA 5FWNA 1CEQA 3ANNA 4E2ZA 5JC8A 4N54A 3MTGA 2C5AA 2DTEA 4GQAA 3WFIA 4BV9A 2JD2A 2NVUB 3IOYA 5BNIA 3A1NA 4Q3EA 3AY7A 3UH1A 3VHRA 5FYDA 1RWBA 5U9CA 9LDBA 5TT0A 1UP6A 3ASUA 3S2EA 1B15A 2GRAA 3OIGA 1K5HA 1LBEA 3UCXA 4BGUA 3EZLA 3TJRA 3PYXA 1LLQA 1Z45A 2JCVA 3GA0A 3WB9A 1ZUD1 5F21A 4J2HA 3LU1A 1BW9A 1Z7EA 2W8ZA 4NJMA 1YOVB 4BNWA 1UXIA 4PN3A 3D3WA 4WOKA 1ZFNA 3PHJA 3TZHA 5GY7A 4XEHA 4U0JA 3CH6A 2D2IA 1GU7A 2LDBA 1DAOA 4CMJA 2EKLA 1R0LA 3NX4A 4GBJA 1XEAA 3HN7A 1U28A 5ER9A 4YAJA 3DOJA 3TF5A 3VVBA 4CM9A 4CQLB 2VUUA 5BQFA 1L7EA 1AGNA 3K73O 4IXTA 4GKVA 5C7LO 2HO5A 3LC7O 4ZHSA 1Q0HA 1GQYA 5THKA 1LA2A 1VJ0A 3FPLA 1N9GB 2I9PA 1IPEA 3UAGA 3A28A 2YDYA 1IB6A 3GPIA 2Y0CA 2G5CA 3V1YA 4E5KA 1JN0A 4BNTA 3C85A 2A94A 1FJHA 4JNKA 4PRLA 3K6JA 1K6IA 3HN2A 2AHRA 4P4LA 5B37A 4CV2A 4PVCA 5JMWA 4J16A 3VZRA 3INTA 2AA3A 4J1QA 4KOAA 1NP3A 1ISGA 1PGPA 3ONDA 4R69A 4DLAA 5COBA 3WGIA 2O4UX 3KTDA 3M6IA 4F3YA 4RJTA 2CF5A 4PVDA 4BMNA 5KVVA 4J7XA 1YGYA 3HQ4O 1P33A 2WTBA 3I4FA 4BNIA 4WOJA 1KC1A 1NPDA 4UVGA 3RKRA 1MV8A 3PXXA 4WASA 5TNXA 4E21A 2Q2QA 1VKOA 2XPCA 4Y6SA 4MKRA 1I2BA 3AOGA 4DLBA 3SC4A 5MDHA 5KOIA 2Q1TA 3MOIA 4OMUA 1WZIA 1JTVA 1LU9A 3I9KA 2GN4A 1PJ4A 3QA9A 5ICMA 4J0EA 1YRLA 3LYLA 1XQ6A 2P2SA 1HF3A 2GPTA 2OZPA 3AM4A 3Q2KA 3ZCXA 1TT5B 1SCUA 2J5RA 2VTDA 1GY8A 3JQ9C 1HLPA 3ZWNA 1DFHA 2VNAA 1HTBA 1WDLA 1M6WA 2C5EA 1GEGA 1ONNA 1SB9A 3HJAA 3ASVA 4P38A 4KTVE 3Q9NA 2VT2A 3OA2A 1R4MB 5IDYA 5KVSA 3HB4X 3ZWOA 5HTOA 2GNAA 3HE3A 1X7HA 2VWQA 2FPPA 1A9ZA 4FS3A 1GAEO 3B1KA 3ADOA 1E6EA 4QEDA 1UXKA 2I3GA 3JSAA 3H7AA 4YT2A 4M55A 4BO9A 5C3MA 3ROPA 3WR5A 3GVIA 3I4CA 1XDWA 5DCWA 1M66A 2A4KA 4E30A 4NG5A 5BT9A 1U5AA 1UZLA 2PGJA 4YT5A 1EK6A 2J5QA 3D64A 1E0DA 4DIBA 5LC1A 1VSUA 5ICSA 3DMTA 4RF2A 5DZSA 1TEHA 4CLOA 4E2YA 4WE3A 1KEPA 4NH4A 4FN4A 4INAA 4WCFC 5KJ1A 3V2GA 1E77A 4CM7A 2ZJ0A 4B4VA 4PLHA 2P4HX 1HSOA 1LLUA 4GSLA 4YJGB 1GCUA 1KYQA 5BSGA 1WXDA 3GFGA 1MG5A 4XZ3A 4Y67A 4HV4A 4BO1A 2BGLA 4XDZA 1PS0A 5K6AC 3WX0A 1LLCA 3I6QA 4XRRA 4N5NA 4R1SA 4J0FA 2CMDA 4ALLA 4EEXA 1ISIA 2X9GA 1DLJA 3I1JA 3KO8A 4DC0A 1P9LA 4YJFA 1YQXA 1HL3A 3CTMA 2AEMA 3RC1A 3JQFC 4DBVO 1P31A 2AEJA 3HNPA 3TFQA 4FSHA 4DPKA 3OJ0A 1ENOA 1FDWA 1LDYA 2O50A 2W90A 4RO0A 3RFXA 4YQZA 3U4DA 1T2AA 2E48A 3X2FA 1MB4A 1WDKA 5T8KA 2QZ9A 5KVCA 4Z9FA 1VLLA 1BXGB 4TKMA 4B4WA 3VVCA 5IFLA 3WMWA 1VE9A 3OIFA 1T1RA 2D4AA 2YV2A 4R9SA 3RROA 2VYNA 4NR0A 7ADHA 4CQMB 2EJWA 4HUJA 5A4DA 5JYEA 5T67A 3I9MA 4PIVA 1QKIA 1QRRA 3QVSA 3DWFA 1YJQA 4TROA 4BNJA 3OJFA 3QVWA 2FOIA 2UDPA 1RJWA 1PL6A 2O48X 1B0AA 2VZ0A 4J7CA 5F5NA 3JQDA 4LW8A 2IZZA 5G2OA 4AJ1A 1U3UA 5AXDA 5HM8A 2EEZA 5H81A 3EK2A 3OJLA 1R0SA 2UV8A 2Y99A 1P1FA 4KQWA 4L9RA 2O2YA 1DIHA 3KVOA 1JU9A 4EITA 3AFMA 3PEFA 4W7IA 3GGPA 1RM3A 5TQVA 1I10A 1DJNA 1ZSYA 3H5NA 2HMUA 3JQAD 1FDUA 1IOLA 3G1TA 2ZQYA 1PS8A 5JCJA 2IZ1A 1PGJA 2Q1UA 4E0BA 1DHTA 4D41A 