4CVIA

Neutron structure of ferric cytochrome c peroxidase - deuterium exchanged at room temperature
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
292
structure length
292
Chain Sequence
PLVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFNDPSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGKTHLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKDAPSPFIFKTLEEQGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neutron Cryo-Crystallography Captures the Protonation State of Ferryl Heme in a Peroxidase
pubmed doi rcsb
molecule keywords CYTOCHROME C PEROXIDASE, MITOCHONDRIAL
molecule tags Oxidoreductase
source organism Saccharomyces cerevisiae
total genus 108
structure length 292
sequence length 292
ec nomenclature ec 1.11.1.5: Cytochrome-c peroxidase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00141 peroxidase Peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.420.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 2 Peroxidase, domain 2 4cviA02
1.10.520.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 Peroxidase; domain 1 4cviA01
1CYFA 4NVDA 1AEKA 1AEEA 2VCSA 5KQ3A 2PCBA 1BEQA 2V2EA 4NVGB 5AMMA 1ARPA 1SDQA 4NVIB 4BM2A 5JHXA 5KQ0A 5KSFA 5SXWA 1JCIA 1CCLA 4JM5A 3WNUA 1C8IA 2RBVX 4A5GA 1HSRA 2EUNA 1QPAA 1CCIA 3M28A 1H5HA 4XV4A 4FCSA 5JHYA 5EJTA 1BJ9A 1QO4A 4XV6A 1CPEA 1H55A 3ZCGA 4NVJB 1U75A 2X08A 4NVOB 2CCDA 2VNXX 1H5IA 2RBYX 1H5EA 2V23A 1AEHA 2RBZX 4PAEA 1DSOA 4JQMA 2N18A 2RBTX 4NVFA 4G05A 1BEKA 1U74A 4JMBA 3VLJA 2AS2A 1CCPA 2BCNA 1S73A 3M26A 5CIHA 2XIFA 5SYLA 1CPDA 2GHKX 3FJWA 5ALAA 5SX7A 1U2LA 1ARUA 2B11A 2RC1X 5KQ2A 4XV5A 5SYJA 4FCNA 1H5MA 2EUQA 2GHDX 3M2GA 3ATJA 4A6ZA 1CMTA 1ZBYA 4JMTA 1CPFA 2B0ZA 5SX3A 3Q3UA 4JB4A 4NVBA 3M23A 1MN1A 3UT2A 1S6VA 5JHZA 4A7MA 4NVNB 1MKQA 1KZMA 2VCNA 5CIBA 1DSEA 1DJ1A 2RC2X 2B10A 5L05A 2CCPA 1CK6A 3FKGA 3CCXA 1Z53A 2CEPA 1H5JA 4FEFA 1LLPA 2B12A 2XILA 4XV7A 4CCXA 1PA2A 1BVAA 2AS1A 5CIEA 1GW2A 1YZPA 5KQKA 4BM0A 5SYYA 1LY8A 4JM9A 1RYCA 1H5CA 5SYKA 4BM1A 4CZNA 5SXXA 3ZCYA 2IA8A 1CCBA 4CZQA 1AEBA 1U2KA 5ABQA 2VNZX 5CIGA 2Y6BA 3E2NA 1MKRA 1CMUA 2X07A 1H5GA 4CZPA 4JMWA 3UW8A 1BEPA 1MN2A 5FNBA 3VLMA 4JQJA 1AA4A 1BEMA 1A2GA 2AS4A 2GGNX 1GX2A 5SYHA 7ATJA 1AEGA 1AEFA 1ARXA 1LY9A 2E3AA 5JPRA 1DJ5A 4NVHB 4XVAA 1EBEA 1CMQA 5SYUA 2XJ5A 1UB2A 3M25A 2VCFX 2GHCX 3R98A 2PCCA 1YZRA 3M27A 4BLXA 2AS6A 4JPLA 1BGPA 1LYCA 4JMAA 2Y6AA 2EUTA 1DSGA 1CPGA 2XIHA 2AS3A 4CUOA 5SW5A 1MNPA 5L02A 4USCA 4XV8A 3RRWA 4JQKA 2WD4A 2ANZA 3M2FA 1CCKA 1AEOA 1KOKA 3M2AA 1H5FA 3VLIA 4FDQA 5CCPA 2YCGA 2ATJA 1ITKA 5SX6A 3FMUA 2W23A 3HDLA 3RIWA 5SX0A 5FNEA 1ARWA 1W4WA 1OAFA 5D6MA 4BLLA 1B80A 1AEQA 1H58A 5AL9A 1U2JA 4GEDA 4BLNA 1KRJA 2YLJA 4C51A 1JDRA 1CCAA 3M2IA 3E2OA 