4CVZA

Complex of a b21 chicken mhc class i molecule and a 10mer chicken peptide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
277
structure length
277
Chain Sequence
LHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSWRSGGGLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression levels of MHC class I molecules are inversely correlated with promiscuity of peptide binding.
pubmed doi rcsb
molecule keywords MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I GLYCOPROTEIN HAPLOT
molecule tags Immune system
source organism Gallus gallus
total genus 68
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cvzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4cvzA01
4R97B 1WZLA 4YEFA 2ZKHH 2BX5A 4M3KB 1E27A 3RWCB 1DBJH 1GC1C 2NPLX 3PWPA 3C5ZD 1U9KA 1GAFL 5KVFH 3EJZC 4TOYH 3RDTB 1PX4A 2QQNL 4PGJA 2QSTA 4MXQA 2FSEA 3MCG1 2BZDA 2KQNA 3NAAL 5MEPB 4POZC 3RQ3A 5ALCH 1G7HB 2VXUL 3G9AB 4YO0B 1LEKA 4O02H 5J12B 1FIGH 2GSGA 4CN1A 4NKMA 3V5DA 1E6JL 4M7ZB 4MXVE 1KCUH 1N5YL 3LQZA 5TDPB 1A3RH 3MLZL 4NRYA 2VDLL 2IPUG 1MUJA 1CDBA 4P2OA 3HZMB 5EOQH 1JNNL 4BUGA 4X7TA 5A2LH 2E7BA 4TSCL 4EI5D 1RHHA 1H0DA 1RU9L 3I6LD 3ILPA 3JSSA 3VXSB 4BQ8A 2XZAH 4ZFFB 3P0VH 1PG7L 4EUPH 4IRSA 5F1NA 4G43A 4PRBB 1I9IH 3UTSD 3FN0H 3VCLB 1QRND 3E2HB 3OAZK 4X5WB 1AHWC 2NY4D 2X09A 3QDGE 2XY1A 5K9KA 1NBZB 4NNYB 2PN5A 3CJJA 2HT2D 1QSZA 1IT9L 5L2JA 1F13A 4EBQL 5TDOA 4X6FB 1X5YA 2W9EL 3IXAA 4JPWL 2LAAA 1HNFA 4LMQE 4OCSL 1BJ8A 5DRXB 4TUKH 2VR5A 1MHEA 2IQ9H 4LSVL 4G6KH 3WO4B 1KIRB 5F7MC 2ICWJ 1AY1L 4AEIH 3LPWA 5IQ7H 3H42H 1XF5A 2JCCA 3UC0H 3IFNL 3CLFL 3PUCA 3WFCH 5SV3A 4IOIB 1VEMA 3BAEL 5DHYA 3MJ9H 1FAKT 4UNTA 1JYVA 4LCWD 3E3QE 5MERB 2F8VA 3S37X 5I66B 2DI7A 1LD9B 1ZANL 4S1RL 1N59A 3ARBD 1Z3GL 2NXZD 1REIA 3ARRA 2DKSA 3HPJB 4ONGH 4YWGH 5I8EA 4HG4J 3D3VB 4PPTA 4LVOB 4OGAC 1AI1H 5EFIB 5FA4A 