2YHUA 1OAAA 2OOSA 4CM3A 2VRBA 2NLOA 1YB5A 2V65A 1J6UA 3F5QA 5CP8A 5EQFA 3E5MA 3O03A 3GGGA 2C2XA 4FW8A 2QRJA 4BO7A 3DBLA 2X0IA 2PV7A 3ROMA 4EUHA 1YONA 2UAGA 3FBTA 4FD3A 4C7KA 3VH4A 3C1TA 2FSSA 3IDSA 4L75A 4MVJH 3OM9A 3HDJA 1RM0A 3TSCA 1I3KA 3FRJA 3JD1A 2VYVD 4OOEA 2G1UA 4JIGA 3AOEC 2ZTMA 4BNZA 3FCOA 4MP3A 5C7IO 4DTIA 2Q49A 4WNCA 5TIIA 3KYBA 4BMVA 2I99A 3EDMA 3MJTA 1P1RA 2D1YA 3KV3O 3O4RA 5B4TA 1ZMOA 6LDHA 5DCUA 2YZ7A 1BDMA 1E7WA 2IEBA 3RUAA 4J91A 5IZCC 3OEYA 3RWBA 4H7PA 4HFJA 1VRWA 4II2A 4MINA 1J5PA 1Z7BA 1Y9EA 3DMYA 3O26A 3RBVA 5CEEA 2F1KA 1KVRA 1ZJZA 3ZWPA 3D5QA 2C29D 1DO8A 3JQEA 1H6BA 1YL5A 1UXJA 1JLLA 4PZDA 1ADGA 4IQGA 5HA5A 1DHRA 4WLNA 1VC2A 2O3UA 3DZBA 3WGGA 4D44A 1X13A 3G1UA 3K9QO 4I08A 4YAEA 4FJ1A 4BNXA 2HUNA 4CLXA 3ENNA 3QWAA 4DA9A
chains in the Genus database with same CATH superfamily
1THMA 2C0CA 2VUIB 3O5AA 4HJXA 4DJAA 2NVOA 3G68A 1M5UA 3AR8A 1JBEA 3IJ5A 5HF8A 1KARA 5GMOA 2XXJA 4PZYA 1H6DA 1XK6A 2ARKA 2FN4A 3GZNB 4H7IA 4IJKA 4IPTA 4BMSA 5LWQA 1SZDA 1ETUA 3N53A 2G9RA 1GGKA 1HZZA 1NU8A 4AS2A 3S5UA 5HXAA 1K27A 4L22A 1PUXA 3FF1A 3NPMA 2Y2VA 3NKLA 4JEIA 5K4HA 4RZ3A 3IKVA 2QSZA 4GS5A 4IZOA 4I8DA 4KKVA 4OXXA 3UZUA 2FPGB 4JJKA 3TIGA 3UT6A 5H8WA 4R1OA 4QVGA 3UK1A 1NXTA 3GVHA 1UBTS 4LWPA 1QFMA 3N6VA 1IONA 3KKNA 4KFUA 1HA3A 4NE2A 4A6DA 4CTOA 3QBEA 3TLMA 5JCPA 3CLKA 3UA3A 3CKKA 4IRUB 3TTWA 2BUBA 4WFJA 1EFLA 3V1KA 3ZYCA 3Q9LA 3AL2A 1IIRA 2FP3A 4JI6B 2EGGA 2GM4A 1ZU4A 4UM5A 4UMFA 5MGBA 2IY8A 3KB2A 4LOAA 4ZEVA 2HA2A 4L0CA 3AEUB 4LQCA 4RJIA 3V1MA 2G83A 3VO8A 4RD6A 2PWAA 1KEVA 4FZ3A 1BROA 3LLSA 3FZEA 1L7AA 4J0JA 1BZYA 2ZE6A 4FCVA 3ONVA 5EIWA 1XWFA 5CD1A 4TL6A 3G0IA 3K32A 3IO5A 3WO1A 3JYNA 4DSUA 1KEKA 2QX6A 4TV8B 1J8YF 3A2NA 3CB2A 4COKA 5LUAA 3NONA 4X66B 1BMFD 1PUIA 4ZICA 4LSMA 2VH1A 5EWLA 3HXQA 1K3TA 1C9EA 1ZSNA 1O95D 2VKQA 1VYUA 5K5EA 1VCNA 1T2CA 2IY7A 4K6OA 3I42A 3U4HA 2O8CB 2Z4RA 5K1ZA 3C24A 4S3MA 4BLQA 3ULKA 4ZI7F 1CYEA 2JFZA 1LJUA 1XD9A 2P0AA 1C29B 1NFFA 4PG8A 1RJGA 4EA7A 4JYPA 5HMMA 2YBDA 1EU1A 2W4MA 3FLBA 1DAIA 3BMOA 1SEVA 1TD1A 1FTSA 4FVTA 2JD0A 4ND8A 4NCXA 4CW7A 2ZVJA 4F5ZA 5BMVB 3EE6A 5LYJB 4LZLA 1EFCA 1NN5A 2LPMA 3CX4A 4JA2A 1R0WA 4KK3A 4E2FA 3UJBA 3KKEA 1C1YA 1ZP6A 2IP2A 4J75A 4JLOA 4QREA 5DM4A 3T7KA 3W8NA 1LRKA 1WW2A 2V3VA 4P83A 3WLLA 2MMCA 2FW1A 3LQQA 3SMVA 3ZXIA 1FW6A 1R8JA 1QQ7A 2ZDQA 3HY4A 3NALA 4IW3B 1UKEA 3JVDA 2W6CX 3N0WA 2N1BA 3ZVLA 3H97A 4G85A 5D1HA 2XVXA 1V3VA 2QSYA 4O2AB 2GF0A 3B6KA 1DRWA 1KO8A 1XZQA 5EKXA 1V5WA 3UJCA 3N8KA 1IZ7A 1NVVR 4YAUA 2IXGA 5DMHA 2VK4A 1DO0A 1QO7A 2X3FA 2C82A 4E21A 1TJNA 1KVSA 2NSJA 1C1DA 4RF5A 2MSNA 4RULA 1XMXA 3J80A 1ST3A 2CNNA 2AWOA 4HTAA 4X60A 5CM2Z 1E6WA 2EKQA 3HHPA 4QJIA 2RJOA 5GM1A 3TGLA 3ZHSA 4FDVA 1V6AA 1Z6AA 1QAMA 2BFPA 4QOIA 2ZKIA 2BCGY 3DOIA 1HQKA 2PQ6A 4GPIB 1LDNA 1W85A 3L7KA 4NQRA 3GI1A 3ZDDA 4MS4B 2H1HA 4I5GA 