5SYVA 1GWOA 1GWTA 1BESA 4CVIA 1YYDA 1OAGA 3M2EA 4ATJA 4JN0A 1KXNA 2GB8A 3M8MA 5SX0B 1GWUA 1A2FA 2Y5AA 5SYXA 4CVJA 3FM1A 2EUSA 1AESA 1KXMA 2JTIA 5CIFA 1AEMA 3FM4A 1V0HX 2RBXX 2XJ6A 5CJHA 5ABNA 2AQDA 1APXA 1AEDA 1AEJA 2CYPA 5SX1A 4JM8A 1MK8A 4JPTA 5SXRA 3RIVA 2CL4X 4JMSA 2ICVA 4JPUA 1CCEA 1AC4A 4BLYA 5ABOA 3R99A 2GHEX 4JMZA 2RBWX 1H57A 1AEUA 2EUUA 5SXQA 1SBMA 1AC8A 2VO2X 1CMPA 3M2BA 1H5LA 5SYIA 5KQ6A 5AOGA 6CCPA 4BM4A 5L86A 4NVMB 1AEVA 3M5QA 4JMVA 1H5DA 2XI6A 3VLLA 2GHHX 3ZCHA 1IYNA 1ARYA 4OQ7A 4BLZA 1B82A 1HCHA 1SJ2A 2EUPA 1ATJA 4A78A 7CCPA 3M29A 5SXTA 3M2CA 6ATJA 1W4YA 4NVAA 5KQIA 5CICA 2E39A 4NVKB 5SW6A 3M2DA 1DSPA 4NFGA 5EJXA 4CZOA 2RBUX 5KSKA 1DS4A 1LYKA 4P4QA 1AETA 1GZAA 4NVEA 5SXSA 1FHFA 1AENA 1STQA 4NVLA 2VKAA 4JQNA 4NVCA 1BEJA 5SW4A 1LGAA 1CCCA 2XJ8A 1B85A 5SX2A 3CCPA 4CCPA 2RC0X 3X16A 5KQHA 1ML2A 4JM6A 5SYWA 1GZBA 2E3BA 4BLKA 1SOGA 4BM3A 2BOQA 2CCAA 1QGJA 3M2HA 1H5AA 1ARVA 1YYGA 1CCGA 1H3JA 3FM6A 4A71A 1DCCA 5JQRA 4C50A 1SCHA 3VLKA 1ZBZA 3WXOA 3EXBA 5CIDA 4CZRA 3VLHA 2EUOA 2EURA 1H5KA 1CCJA
chains in the Genus database with same CATH superfamily
1CYFA 4NVDA 3WA8A 1AEKA 1AEEA 2VCSA 5KQ3A 2PCBA 1BEQA 4GKFA 2V2EA 4NVGB 5AMMA 1ARPA 1SDQA 4NVIB 4BM2A 5JHXA 4H79A 5KQ0A 5KSFA 5SXWA 1JCIA 1CCLA 4JM5A 3WNUA 1C8IA 2RBVX 4A5GA 1HSRA 2EUNA 1QPAA 1CCIA 3M28A 1H5HA 4XV4A 4FCSA 5JHYA 5EJTA 1BJ9A 1QO4A 4XV6A 1CPEA 1H55A 4QYZB 3ZCGA 4NVJB 1U75A 2X08A 4NVOB 2ZOPA 2CCDA 2VNXX 1H5IA 2RBYX 1H5EA 2V23A 1AEHA 2RBZX 4PAEA 1DSOA 4JQMA 2N18A 2RBTX 4NVFA 4G05A 1BEKA 1U74A 4JMBA 3VLJA 2AS2A 1CCPA 2BCNA 1S73A 3M26A 5CIHA 2XIFA 5SYLA 1CPDA 2GHKX 3FJWA 5ALAA 5SX7A 1U2LA 1ARUA 2B11A 2RC1X 5KQ2A 4XV5A 5SYJA 4FCNA 1H5MA 2EUQA 2GHDX 3M2GA 3ATJA 4A6ZA 1CMTA 1ZBYA 4JMTA 1CPFA 2B0ZA 5SX3A 3Q3UA 4JB4A 4NVBA 3M23A 1MN1A 3UT2A 1S6VA 2ZCAA 5JHZA 4A7MA 4NVNB 1MKQA 2BO5A 1KZMA 2VCNA 5CIBA 1DSEA 1DJ1A 2RC2X 2B10A 5L05A 2CCPA 1CK6A 3FKGA 3CCXA 1Z53A 2CEPA 1H5JA 4FEFA 1LLPA 2B12A 2XILA 4XV7A 4CCXA 1PA2A 1BVAA 2AS1A 5CIEA 1GW2A 1YZPA 5KQKA 4BM0A 5SYYA 1LY8A 4JM9A 1RYCA 1H5CA 5SYKA 4BM1A 4CZNA 5SXXA 3ZCYA 2IA8A 1CCBA 4CZQA 1AEBA 1U2KA 5ABQA 2VNZX 5CIGA 2Y6BA 3E2NA 1MKRA 1CMUA 2X07A 1H5GA 4CZPA 4JMWA 3UW8A 1BEPA 1MN2A 5FNBA 3VLMA 4JQJA 1AA4A 1BEMA 1A2GA 2AS4A 2GGNX 1GX2A 5SYHA 7ATJA 1AEGA 1AEFA 1ARXA 1LY9A 2E3AA 5JPRA 1DJ5A 4NVHB 4XVAA 1EBEA 1CMQA 5SYUA 2XJ5A 1UB2A 3M25A 2VCFX 2GHCX 3R98A 2PCCA 1YZRA 3M27A 4BLXA 2AS6A 4JPLA 1BGPA 1LYCA 4JMAA 2Y6AA 2EUTA 1DSGA 1CPGA 2XIHA 2AS3A 4CUOA 5SW5A 1MNPA 5L02A 4USCA 4XV8A 3RRWA 4JQKA 2WD4A 2ANZA 3M2FA 1CCKA 1AEOA 1KOKA 3M2AA 1H5FA 3VLIA 4FDQA 5CCPA 2YCGA 2ATJA 1ITKA 5H9FB 5SX6A 3FMUA 2W23A 3HDLA 3RIWA 5SX0A 5FNEA 1ARWA 1W4WA 1OAFA 5D6MA 4BLLA 1B80A 1AEQA 1H58A 5AL9A 1U2JA 4GEDA 4BLNA 1KRJA 