3SDXE 2NXYD 1VFBA 1R0AL 4MA3B 3SDDB 4P46C 3DX8B 3U6RB 5IOPB 3Q6FA 3TZVD 1MHPH 3GRWL 2HT3C 5F6IB 1T5WB 4XBEH 3T2NH 5KS9A 4YFDB 5CS7A 3O4LB 5CD5C 4P5KB 3DBXA 1FYTD 4EVNA 3FN9A 2D03H 4LU5H 5FF6A 3J8F7 3TV3L 2E7HA 3HRZB 3N50A 4OIAA 4HG4K 1ITBB 3B2UD 3C5ZA 2AK4B 3U36A 3ARPA 4BH7B 5GS1A 4LFHD 5HDBE 2XA3A 4CNIA 2ZSWB 3ECBB 4IDLA 3H7BA 3MZTA 2V5RA 2G5BB 2AABL 4F7MB 2D2OA 1FAIH 3S3SA 4OGXH 2YPLB 7FABH 4XP4H 1R3LB 1UB6A 3VGBA 4RX4A 4F7PB 1FL6B 1LDPH 1DQJB 2XKSA 1YUHA 3DURA 3ARGB 4QNPF 3GSXB 4IMKC 4M4RA 1EEYB 2KZWA 3HA0A 3M8OH 3LQAH 3BKML 2R2CA 2IBZX 1TFHA 3PQYB 4WW1A 2PO6B 3AC0A 4F3FA 1HSBB 1P6AB 4K71B 3CFCH 3TO4A 5BV7H 4M03A 4LPVA 4CVUA 2F8XC 4XVSL 5AZEH 2O5ZH 1ZHLB 4FMKA 4WHTB 4R4BA 3T0EE 1U8JA 1KNOA 4JE4B 3QDMD 3QAZB 5ID0A 1MRDH 4ODHL 1IL1A 2BRRH 1BFVL 4RZCB 1G9MH 3EO0A 1I3VA 5F7LB 3RZCB 1ETZA 2R4SH 4M93B 3ULUD 3W0WE 1E28A 4PR5B 1U8QA 4KHXH 3AAZA 1JZ4A 2NY0C 3BSZL 1EVTC 4P57A 4WUKH 4PRHE 3A6CH 4ZOBA 2VDNH 3QI9C 4ONFL 2IFFH 3PV7A 5KSAC 5HJ3B 4P3CL 5GGRB 3GSUA 2VDQL 4JHZA 3NCBB 1XIWB 3PF2A 4M7JH 4WEMB 3SQOL 3MA9H 1QSEE 1F5WA 2EXWC 4P2RD 1D9KC 3HMWH 1MY7A 1EEZB 2OSLA 4ALAL 4G6FD 3MNVB 3W2DL 3QQ3A 1AGBA 3KPNA 1IGCL 4K8RL 4ZUTA 1V7NL 3EYOB 5FKPA 3ETBF 4NUJA 2VITB 4S1SL 4NYLA 1EGJL 4ODUA 2VDOH 3O6ML 5HGDA 3SY0B 1K2DB 5BXFA 4YHNA 4OLZL 3RIAF 3BPNB 4MAUH 3TZVA 4Q97A 4PY8J 3FO1B 1L7TL 5INCA 4PJ9C 2D4FA 4F7CA 4KTEH 4ISVB 3CH1B 3FRUB 1FYTA 4QHLA 4DKEH 1MLBA 3NABH 2PCPA 3E6FA 3W82A 3N1FC 4Q2ZB 2CMRH 5DR5L 3C08H 3VFTA 5DHVH 2OQJB 3OJDB 4G6JH 3VGFA 4F9LA 4LSUH 3OPZL 4J2XA 3NFPA 3DSFH 3P9MA 3QUYC 4P4RB 1EHAA 3K2MC 3KPPA 1L4IA 1V8HA 4WEBH 5E9DD 5DD5L 4PLNC 5DMKB 1UCBH 3KR3L 4XPTL 5JORA 1K4CA 1WCQA 3CFEB 3HRPA 3R4DA 4R8WL 3RWDA 3N1MC 1Q0XL 5BRZE 5KSUA 2DQFA 5CCKH 4ZFZA 3IU3A 5DF0A 1T03L 1K3IA 3UTTD 5K9JL 4QXGH 3UO1L 4E5XB 3VH8G 3TCLA 1O7VA 1YEHL 5CBEA 3BH8A 1J87A 4FQ2H 3PL6B 