1JEAA 4ALJA 2HK9A 4MQ4A 5D3MA 5G0VA 1X70A 2DPLA 2ZR0A 1V8FA 4RSGA 1UP7A 2RMKA 5DP2A 3FHJA 3WV4A 4Y8VA 4J9UE 1JA9A 3OOWA 4Y1EA 4L9SA 1JQDA 4KIGA 3IFSA 3RJMA 1SK9A 1EK5A 1N5RA 3EIQA 1EM6A 5J2UB 5C31A 5MFPA 4LXHA 4HO1X 2OD9A 1Z26A 1A9RA 2B0JA 4E13A 2YWGA 2EW8A 2LCIA 2NZVG 2ZWIA 3JWJA 2HLDA 5F2NA 3VKGA 4PHTA 4KV7A 3EFBA 5CHYA 1UC9A 1SCQA 5IAJA 1JMKC 3O2NA 1HFKA 1T6XA 4WADA 3TLXA 1J20A 5K3AA 1QC5B 4RTSA 1BSVA 2ZQ5A 4BOYA 1HDRA 3FD8A 4ZT7A 4D3FA 1J1IA 1QAQA 1FK8A 1RI4A 4O59O 1E7SA 3R9KA 2X2OA 5FOTA 2FPUA 2Z2KA 3EOBI 1QOQB 2AUTA 2VC2B 3FUCA 1WDTA 5JSKA 3MHTA 3K0CC 5A4JA 1RLIA 1SU8A 1TCUA 3H65A 3PQ3A 5LR6A 5F9FA 4KHPB 1VPTA 4L5YA 3TBHA 1X94A 3LF2A 4QO7A 3GIDA 5FNVF 1U1FA 4B0PA 1YJ5A 5IAAA 2DOKA 1CY8A 1OWOA 4JJ6A 5EXPA 2HMYB 1K5GA 2ZS8A 2X2FA 3K4QA 2ODAA 1JVNA 3JY6A 1AE1A 4IJWA 4J1NA 4D9EA 4XYLA 1YRBA 4DMGA 3NBMA 3S28A 1X1SA 1HPLA 2I33A 2QVZX 1D1TA 2R84A 4JBLA 4KBGA 4ZCQA 3U80A 2FUCA 1R37A 1N25A 4HAYA 1L3IA 2IYPA 2ZAIA 3N5CA 4GIBA 3FYCA 1K7YA 4C6TB 1Y1SA 4GI5A 1ZL0A 4OYYA 3AR2A 4G37A 1IPHA 1TJ5A 1WF6A 5AMXA 3WK5A 4JP2A 4F5DA 4OMFG 1M10A 3EGCA 2IPOA 4FQ5A 3LA6A 2RIPA 5KSZA 1XDZA 3FW1A 4RH1A 2NUTA 4E6EA 3H1GA 4HXEB 1CDEA 1VCMA 3TYXA 3TXXA 3HCWA 3B7GA 4IMRA 4WN9A 3WBJA 4E70A 2PM8A 2A9QA 4RVFA 5E1DA 4YAKA 4CLRA 4BTLA 3L46A 3PC8A 1BX1A 1P4HA 1SOMA 3R09A 1U8AA 1WO8A 2X8BA 4PYLA 3FB4A 1L5SA 1NNSA 1AQ6A 3FUTA 1A8IA 2IYSA 5J2TF 5GQSA 2C92A 1UM9B 2PWYA 2P1RA 3AY6A 5ERGB 1BX0A 4D0GA 5ADVA 3DTYA 1LK5A 1E60A 2RI0A 1MIOA 4JJGA 1HDXA 4Y9RA 2GXQA 1NF8A 5IH7A 1H1TA 4IDQA 2OCAA 2QTVB 2RH4A 1GXSA 2GM5A 3H2GA 2KSQA 4FMCB 4U2EA 2NN3C 2YJ6A 2WAYA 3ZHCA 3FKSA 2XEDA 2QGFA 1OVMA 3JQGB 3G7UA 4BYMA 4PTLA 3ZQUA 3WWDA 2HRZA 3JASA 3K8OE 6ABPA 1M2FA 2F3RA 5T7BA 1UZNA 3NWJA 3GFRA 4N6GA 2XIJA 4D9JA 1XC7A 3EY4A 3LLVA 4TQAA 1W0JD 3VR6H 2IZ6A 3QYAA 4YO7A 3PRKE 1Y9ZA 5FHQA 4F56A 3DFMA 2JHPA 4YCJA 3FG9A 2X42A 3O90A 2FRDA 4AI6A 3KQOA 4UFNA 1X7GA 4BIIA 1TRHA 2H07A 2Z0MA 3JVUA 3KTOA 5BXYA 1GLGA 4GMFA 5GIOE 2FN3A 4XOIA 2OO5A 2SNIE 5F76A 1TIKA 3EJWA 3ICPA 2PT9A 1I14A 1MOZA 4F5YA 2OGUA 1I7PA 3IRUA 3MC1A 3NR2A 4HQLA 4AVYA 2HF9A 5IUJC 3EWSA 3ZJVA 1W59A 3DUWA 4ZCLA 1SU4A 3LHDA 3NNDA 5L7YA 5BYAA 4LMBA 3GQBB 1BXKA 3RK1A 1LVUA 1R6AA 2VT3A 3KNZA 4P3XA 3UEOA 1U1EA 2DGDA 3WKCA 3WLMA 4D98A 2RAVA 1V2HE 1C3OA 1FP1D 2FPPB 1P62B 2A9FA 3AHDA 3RFVA 2H1OA 3DMFA 2MR6A 5AIAA 3UMCA 1DUIA 4X6XA 4XSVA 1IRIA 3UJAA 4AW9A 4NJEA 5B3JA 4GZMA 1DBQA 3UQYS 5A4FS 2A67A 1EFPA 3LM8A 1AY0A 1S3IA 2K4MA 3R3ZA 1TLTA 3ZWAA 4H6VA 5FWXA 5EEHA 2CJYA 4LE2A 1GKIA 1CS0A 1W88B 2N9UA 2PV0A 2C78A 3ESBA 4RVNA 1R0XA 1FB5A 3OZTA 3V32A 1R5JA 3GN2A 3ZBPA 4BCCA 4DPLA 1ESDA 3O7WA 4HZUA 2PSHA 3H6GA 4BRUA 3NH6A 1N2CE 4NZZA 4BLTA 4TXHA 5CIQA 4XB1A 1QH9A 2WMOB 4S0XA 5GP1A 2ZKLA 4AY2A 4EDFA 2P9YA 3QLVC 1FFSA 1GUDA 2CJWA 3KOWA 2AVNA 4FGJA 1DS6A 5DULA 2IQ5A 5C5IA 4NBSA 1MVLA 3ZIAA 3BB4A 