2YLJA 4C51A 1ABVA 1JDRA 1CCAA 3M2IA 3E2OA 5SYVA 1GWOA 1GWTA 1BESA 4CVIA 1YYDA 1OAGA 3M2EA 4ATJA 4JN0A 2A7UB 1KXNA 2GB8A 3M8MA 5SX0B 1GWUA 1A2FA 2Y5AA 5SYXA 4CVJA 2WSSS 3FM1A 2EUSA 1AESA 1KXMA 2JTIA 5CIFA 1AEMA 3FM4A 1V0HX 2RBXX 2XJ6A 5CJHA 5ABNA 2AQDA 1APXA 1AEDA 1AEJA 2CYPA 5SX1A 4JM8A 1MK8A 4JPTA 5SXRA 3RIVA 2CL4X 4JMSA 2ICVA 4JPUA 1CCEA 1AC4A 5CD4J 4BLYA 5ABOA 3R99A 2GHEX 4JMZA 2RBWX 1H57A 1AEUA 2EUUA 5SXQA 1SBMA 1AC8A 2VO2X 1CMPA 3M2BA 1H5LA 5SYIA 5KQ6A 5AOGA 6CCPA 4BM4A 5L86A 4NVMB 1AEVA 3M5QA 4JMVA 1H5DA 2XI6A 3VLLA 2GHHX 3ZCHA 1IYNA 1ARYA 4OQ7A 4BLZA 1B82A 1HCHA 4U7UB 1SJ2A 2EUPA 4JZAA 1ATJA 4A78A 7CCPA 3M29A 2OEBA 5SXTA 3M2CA 6ATJA 1W4YA 4NVAA 5KQIA 5CICA 2E39A 4NVKB 5SW6A 3M2DA 1DSPA 4NFGA 5EJXA 4CZOA 2RBUX 5KSKA 1DS4A 1LYKA 4P4QA 1AETA 1GZAA 4NVEA 5SXSA 1FHFA 1AENA 1STQA 4NVLA 2VKAA 4JQNA 4NVCA 4H7AA 1BEJA 5SW4A 1LGAA 1CCCA 2XJ8A 1B85A 5SX2A 3CCPA 4CCPA 2RC0X 3X16A 5KQHA 1ML2A 4JM6A 5SYWA 1GZBA 2E3BA 4BLKA 1SOGA 4BM3A 2BOQA 2CCAA 1QGJA 3M2HA 1H5AA 1ARVA 1YYGA 1CCGA 1H3JA 3FM6A 4A71A 3X1LF 2JMXA 1DCCA 5JQRA 4C50A 1SCHA 5H9EB 3VLKA 1ZBZA 3WXOA 3EXBA 5CIDA 4CZRA 3VLHA 2EUOA 2EURA 1H5KA 1CCJA
chains in the Genus database with same CATH topology
1CYFA 4NVDA 3WA8A 1AEKA 1AEEA 2VCSA 5KQ3A 2PCBA 1BEQA 2V2EA 4NVGB 5AMMA 1ARPA 1SDQA 4NVIB 4BM2A 5JHXA 4H79A 5KQ0A 5KSFA 5SXWA 1JCIA 1CCLA 4JM5A 3WNUA 1C8IA 2RBVX 4A5GA 1HSRA 2EUNA 1QPAA 1CCIA 3M28A 1H5HA 4XV4A 4FCSA 5JHYA 5EJTA 1BJ9A 1QO4A 4XV6A 1CPEA 1H55A 4QYZB 3ZCGA 4NVJB 1U75A 2X08A 4NVOB 2CCDA 2VNXX 1H5IA 2RBYX 1H5EA 2V23A 1AEHA 2RBZX 4PAEA 1DSOA 4JQMA 2N18A 2RBTX 4NVFA 4G05A 1BEKA 1U74A 4JMBA 3VLJA 2AS2A 1CCPA 2BCNA 1S73A 3M26A 5CIHA 2XIFA 5SYLA 1CPDA 2GHKX 3FJWA 5ALAA 5SX7A 1U2LA 1ARUA 2B11A 2RC1X 5KQ2A 4XV5A 5SYJA 4FCNA 1H5MA 2EUQA 2GHDX 3M2GA 3ATJA 4A6ZA 1CMTA 1ZBYA 4JMTA 1CPFA 2B0ZA 5SX3A 3Q3UA 4JB4A 4NVBA 3M23A 1MN1A 3UT2A 1S6VA 2ZCAA 5JHZA 4A7MA 4NVNB 1MKQA 1KZMA 2VCNA 5CIBA 1DSEA 1DJ1A 2RC2X 2B10A 5L05A 2CCPA 1CK6A 3FKGA 3CCXA 1Z53A 2CEPA 1H5JA 4FEFA 1LLPA 2B12A 2XILA 4XV7A 4CCXA 1PA2A 1BVAA 2AS1A 5CIEA 1GW2A 1YZPA 5KQKA 4BM0A 5SYYA 1LY8A 4JM9A 1RYCA 1H5CA 5SYKA 4BM1A 4CZNA 5SXXA 3ZCYA 2IA8A 1CCBA 4CZQA 1AEBA 1U2KA 5ABQA 2VNZX 5CIGA 2Y6BA 3E2NA 1MKRA 1CMUA 2X07A 1H5GA 4CZPA 4JMWA 3UW8A 1BEPA 1MN2A 5FNBA 3VLMA 4JQJA 1AA4A 1BEMA 1A2GA 2AS4A 2GGNX 1GX2A 5SYHA 7ATJA 1AEGA 1AEFA 1ARXA 1LY9A 2E3AA 5JPRA 1DJ5A 4NVHB 4XVAA 1EBEA 1CMQA 5SYUA 2XJ5A 1UB2A 3M25A 2VCFX 2GHCX 3R98A 2PCCA 1YZRA 3M27A 4BLXA 2AS6A 4JPLA 1BGPA 1LYCA 4JMAA 2Y6AA 2EUTA 1DSGA 1CPGA 2XIHA 2AS3A 4CUOA 5SW5A 1MNPA 5L02A 4USCA 4XV8A 3RRWA 4JQKA 2WD4A 2ANZA 3M2FA 1CCKA 1AEOA 1KOKA 3M2AA 1H5FA 3VLIA 4FDQA 5CCPA 2YCGA 2ATJA 1ITKA 5H9FB 5SX6A 3FMUA 2W23A 3HDLA 3RIWA 5SX0A 5FNEA 