5D7LB 2FZ3B 1ZEAL 4L5FL 2Y06H 3MZGB 4K94L 4PB9H 5JW3H 2QADD 5A43C 2GT9A 4PTUB 5ENWB 3L1OL 3SGEI 4OD3H 2IANE 3RUGE 4O2FA 3AM8A 3OKMA 3UBXB 4G8EA 4QHNB 4XC1L 3MFFA 3VWKB 4R90H 3HZKB 4M5YL 1EMTL 1JZ5A 3TYFB 3W39A 5D1XD 1Y0LB 3IDXL 2JLLA 4NO3A 3O3DB 2OI9C 2NY1B 4XI5C 5GZNC 5GGTL 2X4PB 2XN9B 3RGVB 3U0PB 5CGTA 2IPTH 1JHLL 2CDEB 1IGIH 1JFQH 1K6QH 2YEZA 1BX2A 3OX8B 3S35L 1MQKL 3S4SA 2UWEB 4HWBA 1MCWW 4PJ8D 2ZCHL 3EOBB 4P2RA 3KPMA 3WNOA 1EO7A 4Z7QE 3OMZA 2I24N 4RAHA 3TFKD 1F90L 2X40A 5JW5A 3DNKA 4PG9B 5T1LB 2D7TL 1OM3H 4O2EA 4WIQA 1RUML 3O3UN 4XWOC 4NC0B 1NCUA 2ICEA 2I26N 1ZLVK 1KLUA 3T09A 1A7OL 4TSBL 2CKBB 2BJMH 1DQQA 1Z5LB 2HFFA 5I30H 2XQBH 3VG0L 2AGJH 1BQLL 3OXRA 4U05A 3K8LA 4GO6B 5FYKD 5TGBB 4YDJB 4ODTL 3EFFB 4X6CA 2VLJB 3TT3H 2WAHA 4GLRI 1YMMB 1MAKA 4HCRL 3C60D 2JB6A 3B6SA 5D72L 3QEGL 4BSVA 1E4XI 2X41A 4HFWB 1WEJL 3MX0A 3MODL 2C3VB 3BMWA 3I9GL 4MDIA 4NN6B 4FQ1H 2NNAB 4XBGA 1T22B 3M1BB 5EU7C 3U0WL 1NMBH 2DD8H 1AC6A 1OSPH 4QF1B 3GIZH 4FG6C 3X3GH 2XFXB 3AY4C 4UOW0 4OLUH 3JV4B 1UB5B 2JJTA 3L3JA 4TNVF 2Y23A 3T77B 2CLRA 2IADA 2P5WD 1H3PH 4XCNB 4OZFG 2XI9A 3C9NA 4NSKA 3VFWB 2VAAB 3HUJA 2LABA 3SO5A 3KG5A 2BNRD 4UIMA 4ZD3H 5D96C 2XWBB 4X6CF 5EN2A 2CDFA 5FGBC 1UACL 3UTTA 1JHTA 3RI5K 5ID1A 4LP4A 1PQZB 4HFUL 3VGAC 1KPVB 2VUOA 5FHBH 5IR1A 3RWIB 1CT8A 1U91B 4JZJC 2ED8A 3P4NB 4ONHB 1J8HD 3KNBA 2ADIB 4KGLA 4ZDHB 3MMEB 3TIDB 4X6EA 3WO3B 1Y18B 4HKXB 4PJDB 4U1SA 1I1YB 4Z76B 5E08H 1A7BA 5BQ7A 4LNRB 3FT2A 5D1XA 5E00B 1K8IB 2WLZA 2GYSA 4XNMA 4NO5A 3HC4H 3I6GA 4M7KH 4XP6L 3IRZA 3DETC 3P73A 3UP1A 5GGSY 2PW1B 4U0RC 5F9OH 1KTKE 4D9QE 3TPUB 3HUJF 4U6TA 2X10A 3RWFA 4AEFA 5CWSB 3D69A 1FJ1B 3G9VA 4PGEB 3DVIA 2ZCKL 5C08B 3TFKA 3HNVL 5GGUA 4H0GA 5GPRA 3SCMC 2BVUA 4WFGD 2LV4A 3GSRA 4N0CD 1A21A 4XNZC 4EXKA 3JTCA 3O3BA 5FYJU 4C54A 4C83B 3HAEH 5F21B 1R24A 3GSWB 5FYJL 1CZ8L 1YN6B 5FUCE 3UJIH 