1E5QA 1SUSA 3L43A 3WYCA 1F51E 3HG7A 4J4TA 4X5OA 1JXAA 1Y9DA 1CR1A 1G5IA 2YJ5A 1ORIA 3K0FA 4M21A 4WZAB 1RQ2A 3SM9A 4UPVA 2ZCJA 4BZZA 4CT5A 2AXNA 1ARZA 3NYWA 3MEQA 4QEZA 5DJ5A 2AEFA 2ZBEA 1NURA 2Z1DA 1EJ6A 3QQ5A 1RLMA 4I3HA 1IWPB 4RL6A 3A9WA 3LIIA 4CN9A 2BFAA 2X0KA 5F64A 3IEKA 5ISMA 3F3YA 1QO0D 4YRDA 1KKMA 5DN6D 5DXJA 2VK1A 4EY3A 2WJWA 3VR6D 3L4KA 3EIWA 1VHTA 2CDBA 1PW7A 3PIDA 5FUYA 1GA6A 3JALB 4INZA 3S2IA 1IZZA 2R1VB 3GFVA 2O8BB 3O6VA 1U0TA 2INGX 1GIAA 4AJKA 1G0OA 4WESB 4MR7A 1ZD8A 4JXXA 5K2OA 1A7AA 1K86A 1M34B 1QF7A 4LXQA 2VI5A 4O5OA 3TB6A 3WLAA 4DR4B 2RHHA 1XU9A 1Q7BA 1Y7HA 2JK0A 5AP9A 5IF9A 3LZDA 1DOZA 1CZRA 2IPNA 3A05A 3CRVA 4OIFA 5C18A 2IEGA 4P3PA 4F92B 3PDIA 3VC7A 4XCQA 3TKLA 5JWRA 1FDRA 2ZRCA 3I5YA 5BWNA 2H4ZA 5I7HA 1US8A 4GBGA 5FPKA 4YFVA 4HB2A 4S35A 5ITZB 4Z3OA 1IY8A 1QIMA 1J23A 4K28A 3UHPA 4CNQA 3UMVA 4QU5A 3HCDA 4HLUC 2VRCD 3UFXB 4B3FX 3LDGA 2IYAA 2ROQA 4JLJA 4L3VA 2W2QA 1H2XA 3OKCA 5CURA 3B20A 3DMNA 1QP4A 5KS2A 1RWMA 4IUDS 3PD7A 4B2PA 1SRRA 3OWOA 1I94B 3I9V6 1PFVA 1E7MA 1JHAA 1E9EA 2QRVA 3PGVA 1XX6A 1KDRA 3KT3A 5G4LA 1E2JA 1NYQA 2XUGA 1NBME 5C0OE 2P77A 5JJ5A 2D5BA 2BZ0A 3UAOA 2B8WA 1SUEA 3GOHA 1GOTA 2OZLB 3ENQA 3U9LA 1Z0KA 2H06A 4RV9A 5AJYA 4TS3A 2B99A 4KE7A 4Q7LA 4YCLA 4WLVA 3H2KA 3UJ3X 5KWVA 3WGLA 4BNDA 4TRJA 4NOJA 1DC7A 3TLAA 1BWQA 1KIFA 2HJVA 4TV9A 4FP9A 5EIBD 5K8UA 3Q11A 2IDMA 3O8RA 4NV3A 3W4JA 3HXTA 1G5HA 1CNEA 4I1VA 4PG7A 5IN5A 3AY0A 3CNHA 4BS9A 4CU2A 3AYZB 1VOTA 2O4CA 3DL2A 3OAAD 3JQ6A 5HKBA 4YFYA 1KEEA 4YVFA 5J23A 1W5FA 1NHWA 3KHUA 3LGAA 3WOHA 3GLGB 2EAUA 4DILA 2RI6A 3G82C 2NO0A 1EDOA 3QEOA 5DSZA 1P5ZB 3DBLB 1PDOA 2HHAA 2P27A 2X8JA 1Q1EA 3DD1A 3F5MA 3IILA 1TMYA 3OEWA 4BFYA 3K0KA 4D6YA 1PZFA 2VTVA 3CRZA 5DRYA 3OHSX 3KKMA 4RZUA 1D03A 4HD8A 5T5QA 1E0AA 4ZMBA 2IHTA 2O5EA 1CIVA 1RFLA 1UKVY 2Y9MB 3ZC3A 4F46A 1WQ1R 1ZNZA 1SIUA 2ECOA 2JASA 2IRWA 5DHRA 1JIUA 3L40A 3JYHA 4YXFA 5I3ZA 3ITDA 3M4JA 4RJLA 1Y8RA 1PLJA 3NEPX 3L8GA 4QOEA 4EBFA 1ZK0A 3HU3A 5ALVA 2VVTA 3H0EA 3AR3A 1SXJC 2FFRA 4DY4A 1XLVA 2D00A 3RVSA 5F77A 3AHCA 2YRXA 1YCGA 1K4YA 3AERB 5IAKA 5ICFA 4ZYXA 4EB8A 1L8AA 3CNLA 1RC0A 1GSHA 2Y0PA 1YIDA 4MAAA 4B2IA 3WRXA 4PPNA 4PTZA 1WOYA 1N8SA 3DEHA 1FFWA 4EHLA 3A2MA 2P69A 4OXNA 2FZWA 4MQEB 2X58A 4HN2A 4PGMA 5KOHA 3QY9A 4MCIA 1VMAA 4C08A 1OT5A 3VPSA 1RW4A 3U7FB 4I3GA 1S7GA 1CJUC 1JF8A 1SWWA 3KQKA 1Q2XA 1NGSA 2R96A 1DIAA 1X1BA 2YWCA 4UHKA 5COAA 1T5DX 5TEVA 3F7NA 3KLNA 4GYKA 1S3GA 2BFWA 3KJIA 4BJ6A 2JLBA 2ZOSA 1LI5A 4PIPA 1IM8A 1OFGA 4LK3A 1R3UA 3V5NA 2XA9A 1GT91 3FUXA 3GA5A 4D45A 5KX5A 2OBBA 2Z6VA 1OY1A 3MFYA 3OH8A 3QU9A 4GWLA 4WUTA 4EMTA 5JH7B 3STWA 3CVUA 4D4GA 1OFTA 4QLAA 4HSGA 3LHFA 4P7GA 5DBEX 5HMLA 1LNZA 1UIRA 4ACBA 1LBSA 1RJDA 2R97A 3MNFA 1RACA 5THQA 3V4VB 2CHEA 4ENWA 1KJ9A 2PUJA 2OXEA 1OLOA 2P9FA 2YJ3A 3GUZA 3RV4A 3TJMA 5CVUA 3CA8A 5EJ6A 2EQBA 3BD6A 5ESRA 