1ARWA 1W4WA 1OAFA 5D6MA 4BLLA 1B80A 1AEQA 1H58A 5AL9A 1U2JA 4GEDA 4BLNA 1KRJA 2YLJA 4C51A 1JDRA 1CCAA 3M2IA 3E2OA 5SYVA 1GWOA 1GWTA 1BESA 4CVIA 1YYDA 1OAGA 3M2EA 4ATJA 4JN0A 1KXNA 2GB8A 3M8MA 5SX0B 1GWUA 1A2FA 2Y5AA 5SYXA 4CVJA 3FM1A 2EUSA 1AESA 1KXMA 2JTIA 5CIFA 1AEMA 3FM4A 1V0HX 2RBXX 2XJ6A 5CJHA 5ABNA 2AQDA 1APXA 1AEDA 1AEJA 2CYPA 5SX1A 4JM8A 1MK8A 4JPTA 5SXRA 3RIVA 2CL4X 4JMSA 2ICVA 4JPUA 1CCEA 1AC4A 5CD4J 4BLYA 5ABOA 3R99A 2GHEX 4JMZA 2RBWX 1H57A 1AEUA 2EUUA 5SXQA 1SBMA 1AC8A 2VO2X 1CMPA 3M2BA 1H5LA 5SYIA 5KQ6A 5AOGA 6CCPA 4BM4A 5L86A 4NVMB 1AEVA 3M5QA 4JMVA 1H5DA 2XI6A 3VLLA 2GHHX 3ZCHA 1IYNA 1ARYA 4OQ7A 4BLZA 1B82A 1HCHA 4U7UB 1SJ2A 2EUPA 4JZAA 1ATJA 4A78A 7CCPA 3M29A 5SXTA 3M2CA 6ATJA 1W4YA 4NVAA 5KQIA 5CICA 2E39A 4NVKB 5SW6A 3M2DA 1DSPA 4NFGA 5EJXA 4CZOA 2RBUX 5KSKA 1DS4A 1LYKA 4P4QA 1AETA 1GZAA 4NVEA 5SXSA 1FHFA 1AENA 1STQA 4NVLA 2VKAA 4JQNA 4NVCA 4H7AA 1BEJA 5SW4A 1LGAA 1CCCA 2XJ8A 1B85A 5SX2A 3CCPA 4CCPA 2RC0X 3X16A 5KQHA 1ML2A 4JM6A 5SYWA 1GZBA 2E3BA 4BLKA 1SOGA 4BM3A 2BOQA 2CCAA 1QGJA 3M2HA 1H5AA 1ARVA 1YYGA 1CCGA 1H3JA 3FM6A 4A71A 1DCCA 5JQRA 4C50A 1SCHA 5H9EB 3VLKA 1ZBZA 3WXOA 3EXBA 5CIDA 4CZRA 3VLHA 2EUOA 2EURA 1H5KA 1CCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CYF A;  4NVD A;  1AEK A;  1AEE A;  2VCS A;  5KQ3 A;  2PCB A;  1BEQ A;  2V2E A;  4NVG B;  5AMM A;  1ARP A;  1SDQ A;  4NVI B;  4BM2 A;  5JHX A;  5KQ0 A;  5KSF A;  5SXW A;  1JCI A;  1CCL A;  4JM5 A;  3WNU A;  1C8I A;  2RBV X;  4A5G A;  1HSR A;  2EUN A;  1QPA A;  1CCI A;  3M28 A;  1H5H A;  4XV4 A;  4FCS A;  5JHY A;  5EJT A;  1BJ9 A;  1QO4 A;  4XV6 A;  1CPE A;  1H55 A;  3ZCG A;  4NVJ B;  1U75 A;  2X08 A;  4NVO B;  2CCD A;  2VNX X;  1H5I A;  2RBY X;  1H5E A;  2V23 A;  1AEH A;  2RBZ X;  4PAE A;  1DSO A;  4JQM A;  2N18 A;  2RBT X;  4NVF A;  4G05 A;  1BEK A;  1U74 A;  4JMB A;  3VLJ A;  2AS2 A;  1CCP A;  2BCN A;  1S73 A;  3M26 A;  5CIH A;  2XIF A;  5SYL A;  1CPD A;  2GHK X;  3FJW A;  5ALA A;  5SX7 A;  1U2L A;  1ARU A;  2B11 A;  2RC1 X;  5KQ2 A;  4XV5 A;  5SYJ A;  4FCN A;  1H5M A;  2EUQ A;  2GHD X;  3M2G A;  3ATJ A;  4A6Z A;  1CMT A;  1ZBY A;  4JMT A;  1CPF A;  2B0Z A;  5SX3 A;  3Q3U A;  4JB4 A;  4NVB A;  3M23 A;  1MN1 A;  3UT2 A;  1S6V A;  5JHZ A;  4A7M A;  4NVN B;  1MKQ A;  1KZM A;  2VCN A;  5CIB A;  1DSE A;  1DJ1 A;  2RC2 X;  2B10 A;  5L05 A;  2CCP A;  1CK6 A;  3FKG A;  3CCX A;  1Z53 A;  2CEP A;  1H5J A;  4FEF A;  1LLP A;  2B12 A;  2XIL A;  4XV7 A;  4CCX A;  1PA2 A;  1BVA A;  2AS1 A;  5CIE A;  1GW2 A;  1YZP A;  5KQK A;  4BM0 A;  5SYY A;  1LY8 A;  4JM9 A;  1RYC A;  1H5C A;  5SYK A;  4BM1 A;  4CZN A;  5SXX A;  3ZCY A;  2IA8 A;  1CCB A;  4CZQ A;  1AEB A;  1U2K A;  5ABQ A;  2VNZ X;  5CIG A;  2Y6B A;  3E2N A;  1MKR