1I8MA 3STZA 3BEVB 3D85D 5INDB 1TZIB 1H3GA 3L5XL 5EOCL 3WJLC 1I1FA 3TP4A 5D7KD 5FO7A 2COQA 2J7LA 2AI0L 3CPLA 3TVMD 3ZO0A 5F96L 4G80B 3UMTA 4KKCC 4YGAB 4WDIA 3IFLH 3K1KC 4U1GC 5EC1A 3U4BL 4KY1H 1E0OB 4D0DA 4Y0GA 1LEIA 4JG1L 3WFZA 2WP3O 2VLKE 2VN4A 1AC0A 1TENA 4NQSB 4J8RB 2X9XA 1P4IH 1OCWH 2R2HB 43C9A 4YHYB 5MHSD 3FL7A 3VGDA 1LP9F 1MCRA 4CU8A 1H3TA 4YHIB 4I18A 1EEQA 4ZTOH 5DD1H 1GHFL 2XWTA 4NC1E 5ADOL 4PJ7A 4IOFD 3TJHD 2Q8BL 2NX5D 2SEBB 1KGCD 5I1EL 4WI8A 4BFIA 1HWHB 4M6ML 3T0BA 5CGYC 1YPZA 4OZGA 4WW2A 4JPIB 3UEZA 2WBKA 3MRQB 4KQ3L 3ZDZF 2A0LC 4PJ5E 2W91A 5CZXD 1T1XB 1LO3L 3ZE1F 2BSRA 2YPKA 3CXDH 4HKBA 2EDQA 1P2CB 4JFEB 1VGKB 4MHHI 1J8HA 4HJJH 4QHUA 4Y4HD 3FB7B 3ULUH 1I8IB 4RGNE 4EUPB 1G0YR 1B0RB 4MCZB 4JKMA 4KJWD 5GRXG 2YZ8A 4WWKC 5ALBH 4KKNA 3GMQA 1SMOA 4XMKH 5J6HA 3ULVD 5E2TL 1CXIA 2R15A 3ZYOA 2AEIT 3UYRL 1ZLSH 3NCYS 5E6IB 5IKCB 1M05A 2HKHL 2A6IB 4HWBH 1I85C 5IW1B 4MD5B 4MZ2A 4DN3L 4AZ8A 2IF7A 4MNGE 5DXWA 5JHDE 2PYEB 4XPAL 3BVNB 3K7UA 4RBPK 1UYWL 2NY6D 3EDKA 1JNHB 2BY3A 5E2UL 5FYJE 5C0DB 3PNWB 3D25B 1KSRA 3DSNA 3WN5B 3G08A 3O9WC 4XC3H 3ARDC 3QR2A 5D8JH 5GJSL 1F4WH 1G7LA 2VDKL 5EUOF 4M43L 6FABL 1UCTA 1L6XA 4Q9RH 2WBJD 2Y7QB 3S3PA 3WXWL 3T2PA 1LNUB 3OSKA 5E8DL 1Q9OB 4OCLC 2XZQL 3ZSTA 2NY7H 4W4OC 3G6JB 3D85A 3ARSA 3VXRB 3FQRB 4PRAB 4AG4L 1T80A 4QKXB 1AGEA 3DVGA 1YDPB 5JR1H 3MLYL 2AAVA 2WWKO 4JY5H 1CBVH 4OAWA 3WLWC 5E99L 8FABA 3TVMA 4X6DA 4J3VA 4NIKB 5BZWA 4QRPE 1A3QA 3S88L 3GBMH 3X13B 3EUUA 2DTSA 1WFUA 4DZBA 1ZE3C 4EEEA 3BKCL 3U30C 3BUYA 3MBEC 3NFSL 5LWYH 4ODVH 5D7IA 3WBDA 1XZ0A 1OPGH 1S9VA 1TITA 1U58B 2CDGB 1CDCA 4F15C 1R5IB 3MA7A 4BSWA 5IVXE 2WIMA 1UM4L 1C7SA 4KHTH 4FFVC 1NUDA 3HFML 1XGTA 3LKQA 5I8OL 5MENA 5MEQB 3LS5H 3GHEL 5FK9A 3WNKA 3RVTD 1I9JL 3SKNA 15C8L 4IMLA 5HYIA 1F3DH 1QR4A 1VB9A 1G7IA 2NX5A 3CSPA 1GRWA 1VFOA 1SMAA 4Z7WA 2AEQL 2BSSB 5DS8B 3QCUL 