4ND6A 2R6JA 4LZAA 1QIDA 3H3JA 2C1XA 4RD1A 2W37A 2VAXA 3FNBA 3QE4A 4TS1A 5CM9C 5I9MA 1XPUA 4QBIA 4XGRA 1P77A 1OLUA 3DNFA 4AQYB 2FZKA 3I2YX 4QFCA 3FYSA 4GOOD 3HBJA 4GYWA 4BEWA 1ORHA 1Q0LA 3LA8A 2ATIA 4EIWA 5LZ9A 1RXEA 1K8ZB 1T0HB 9GPBA 4CDNA 4LQ4A 1CXZA 1BXRB 4AKHA 4TLBA 4ER0A 1OV6A 2WTXA 3UKOA 5A2QA 4IDAA 2VP9A 2FAXA 2VDOB 2VQDA 2WTUA 4XYBA 4Y1FA 2B1GA 5A6SB 1I3LA 1WB6A 2OHJA 5BWCA 3C45A 4BKMA 1GLNA 1WAMA 3EVEA 4WNAA 1UANA 3NBKA 1ZMBA 4BZPA 3WIBA 4EHHA 4KN9S 2ENWA 4KO4S 2NACA 3QWBA 4RKYA 1SUPA 4ZO6A 1MO2A 1X1QA 1NA5A 3BERA 4D3YA 3I39X 3QX3A 4RXTA 1E9FA 2YZKA 1W47A 3SICE 2D5LA 1CB7A 4EY7A 3T3NA 4QATA 1P7CA 3H9GA 3DZCA 4WDQA 4CQLA 2VUTA 4QOFA 3UOGA 2AZXA 1G3UA 3L6CA 3EVDA 2OYCA 4AWXA 3RAGA 3H4MA 3OIVA 1H8EA 3ZZNA 2V4ZA 4FSDA 3PFIA 5CFLA 3SVTA 4C7OA 4PLWA 1BA3A 3QHAA 1A3CA 3KG2A 4LDNA 1SVKA 3G0CA 4KUEA 1T5SA 2I6QA 1WB5A 3W1WA 2DX7A 3I2GA 1TMKA 1XALA 3TFOA 1VCOA 4NCBA 4L72A 1VIVA 3V33A 2O14A 5IJ0A 1AO3A 4O4IF 2JS7A 3PRHA 5FR1A 5KOYA 5IK2D 3DOCA 2I6TA 2HYDA 2OORA 4O1HA 3T5CA 1BMQA 5FUVA 4DG9A 3O2JA 3TQHA 2HWKA 4MQ5A 4Y30A 5FLKA 1LX7A 3O93A 5DOZA 3CLVA 4PAGA 5JHHB 3K71B 2GEJA 1NRIA 1PR9A 1BJKA 4LYGA 2IYVA 1CS4C 2C03A 4J9VA 4EMBA 1K3FA 4C21A 4X8HA 4HEA6 4ECAA 1GLVA 3K4HA 2C5SA 2V4MA 4BGVA 1TFRA 2WE7A 1FDOA 4G65A 1VLVA 1M1UA 1PBTA 2HQ1A 1TAQA 4RKEA 4EJSA 4XQCA 5CEFA 4LA4A 1XOIA 4ESHA 4TVOA 1JZQA 4D4KA 1QTRA 3ZHVA 4RK6A 2O1EA 1BKYA 4OP1A 1A77A 1CUWA 3CF2A 4GMKA 1E3TA 3NXKA 1GYRA 3BORA 1TAGA 4E2WA 1CQJB 3PV0A 3I61A 5LZ4A 5IYZF 1WS6A 1WNFA 4GL2A 2M6KA 1LJLA 3SG0A 2ID9A 1SBHA 1NWCA 3EZGA 3IT2A 4HNGA 3DOUA 4LY9A 2FWPA 5ENVA 5AVOA 3UUEA 4F8YA 1TT5A 5E1BA 3U44B 1ZH4A 4BQOA 3F7MA 5BT8A 2NVWA 4MS1B 3AZPA 1N2IA 4PC2A 4NFHA 5CTJA 5ALUA 1EMDA 3BIOA 3K70C 1R4MA 4XDYA 4BNMA 2BFCB 2PQMA 4LVCA 2OCLA 5E8RA 5DEOA 1R5NA 4BVGA 3PDHA 3PG5A 4FONA 3OZCA 3WGTA 4DA6A 2BSAA 5DNCA 2OBXA 2B7LA 2MWMA 2YWBA 4MYSA 4TT3D 4BE4A 5JRDS 1TVMA 1V8ZA 4ROSA 2NXEA 4QDUA 1YJXA 3O4FA 4W5WA 4W9NC 3PX2A 5BNTA 2ZI9A 3S8YA 4KMRA 1LNSA 3RS7A 1GNVA 3EYAA 1ZH2A 4NE9A 4YRFA 1KJWA 1X8JA 4E2XA 3SC3A 3RSSA 1DP4A 3A25A 4C0AC 5KWEA 4Y6LA 4JK3A 4EG8A 5LXTB 1JWLA 1JDJA 1VPEA 3WIVA 1WXFA 4PC1A 5L3VA 2P4UA 1N5JA 3ZIDA 1JAIA 1P3DA 2AYZA 3D2AA 2AW5A 3MLBA 4Q6WA 3W2TA 3IAM6 3AF0A 3LUAA 1XWWA 3LD9A 4X97A 2HU8A 2ZE8A 4K40A 5FPPA 5DGXA 5MN6A 1Z8NA 3BILA 3FNEA 2A3RA 4B9EA 1CU1A 1W94A 5EZYF 3GJ4A 4RACA 2WNIA 1RHUA 1QV9A 3B5IA 1D04A 1WZNA 4PXYA 1NZFA 1KI6A 2PS1A 1K9VF 3NEYA 1EHYA 3KC2A 4Z0PA 1H1DA 2HOQA 5T4EA 3OZGA 3TQSA 1G20B 3ANXA 3EAGA 5EKSA 5IT4A 3JYPA 1PGOA 5BV8A 3U19A 4KYIB 4LHYA 1DC4A 3TD2A 5ILOA 2XGMA 3QJYA 3OPXA 4RPCA 5LOVA 1X0XA 3AJEA 4ZCTA 2C8KA 1TIBA 2VYND 3P0JA 4JS0A 1Y81A 4Y9SA 3SF0A 2PG3A 1V0JA 2PRKA 3ZCQA 2VSNA 3FX2A 4Z2AA 3DLBA 4MLPA 3UNXA 4EG1A 3CNEA 1B6SA 1LZLA 2ZIEA 3MWDB 4ZAGA 4B3DA 1GKKA 4MP6A 4N3BA 5E4TA 2QW0X 3VR0A 1E3EA 