A;  1CMU A;  2X07 A;  1H5G A;  4CZP A;  4JMW A;  3UW8 A;  1BEP A;  1MN2 A;  5FNB A;  3VLM A;  4JQJ A;  1AA4 A;  1BEM A;  1A2G A;  2AS4 A;  2GGN X;  1GX2 A;  5SYH A;  7ATJ A;  1AEG A;  1AEF A;  1ARX A;  1LY9 A;  2E3A A;  5JPR A;  1DJ5 A;  4NVH B;  4XVA A;  1EBE A;  1CMQ A;  5SYU A;  2XJ5 A;  1UB2 A;  3M25 A;  2VCF X;  2GHC X;  3R98 A;  2PCC A;  1YZR A;  3M27 A;  4BLX A;  2AS6 A;  4JPL A;  1BGP A;  1LYC A;  4JMA A;  2Y6A A;  2EUT A;  1DSG A;  1CPG A;  2XIH A;  2AS3 A;  4CUO A;  5SW5 A;  1MNP A;  5L02 A;  4USC A;  4XV8 A;  3RRW A;  4JQK A;  2WD4 A;  2ANZ A;  3M2F A;  1CCK A;  1AEO A;  1KOK A;  3M2A A;  1H5F A;  3VLI A;  4FDQ A;  5CCP A;  2YCG A;  2ATJ A;  1ITK A;  5SX6 A;  3FMU A;  2W23 A;  3HDL A;  3RIW A;  5SX0 A;  5FNE A;  1ARW A;  1W4W A;  1OAF A;  5D6M A;  4BLL A;  1B80 A;  1AEQ A;  1H58 A;  5AL9 A;  1U2J A;  4GED A;  4BLN A;  1KRJ A;  2YLJ A;  4C51 A;  1JDR A;  1CCA A;  3M2I A;  3E2O A;  5SYV A;  1GWO A;  1GWT A;  1BES A;  4CVI A;  1YYD A;  1OAG A;  3M2E A;  4ATJ A;  4JN0 A;  1KXN A;  2GB8 A;  3M8M A;  5SX0 B;  1GWU A;  1A2F A;  2Y5A A;  5SYX A;  4CVJ A;  3FM1 A;  2EUS A;  1AES A;  1KXM A;  2JTI A;  5CIF A;  1AEM A;  3FM4 A;  1V0H X;  2RBX X;  2XJ6 A;  5CJH A;  5ABN A;  2AQD A;  1APX A;  1AED A;  1AEJ A;  2CYP A;  5SX1 A;  4JM8 A;  1MK8 A;  4JPT A;  5SXR A;  3RIV A;  2CL4 X;  4JMS A;  2ICV A;  4JPU A;  1CCE A;  1AC4 A;  4BLY A;  5ABO A;  3R99 A;  2GHE X;  4JMZ A;  2RBW X;  1H57 A;  1AEU A;  2EUU A;  5SXQ A;  1SBM A;  1AC8 A;  2VO2 X;  1CMP A;  3M2B A;  1H5L A;  5SYI A;  5KQ6 A;  5AOG A;  6CCP A;  4BM4 A;  5L86 A;  4NVM B;  1AEV A;  3M5Q A;  4JMV A;  1H5D A;  2XI6 A;  3VLL A;  2GHH X;  3ZCH A;  1IYN A;  1ARY A;  4OQ7 A;  4BLZ A;  1B82 A;  1HCH A;  1SJ2 A;  2EUP A;  1ATJ A;  4A78 A;  7CCP A;  3M29 A;  5SXT A;  3M2C A;  6ATJ A;  1W4Y A;  4NVA A;  5KQI A;  5CIC A;  2E39 A;  4NVK B;  5SW6 A;  3M2D A;  1DSP A;  4NFG A;  5EJX A;  4CZO A;  2RBU X;  5KSK A;  1DS4 A;  1LYK A;  4P4Q A;  1AET A;  1GZA A;  4NVE A;  5SXS A;  1FHF A;  1AEN A;  1STQ A;  4NVL A;  2VKA A;  4JQN A;  4NVC A;  1BEJ A;  5SW4 A;  1LGA A;  1CCC A;  2XJ8 A;  1B85 A;  5SX2 A;  3CCP A;  4CCP A;  2RC0 X;  3X16 A;  5KQH A;  1ML2 A;  4JM6 A;  5SYW A;  1GZB A;  2E3B A;  4BLK A;  1SOG A;  4BM3 A;  2BOQ A;  2CCA A;  1QGJ A;  3M2H A;  1H5A A;  1ARV A;  1YYG A;  1CCG A;  1H3J A;  3FM6 A;  4A71 A;  1DCC A;  5JQR A;  4C50 A;  1SCH A;  3VLK A;  1ZBZ A;  3WXO A;  3EXB A;  5CID A;  4CZR A;  3VLH A;  2EUO A;  2EUR A;  1H5K A;  1CCJ A; 
#chains in the Genus database with same CATH topology
 1CYF A;  4NVD A;  3WA8 A;  1AEK A;  1AEE A;  2VCS A;  5KQ3 A;  2PCB A;  1BEQ A;  4GKF A;  2V2E A;  4NVG B;  5AMM A;  1ARP A;  1SDQ A;  4NVI B;  4BM2 A;  5JHX A;  4H79 A;  5KQ0 A;  5KSF A;  5SXW A;  1JCI A;  1CCL A;  4JM5 A;  3WNU A;  1C8I A;  2RBV X;  4A5G A;  1HSR A;  2EUN A;  1QPA A;  1CCI A;  3M28 A;  1H5H A;  4XV4 A;  4FCS A;  5JHY A;  5EJT A;  1BJ9 A;  1QO4 A;  4XV6 A;  1CPE A;  1H55 A;  4QYZ B;  3ZCG A;  4NVJ B;  1U75 A;  2X08 A;  4NVO B;  2ZOP A;  2CCD A;  2VNX X;  1H5I A;  2RBY X;  1H5E A;  2V23 A;  1AEH A;  2RBZ X;  4PAE A;  1DSO A;  4JQM A;  2N18 A;  2RBT X;  4NVF A;  4G05 A;  1BEK A;  1U74 A;  4JMB A;  3VLJ A;  2AS2 A;  1CCP A;  2BCN A;  1S73 A;  3M26 A;  5CIH A;  2XIF A;  5SYL A;  1CPD A;  2GHK X;  3FJW A;  5ALA A;  5SX7 A;  1U2L A;  1ARU A;  2B11 A;  2RC1 X;  5KQ2 A;  4XV5 A;  5SYJ A;  4FCN A;  1H5M A;  2EUQ A;  2GHD X;  3M2G A;  3ATJ A;  4A6Z A;  1CMT A;  1ZBY A;  4JMT A;  1CPF A;  2B0Z A;  5SX3 A;  3Q3U A;  4JB4 A;  4NVB A;  3M23 A;  1MN1 A;  3UT2 A;  1S6V A;  2ZCA A;  5JHZ A;  4A7M A;  4NVN B;  1MKQ A;  2BO5 A;  1KZM A;  2VCN A;  5CIB A;  1DSE A;  1DJ1 A;  2RC2 X;  2B10 A;  5L05 A;  2CCP A;  1CK6 A;  3FKG A;  3CCX A;  1Z53 A;  2CEP A;  1H5J A;  4FEF A;  1LLP A;  2B12 A;  2XIL A;  4XV7 A;  4CCX A;  1PA2 A;  1BVA A;  2AS1 A;  5CIE A;  1GW2 A;  1YZP A;  5KQK A;  4BM0 A;  5SYY A;  1LY8 A;  4JM9 A;  1RYC A;  1H5C A;  5SYK A;  4BM1 A;  4CZN A;  5SXX A;  3ZCY A;  2IA8 A;  1CCB A;  4CZQ A;  1AEB A;  1U2K A;  5ABQ A;  2VNZ X;  5CIG A;  2Y6B A;  3E2N A;  1MKR A;  1CMU A;  2X07 A;  1H5G A;  4CZP A;  4JMW A;  3UW8 A;  1BEP A;  1MN2 A;  5FNB A;  3VLM A;  4JQJ A;  1AA4 A;  1BEM A;  1A2G A;  2AS4 A;  2GGN X;  1GX2 A;  5SYH A;  7ATJ A;  1AEG A;  1AEF A;  1ARX A;  1LY9 A;  2E3A A;  5JPR A;  1DJ5 A;  4NVH B;  4XVA A;  1EBE A;  1CMQ A;  5SYU A;  2XJ5 A;  1UB2 A;  3M25 A;  2VCF X;  2GHC X;  3R98 A;  2PCC A;  1YZR A;  3M27 A;  4BLX A;  2AS6 A;  4JPL A;  1BGP A;  1LYC A;  4JMA A;  2Y6A A;  2EUT A;  1DSG A;  1CPG A;  2XIH A;  2AS3 A;  4CUO A;  5SW5 A;  1MNP A;  5L02 A;  4USC A;  4XV8 A;  3RRW A;  4JQK A;  2WD4 A;  2ANZ A;  3M2F A;  1CCK A;  1AEO A;  1KOK A;  3M2A A;  1H5F A;  3VLI A;  4FDQ A;  5CCP A;  2YCG A;  2ATJ A;  1ITK A;  5H9F B;  5SX6 A;  3FMU A;  2W23 A;  3HDL A;  3RIW A;  5SX0 A;  5FNE A;  1ARW A;  1W4W A;  1OAF A;  5D6M A;  4BLL A;  1B80 A;  1AEQ A;  1H58 A;  5AL9 A;  1U2J A;  4GED A;  4BLN A;  1KRJ A;  2YLJ A;  4C51 A;  1ABV A;  1JDR A;  1CCA A;  3M2I A;  3E2O A;  5SYV A;  1GWO A;  1GWT A;  1BES A;  4CVI A;  1YYD A;  1OAG A;  3M2E A;  4ATJ A;  4JN0 A;  2A7U B;  1KXN A;  2GB8 A;  3M8M A;  5SX0 B;  1GWU A;  1A2F A;  2Y5A A;  5SYX A;  4CVJ A;  2WSS S;  3FM1 A;  2EUS A;  1AES A;  1KXM A;  2JTI A;  5CIF A;  1AEM A;  3FM4 A;  1V0H X;  2RBX X;  2XJ6 A;  5CJH A;  5ABN A;  2AQD A;  1APX A;  1AED A;  1AEJ A;  2CYP A;  5SX1 A;  4JM8 A;  1MK8 A;  4JPT