1OIWA 3X1MA 3BC1A 3QNUA 4E33A 3P2MA 4OUKX 2EV9A 1NP7A 2R11A 2WVJA 1DOHA 5JNTA 1KGSA 1G9SA 3S2ZA 1P1BA 1EX1A 4HNQA 3I62A 3Q1LA 3JZIA 5TMPA 3HSYA 5CT9A 4A4DA 4H16A 4BBZA 4TKUA 5DB4A 3VR5A 4MVJG 2PFKA 3BD8A 1JV2B 1T1EA 1ECBA 3QUQA 5T8KC 2GOYA 3DL0A 2DFTA 1JPVA 1UPAA 3KLMX 2WUEA 2QU7A 3CY6A 1KMMA 3MCZA 4LBVA 1T3HA 3RYHA 2CN1A 2N0SA 5L3QA 4O2BA 1AUVA 2XGSA 4BO6A 5GTDA 1E1LA 3JQBA 2TMDA 3FJOA 3PT9A 3W5UA 4H17A 1KBQA 1F5NA 1QRDA 3QVGA 4HDRB 4PW0A 1R88A 1VKNA 2VEDA 1KRHA 3VQTA 4Z7NB 2VJKA 1XCGB 2FA9A 2R7AA 4F21A 1AMUA 1C9NA 1OUMA 3AWDA 3HFRA 4I99A 1RXWA 2ORIA 5FOQA 4Q48A 3CLSD 1NI4A 5TQ0A 3GPDG 2BGRA 4UU7A 3RSGA 3KKLA 3BGVA 5CB0A 3X1ZA 2J09A 1CVRA 1ENPA 1NQUA 2BGIA 3EZNA 4ER3A 4WXEA 3AIKA 4F2GA 2HADA 2AMYA 3RNOA 3RPEA 1PYDA 4I6JA 4A27A 1W30A 1YR3A 2C8VA 4BUJA 1AV7A 3IC5A 4X90A 1RYYA 4A73A 4PYOA 3V7FA 1QZUA 3HUDA 2H63A 2OHXA 1YZHA 2OAQ1 2P2CA 4X1OA 3K9LA 3PBKA 3ZLTA 2AR9A 4YRLA 1MT0A 1VLZA 1RQGA 2ZTLA 2BZ1A 2HF8A 3VX3A 3WYGA 1FQWA 3ETDA 3VPXA 1S89A 1TTTA 4ZDJA 2BKUA 5ULLA 1GL6A 1QYVA 3D0OA 1ADFA 2X77A 2GMWA 3WLTA 1C30B 1JH8A 1RE0A 2YWEA 4P4SB 3E0XA 4A2WA 1ORRA 1TQ8A 2IEAA 1NWHA 4Y9DA 4CKZA 4R68A 3CBQA 1T0PA 1Y42X 3A8TA 4GM4A 4Z9YA 3ZN2A 1YIAA 3BKXA 3L5OA 3OFVA 4A0HA 2I3BA 2DMRA 1E0KA 4MPRA 1BX3A 1EE2A 1QH8A 1U6KA 1WD5A 3R7AA 1AZWA 2JLAA 4REQA 1CSEE 5FWYB 3HB0A 4OD0A 3PHIA 1VPDA 3PNKA 2XUJA 1KHHA 2PJUA 3A3YA 3BGSA 4UUBA 4AICA 4D5EA 1GPDG 1CF9A 2VNKA 1LH0A 3L18A 4FYIA 3FB1A 4JLBA 1JLSA 1XHFA 3GNTA 1FLNA 5HQJA 3SEAA 1MGPA 3URKA 5GM2A 2FZGA 3OY2A 1OBFO 3RC9A 2WWGA 1G21B 1K92A 1XTQA 3GT3A 4LVUA 4TZ0A 2R3SA 3H75A 1WZUA 3BX1A 1VKRA 2RGRA 4RANA 3H3FA 5HJ7A 1VGVA 4UJ5A 4ZYZA 5A3RA 3U13A 4V0ME 3L0ZA 1NVGA 1CUGA 4R9VA 5JSFA 4ZU1X 1F14A 1MP0A 1TJYA 2COKA 2X9LA 3OEHA 3FYDA 4YRMA 5EAIA 3ICCA 3K72B 3WYBA 3DHVA 4R7ZA 2VHWA 3WGQA 4CJXA 4B48A 3EAQA 1YZ3A 1NXXA 1NX6A 1B3BA 2IK8A 3A27A 4LYYA 5FJIA 5D84A 3F8TA 1Q0TA 3C16C 3RTGA 4PYJA 2PS9A 4OOFA 5IH3A 5AKIA 3K9BA 1EXWA 2W6ID 5TT1A 1QIEA 2PUDA 1FRZA 4E5MA 4V0OA 4LJ4A 1VL6A 6Q21A 3A6PC 3GZNA 5JSZB 1U0LA 3H9JA 4IIUA 2JW5A 5B53A 2X7XA 2QQ5A 5F3RA 3LY8A 4X71A 2Y05A 2V6BA 3R24A 3E82A 1EZ1A 2JLRA 3HGMA 1RI1A 3QELB 4RHUA 1HNNA 3O3OB 2JZNA 3PL5A 1IJEA 2HA6A 5FYQA 1WKVA 3T4PA 5JDIA 4G81A 3UPUA 1VI6A 2BI7A 3BHJA 4ZD6A 3FYHA 3S1SA 4UDNA 3GN1A 1DX9A 2FPGA 2HREA 3VYWA 1E79D 3LX6A 1YDHA 2LUOA 4IG9A 2DWUA 2IHUA 2QTFA 4Q02A 1XZKA 4RIEA 3H8WA 4BFZA 1T2EA 4Z0TA 1OHHD 3CW8X 4XWGA 2YJGA 2VPPA 4X8OA 1VIAA 3QPBA 1J9ZA 1C2YA 4HLQB 5HG0A 5EMHA 4CUKA 4C04A 3ECAA 3GLUA 2O3TA 3GLHB 4IQFA 2I3DA 2QM8A 1U02A 4PCLA 4BLWA 1H4QA 4I66A 1LBIA 3GRKA 5I9NA 1WMFA 2DQ4A 2FEXA 2C2WA 3MYYA 3AEUA 3U31A 3D5TA 5MN5A 4W5OA 3QOFA 3RRJA 1QMPA 2BUCA 2VAPA 3OPYI 4UNPA 5H3LA 4OTZA 4HYYA 2P75A 4QT0A 5FUQA 3GAFA 1DIRA 5HKKA 3HJBA 1NF2A 3Q3HA 1VSQA 1K4MA 3E03A 2WT9A 3OO1A 5JAHA 5C53B 5EERA 4TV8A 4W7HA 