A;  5SXR A;  3RIV A;  2CL4 X;  4JMS A;  2ICV A;  4JPU A;  1CCE A;  1AC4 A;  5CD4 J;  4BLY A;  5ABO A;  3R99 A;  2GHE X;  4JMZ A;  2RBW X;  1H57 A;  1AEU A;  2EUU A;  5SXQ A;  1SBM A;  1AC8 A;  2VO2 X;  1CMP A;  3M2B A;  1H5L A;  5SYI A;  5KQ6 A;  5AOG A;  6CCP A;  4BM4 A;  5L86 A;  4NVM B;  1AEV A;  3M5Q A;  4JMV A;  1H5D A;  2XI6 A;  3VLL A;  2GHH X;  3ZCH A;  1IYN A;  1ARY A;  4OQ7 A;  4BLZ A;  1B82 A;  1HCH A;  4U7U B;  1SJ2 A;  2EUP A;  4JZA A;  1ATJ A;  4A78 A;  7CCP A;  3M29 A;  2OEB A;  5SXT A;  3M2C A;  6ATJ A;  1W4Y A;  4NVA A;  5KQI A;  5CIC A;  2E39 A;  4NVK B;  5SW6 A;  3M2D A;  1DSP A;  4NFG A;  5EJX A;  4CZO A;  2RBU X;  5KSK A;  1DS4 A;  1LYK A;  4P4Q A;  1AET A;  1GZA A;  4NVE A;  5SXS A;  1FHF A;  1AEN A;  1STQ A;  4NVL A;  2VKA A;  4JQN A;  4NVC A;  4H7A A;  1BEJ A;  5SW4 A;  1LGA A;  1CCC A;  2XJ8 A;  1B85 A;  5SX2 A;  3CCP A;  4CCP A;  2RC0 X;  3X16 A;  5KQH A;  1ML2 A;  4JM6 A;  5SYW A;  1GZB A;  2E3B A;  4BLK A;  1SOG A;  4BM3 A;  2BOQ A;  2CCA A;  1QGJ A;  3M2H A;  1H5A A;  1ARV A;  1YYG A;  1CCG A;  1H3J A;  3FM6 A;  4A71 A;  3X1L F;  2JMX A;  1DCC A;  5JQR A;  4C50 A;  1SCH A;  5H9E B;  3VLK A;  1ZBZ A;  3WXO A;  3EXB A;  5CID A;  4CZR A;  3VLH A;  2EUO A;  2EUR A;  1H5K A;  1CCJ A; 
#chains in the Genus database with same CATH homology
 1CYF A;  4NVD A;  3WA8 A;  1AEK A;  1AEE A;  2VCS A;  5KQ3 A;  2PCB A;  1BEQ A;  2V2E A;  4NVG B;  5AMM A;  1ARP A;  1SDQ A;  4NVI B;  4BM2 A;  5JHX A;  4H79 A;  5KQ0 A;  5KSF A;  5SXW A;  1JCI A;  1CCL A;  4JM5 A;  3WNU A;  1C8I A;  2RBV X;  4A5G A;  1HSR A;  2EUN A;  1QPA A;  1CCI A;  3M28 A;  1H5H A;  4XV4 A;  4FCS A;  5JHY A;  5EJT A;  1BJ9 A;  1QO4 A;  4XV6 A;  1CPE A;  1H55 A;  4QYZ B;  3ZCG A;  4NVJ B;  1U75 A;  2X08 A;  4NVO B;  2CCD A;  2VNX X;  1H5I A;  2RBY X;  1H5E A;  2V23 A;  1AEH A;  2RBZ X;  4PAE A;  1DSO A;  4JQM A;  2N18 A;  2RBT X;  4NVF A;  4G05 A;  1BEK A;  1U74 A;  4JMB A;  3VLJ A;  2AS2 A;  1CCP A;  2BCN A;  1S73 A;  3M26 A;  5CIH A;  2XIF A;  5SYL A;  1CPD A;  2GHK X;  3FJW A;  5ALA A;  5SX7 A;  1U2L A;  1ARU A;  2B11 A;  2RC1 X;  5KQ2 A;  4XV5 A;  5SYJ A;  4FCN A;  1H5M A;  2EUQ A;  2GHD X;  3M2G A;  3ATJ A;  4A6Z A;  1CMT A;  1ZBY A;  4JMT A;  1CPF A;  2B0Z A;  5SX3 A;  3Q3U A;  4JB4 A;  4NVB A;  3M23 A;  1MN1 A;  3UT2 A;  1S6V A;  2ZCA A;  5JHZ A;  4A7M A;  4NVN B;  1MKQ A;  1KZM A;  2VCN A;  5CIB A;  1DSE A;  1DJ1 A;  2RC2 X;  2B10 A;  5L05 A;  2CCP A;  1CK6 A;  3FKG A;  3CCX A;  1Z53 A;  2CEP A;  1H5J A;  4FEF A;  1LLP A;  2B12 A;  2XIL A;  4XV7 A;  4CCX A;  1PA2 A;  1BVA A;  2AS1 A;  5CIE A;  1GW2 A;  1YZP A;  5KQK A;  4BM0 A;  5SYY A;  1LY8 A;  4JM9 A;  1RYC A;  1H5C A;  5SYK A;  4BM1 A;  4CZN A;  5SXX