3L7YA 3GPLA 5EN4A 3WGHA 1GPLA 1VPWA 3NHWA 3HB1A 1YZNA 5B1HA 2G70A 4E14A 3RB8A 1UWVA 5IKMA 3IMGA 4Q05A 2B8EA 1HL7A 2P9CA 3O73A 4CE6A 3PNQA 2O8CA 1I2CA 2I0FA 4D96A 4HBZA 3ROGA 2XV1A 3LQFA 5HE9A 3PCXA 2V7TA 5EE1A 5TPZA 1K5PA 4O4LF 1TQ4A 1Z06A 4F3TA 3VZPA 3T54A 2ESRA 4XB2A 1GPKA 2VP5A 4B80A 1XF1A 4WXYB 1WDMA 2WWVD 2OM6A 1QSGA 3O38A 3ZHXA 2WB2A 5KJEA 3AHGA 5IJAA 3D6HA 3LPMA 4B8ZA 1HNXB 5BMVA 5HIIA 1SBTA 1XPRA 3T1QA 4MIKA 3R3HA 4O29A 1WA5A 2BLLA 1OBOA 3OZXA 1BVRA 1K8QA 1NYTA 2P7HA 4PRYA 3GJ3A 1JEJA 2JHCA 4NESA 4ZQBA 4H1UA 4C2UA 1MF7A 2R8BA 2ZBQA 4E1AA 3KUDA 5SZJA 2WKPA 4XCVA 2GHTA 3WK7A 4KO1S 4HH3C 5B4UA 1QIGA 3CT6A 3GD7A 3H2SA 3UWKA 3U7GA 2F8SA 2Q3LA 4QC2A 3FVTA 4H4CA 1L4MA 2XDQB 5JMOA 3ZS8A 2H1FA 3GC6A 4X41A 5DNVA 1NJSA 3SZUA 4TTJA 5BV1A 1YAJA 1GYPA 3UAZA 1UZAA 1Z7WA 3O74A 1DARA 4OL9A 5EYPB 5BN5A 2DUUA 3EGIA 4MWSA 4E09A 1WVGA 4IYRA 5B6PA 4P86A 5AHOA 2O0MA 4E51A 1EGVB 3UWMA 3L0BA 1CE8A 1OGIA 2FZVA 3NI2A 3NHJA 2ADFA 1ZD5A 4OXYA 3HDYA 3FGPA 2BL4A 2F4NA 1VSVA 3TRIA 4KIWA 4MS4A 5F1PA 3CISA 3JZDA 2W6OA 1V8PA 1WBBA 1W6UA 5DBFA 2D2VA 2P6UA 3KB8A 1T9BA 1KNQA 1FF9A 3E9MA 3TRDA 3HYRA 4CLOB 1W1IA 3IAS1 1E3JA 1IVYA 1E1DA 2OVFA 1WLSA 2J59A 3DBIA 2QX7A 4V0MA 4ZCRA 5HOEA 4MO2A 4GDMA 2Q0XA 1RRMA 2D3WA 1MQSA 4F85A 1AMNA 5BSWA 4QDOA 4BFTA 4G0UA 1OC2A 3EMKA 4FU0A 1FFDA 4XH9B 4ASUD 4DXHA 1R0ZA 1Z35A 1TU0A 2ZUSA 4JJ4A 3FR8A 4ZGGA 1D2EA 5HR5A 2D4HA 1VIMA 2N47A 4N39A 5EKUA 1EM8B 1MLDA 1NMEA 1B74A 2HK7A 3FDFA 3FCSB 4GX5A 2OA0A 3T9BA 4AMUA 3CVWA 1QC5A 1I6MA 4RGVA 2FUG1 2W43A 3K94A 3E2IA 5FX2A 1B8PA 2AG5A 4IJ5A 5A0FA 2GZHA 1AGRA 3EQ2A 1DEHA 1JDNA 2I4NA 3GCXA 2HXYA 2NZ2A 3DYIA 1G3MA 4L6CA 4Z1MA 1TM3E 2YX1A 4WJZA 2PX0A 4ZAYA 3RGWS 3HBFA 3WGOA 1P4RA 3PXDA 4Y2XA 1UXHA 4Q7EA 1MX9A 2WFAA 3G5UA 5F7ZA 1G1AA 5FI5A 3T0IA 4CR7A 1BD3A 5TDHA 3K8QA 2M6RA 3PC3A 3CGWA 4HNSA 4DKXA 4TPKA 3HU5A 1C41A 1M7GA 5JXJA 3LP5A 2ZITA 2IUUA 1QFZA 1QGYA 2VDQB 3HU1A 1XEXB 4TLAA 1GPUA 1RI2A 2PU7A 2QT0A 3GO4A 3OQBA 4X61A 5DPMA 4IICA 1XMIA 5E3JA 2O8FB 1JHDA 5ES4B 3RQSA 3KT6A 4K9LA 3HVHA 5B12A 4TMKA 4ZWNA 1L5HA 1ZVKA 3KIPA 5KTYA 1RZRA 4JLAA 3R6TA 1FVFA 2QLTA 3LRPA 5E6SB 1MW8X 1P17A 3EA5A 4U2BA 3KEOA 4KR2A 3BXXA 2CW5A 3IOCA 1HR0B 1QP0A 5A0VA 1K2WA 1M34E 2JJQA 4EGAA 4GPBA 4EKYA 3K3PA 1GZHB 2QENA 3F9CA 1I8TA 3KUCA 1R8YA 2GERA 3MMXA 3PNYA 3GHYA 4QM6A 1DQYA 2HV8A 2AOTB 1FYXA 4NBVA 3JQ7A 4Q93A 4DL9A 2XBLA 1K89A 4DWJA 1DCFA 4EJ0A 1IG0A 1B00A 3L77A 3NHPA 5A3SA 4ZYUA 3GUUA 1XDSA 1UOEA 4M7WA 1U7XA 1XIVA 2XHZA 3L4SO 1I7DA 2B7CA 2O1WA 2WNHA 3U81A 1MDBA 1Q7GA 1UJ6A 4AO8A 1UM9A 2X8LA 2BDUA 3D2BA 3VZCA 1FXWF 1S2OA 4O8CA 1R1DA 3PC8C 1EWQA 3GAZA 3I28A 2IPLA 1XCBA 2E2WA 2PBZA 2CXSA 5FTWA 2V7QD 4JA0A 3U3MA 4BY9E 2B4QA 3M5PA 4DZRA 2HR1A 2BMVA 3G7SA 5JMPA 1Q0QA 2I8LA 2V0NA 4R4JA 1XEWY 3TQQA 4R2IA 4KLAA 5DV9A 1NSYA 1HE8B 1VDZA 4YREA 3B6ZA 1G5TA 4JLKA 3DCIA 