A;  3ZCY A;  2IA8 A;  1CCB A;  4CZQ A;  1AEB A;  1U2K A;  5ABQ A;  2VNZ X;  5CIG A;  2Y6B A;  3E2N A;  1MKR A;  1CMU A;  2X07 A;  1H5G A;  4CZP A;  4JMW A;  3UW8 A;  1BEP A;  1MN2 A;  5FNB A;  3VLM A;  4JQJ A;  1AA4 A;  1BEM A;  1A2G A;  2AS4 A;  2GGN X;  1GX2 A;  5SYH A;  7ATJ A;  1AEG A;  1AEF A;  1ARX A;  1LY9 A;  2E3A A;  5JPR A;  1DJ5 A;  4NVH B;  4XVA A;  1EBE A;  1CMQ A;  5SYU A;  2XJ5 A;  1UB2 A;  3M25 A;  2VCF X;  2GHC X;  3R98 A;  2PCC A;  1YZR A;  3M27 A;  4BLX A;  2AS6 A;  4JPL A;  1BGP A;  1LYC A;  4JMA A;  2Y6A A;  2EUT A;  1DSG A;  1CPG A;  2XIH A;  2AS3 A;  4CUO A;  5SW5 A;  1MNP A;  5L02 A;  4USC A;  4XV8 A;  3RRW A;  4JQK A;  2WD4 A;  2ANZ A;  3M2F A;  1CCK A;  1AEO A;  1KOK A;  3M2A A;  1H5F A;  3VLI A;  4FDQ A;  5CCP A;  2YCG A;  2ATJ A;  1ITK A;  5H9F B;  5SX6 A;  3FMU A;  2W23 A;  3HDL A;  3RIW A;  5SX0 A;  5FNE A;  1ARW A;  1W4W A;  1OAF A;  5D6M A;  4BLL A;  1B80 A;  1AEQ A;  1H58 A;  5AL9 A;  1U2J A;  4GED A;  4BLN A;  1KRJ A;  2YLJ A;  4C51 A;  1JDR A;  1CCA A;  3M2I A;  3E2O A;  5SYV A;  1GWO A;  1GWT A;  1BES A;  4CVI A;  1YYD A;  1OAG A;  3M2E A;  4ATJ A;  4JN0 A;  1KXN A;  2GB8 A;  3M8M A;  5SX0 B;  1GWU A;  1A2F A;  2Y5A A;  5SYX A;  4CVJ A;  3FM1 A;  2EUS A;  1AES A;  1KXM A;  2JTI A;  5CIF A;  1AEM A;  3FM4 A;  1V0H X;  2RBX X;  2XJ6 A;  5CJH A;  5ABN A;  2AQD A;  1APX A;  1AED A;  1AEJ A;  2CYP A;  5SX1 A;  4JM8 A;  1MK8 A;  4JPT A;  5SXR A;  3RIV A;  2CL4 X;  4JMS A;  2ICV A;  4JPU A;  1CCE A;  1AC4 A;  5CD4 J;  4BLY A;  5ABO A;  3R99 A;  2GHE X;  4JMZ A;  2RBW X;  1H57 A;  1AEU A;  2EUU A;  5SXQ A;  1SBM A;  1AC8 A;  2VO2 X;  1CMP A;  3M2B A;  1H5L A;  5SYI A;  5KQ6 A;  5AOG A;  6CCP A;  4BM4 A;  5L86 A;  4NVM B;  1AEV A;  3M5Q A;  4JMV A;  1H5D A;  2XI6 A;  3VLL A;  2GHH X;  3ZCH A;  1IYN A;  1ARY A;  4OQ7 A;  4BLZ A;  1B82 A;  1HCH A;  4U7U B;  1SJ2 A;  2EUP A;  4JZA A;  1ATJ A;  4A78 A;  7CCP A;  3M29 A;  5SXT A;  3M2C A;  6ATJ A;  1W4Y A;  4NVA A;  5KQI A;  5CIC A;  2E39 A;  4NVK B;  5SW6 A;  3M2D A;  1DSP A;  4NFG A;  5EJX A;  4CZO A;  2RBU X;  5KSK A;  1DS4 A;  1LYK A;  4P4Q A;  1AET A;  1GZA A;  4NVE A;  5SXS A;  1FHF A;  1AEN A;  1STQ A;  4NVL A;  2VKA A;  4JQN A;  4NVC A;  4H7A A;  1BEJ A;  5SW4 A;  1LGA A;  1CCC A;  2XJ8 A;  1B85 A;  5SX2 A;  3CCP A;  4CCP A;  2RC0 X;  3X16 A;  5KQH A;  1ML2 A;  4JM6 A;  5SYW A;  1GZB A;  2E3B A;  4BLK A;  1SOG A;  4BM3 A;  2BOQ A;  2CCA A;  1QGJ A;  3M2H A;  1H5A A;  1ARV A;  1YYG A;  1CCG A;  1H3J A;  3FM6 A;  4A71 A;  1DCC A;  5JQR A;  4C50 A;  1SCH A;  5H9E B;  3VLK A;  1ZBZ A;  3WXO A;  3EXB A;  5CID A;  4CZR A;  3VLH A;  2EUO A;  2EUR A;  1H5K A;  1CCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...