2Z4TA 3WMFA 1S1MA 3JQGA 5AK5A 3PDWA 1BHO1 5BR4A 1SD2A 3GEBA 2RH8A 4U2KA 4UATA 4US1R 2HJSA 2BHTA 3NAZA 3T5MA 3K15A 3HH8A 2O07A 1AB6A 5KVQA 6CHYA 2F43B 1E8NA 2CK3A 1AKNA 2XCUA 1L3BA 5KDDA 1P1JA 2I55A 2EP8A 1UIMA 4ALNA 3KSAC 2FNAA 4DBLE 1HE1C 4X93A 2WW8A 3IV7A 4C6RA 3ZWCA 5A02A 4EYOA 1UJCA 3GFSA 1UJBA 3GLGE 3AGQA 3AG6A 2FW8A 1JP7A 3IHKA 1T34A 4NCHA 4J4HA 1AK1A 5IARA 4KFCA 4LPSA 1QV7A 3Q6IA 3NDPA 3TIIA 3DP9A 4QGSA 3WBFA 3WFZA 1FNSA 1B0PA 3E9NA 3GZJA 3Q2IA 1XTJA 4L74A 2IYOA 4UBMA 5C8YB 2PGOA 1I9CA 2FRDC 1E92A 3AFGA 2G4LA 3OKPA 4OJQA 5HCIA 4CMCA 1ZIOA 3ZJUA 3KBOA 2P1DA 4TTAA 1VB3A 2GA8A 5GGYA 2OQVA 3UMMA 1W6RA 2D0IA 2XXBA 2YIVX 3EEIA 2HMAA 3VR2D 4XJSA 4O2LA 2QX8A 4NOLA 4BX0A 1CUUA 3V9AA 2HZ7A 2Q4EA 2HNKA 3R3WA 3QBDA 4H9GA 2DHQA 4YACA 5CYFA 2ZATA 1U3WA 5AKGA 3ZOZA 5I7FA 2YOHA 3ZNQA 4UTZA 3WS7A 1JLLB 1EQAA 2CUTA 4ARCA 3VKFA 1RTKA 1RP7A 3V2HA 4OF4A 2QW1A 3OBIA 1VG9B 3AI7A 2M1ZA 4ND4A 4ITUA 5FHRA 2BKEA 4JQOA 1RQXA 3PX3A 3SYTA 2DPMA 1QFXA 4UAUA 1W88A 3BM5A 2ODQA 3LX5A 2GO7A 4NHEA 3VYVA 5K0JA 1J00A 1GL9B 1V47A 2X5XA 3WLSA 4B47A 4Z7JA 1W52X 5B3JC 2ZRGA 4BFXA 1FJXA 1ZAYA 4M1YA 3VSBA 4O4HA 4V0NA 1BEEA 2FN9A 2XZDA 1ZLXA 2WG1A 4J2OA 1DELA 2DEUA 1BS1A 5KINB 1FA9A 1QVZA 2GJKA 3F6PA 4O63O 2PRIA 3H5LA 1U0SY 3I37X 2QQFA 4RIHA 4YP5A 5CGQB 5DYYA 3RS8A 3PK0A 1JILA 5AJVB 3ZTTA 2NVUA 1CY0A 2FY8A 2W2KB 5J59A 4BL5A 2GK6A 2QLBA 3E2PA 2CVZA 3MGAA 4MVJF 1IUKA 5EZQA 4B3GA 2HL6A 2JHFA 3K30A 4WZAA 1EUYA 5IAGA 8ATCA 1B8OA 1U3VA 5LP6C 4ID3A 1NFRA 5AM0A 4D81A 1T3LA 4CXMA 1WXHA 2QZPA 2SICE 3PF9A 4FS8A 2P4EA 3C6BA 3PR1A 4HTFA 5CDHA 2OVBA 1AKMA 1Z4NA 2KB0A 2OB2A 2XB4A 2Y1KA 1PL0A 3DEFA 3PNBA 3K2QA 2HRDA 1XZMA 3KKKA 3N2GB 2W42A 4N48A 3TIXB 2VAVA 3C5EA 4DVGA 4R8SA 5ESDA 1E9DA 3O0DA 1M0WA 2HLPA 1JHPA 3HR8A 3IMFA 1EDZA 4L76A 2DHCA 1MBZA 3OETA 5AUOB 2ID7A 1XQYA 3CHYA 1SN7A 2LCFA 3R5TA 5L3RA 4Q9DA 2A7XA 4WFKA 4QFDA 2Q5FA 3HYSA 4OQFA 5TY0A 4WESA 4XVCA 2D0OB 4RQAA 3DF7A 1UK9A 2VR1A 1G8MA 5DFAA 3UAXA 1M34A 3PFCA 2C0PA 5CDTA 3OICA 4L4XA 5ALEA 2QR3A 1HFEL 4PGAA 1QP7A 1R15A 4Z4GA 1M5TA 2HIGA 2OYSA 1I13A 2QMHA 3DA8A 3ZS9A 1QH0A 3J81k 1V1MB 1SA0A 2XMSA 2JEZA 1B2LA 1R12A 4H4DA 4MP3A 3IAFA 4QPNA 5ITZA 2V54A 2H11A 4MULA 3SGLA 3KOZA 4UUPA 1GAWA 3HO8A 2CUKA 1W25A 4GH5A 3UFXA 3UMYA 4B85A 5IN4A 2B69A 1FIUA 2OPBA 4ZREA 3IMKA 1K0FA 1AHHA 2IDZA 4H1HA 2PMKA 1QQ5A 3RAEC 2FMTA 2CL5A 3B1JA 4RH3A 5DU2A 5JSYA 1KI7A 4CM1A 2YOGA 3L8YA 2XRFA 2XUFA 4J16C 1RWQA 2QZZA 1KPHA 4PY2A 1C7FA 2EWVA 2HU2A 1BMFA 4XR4A 2VEOA 3AJAA 1AS3A 2X5KO 3HP7A 1K6EA 1V7ZA 3HVUA 2WF9A 1O95A 1JIVA 2C54A 2HMVA 4MR8B 3ZE1B 3ABRB 4CKCA 1G2IA 1KSFX 2OZLA 2VDWA 4WKCA 4DANA 4FFBA 1TECE 2Q5HA 4TWAA 2H57A 4I4TF 2A58A 1SAYA 2Q5EA 1N5IA 1W29A 3MIZA 4ZOCA 4EUNA 3WRYA 5I4KA 5D3KA 5IDXA 1TW2A 3KVVA 1FTNA 1N8TA 1TYDE 4BNLA 4FXPA 3C3EA 1ZUNB 3I23A 4PQEA 3SQOA 3RRXA 3OQPA 5J63A 4L1KA