1T21B 2FJFA 4LDLB 1NQBA 4QXTA 4CVWA 4HC1L 1MFBH 4OZHE 4RFEA 2B1AH 1UM6H 4LCUA 5IB5B 2AEPL 1RUPH 4LGPB 1LGVA 5LVEA 2YK1H 2FYYA 1KCRH 2P49B 2OJEB 3MNWB 4Y16B 3SO3B 4Y4HA 2FEDD 3ZKSD 1PSKL 2GAZA 3CDYA 1JGUL 1HKLH 1LEGB 3MXVH 1QG3A 7CGTA 1MJ7H 3OKKB 2PNDA 3SDYL 1GSMA 3MV8A 2A6DA 5AYUH 1QOKA 4KROB 1P4LA 3BRDA 1AFVL 2ORBL 3O45A 4PYGA 1N3NA 3RY5A 1NCBH 4PB0L 2LVEA 4LLDB 3F12B 4BM7A 1T0MB 3IJSB 1L9NA 2DTMH 3L3IB 3KLSA 4GG6B 4CU7A 4BFBD 4JANB 2VO5A 3VXQB 5DQ9A 3IETA 2FBJL 3Q3GA 4PRPE 4Z7WF 3L3DA 3HNTL 4P2QB 5FYLH 1PEWA 5I17B 1WFOA 4PFEA 1GGIL 2P5EB 3QIUB 3T3PE 3HHRB 2R9HD 2C1OB 5JXEC 4H8WH 3FAXA 1A64A 5GGRY 1WVZA 3RRQA 3VU2A 5GRWA 3RL1B 1PYWB 4X9BA 3AXLA 1YJDH 2NTFA 1UKSA 3MLSL 3LKOA 1DQLH 3V4VL 4HZLA 2F9BT 1ZGLB 1RY7B 3VJ6A 4XWGH 1OLZA 4IIQC 1NDGB 3IJYB 4MA1B 1A6WH 4R4FH 4MVBC 1CFNB 2XV6B 3MV7B 3SDAC 3X14A 2H32A 4KKLC 3DROA 5H2BA 1U8LA 4NKDB 1YEJH 1C5CL 1QFPA 2FHBA 1FNSL 5DRNA 5FGRA 1ERNA 4LQFH 1BZ7B 5DD6A 3V0VB 3WXVL 5DJAB 1RJYA 2YOCA 4AK1A 1E27B 3V95A 1SEQH 3S9DB 4KKBD 3PWPB 1AJ7H 1BHGA 1H15A 2Z35B 3T4AA 3OGOE 4OLYL 2E7CA 4K9EH 5AUMB 3AVEA 3VFMA 2VWEE 1X4YA 1U8HB 3GMRB 4OZ4A 5DURD 2I9TB 3MRGA 4HDIB 1MEXH 4RRPG 5ERWA 3FO0H 4QCIA 3V5DB 1EJ6A 4CJ0A 2NZ9C 1RUKL 4WTXA 1BD2E 4NRYB 5DVLA 2J6EA 1MUJB 4P2OB 1B6DA 2VABB 4GG8A 4Y2DC 1ZS8B 2H2PD 2VE6A 4KI5E 1L9MA 3MCLH 3V7MA 1H0DB 4P4KD 3ILPB 5JW4N 1P69B 2F54D 5DVMA 3D87B 3ZDYF 5GRJH 4G43B 1F11A 3IDYC 1DUZA 3VMPA 4K94C 2FO1A 5GGVH 2C3WA 4NQEB 4L8BA 1CVRA 5K9KB 2ED7A 2A83A 3PGDA 1DP0A 2G60H 5TDOB 3VRIA 4R6UA 4LLQA 3X17A 3IXAB 4APQD 1D7FA 2F53E 2BHYA 1CFSA 4J1UA 1MHEB 3H9SE 4LF3A 3C2AL 5F7DA 1E4KA 3IVKA 4GQ9H 3KHQA 5KVEL 3IDGA 1XF5B 4XCFL 1Z9SA 2EEAA 4NN7B 4UIKL 3KDMA 3T8XB 3WFEH 1IGMH 1KJ3H 1MHCA 4LLWB 2IBBA 1N4XL 1IEBB 3MLWL 4FABH 1T4KA 5HI4C 4PJGE 1RJLA 3WFDH 1CLYH 1T83C 3BZDA 5A3IC 4YHML 1QACA 1J0KA 4UDTA 1VPOH 2HT4D 5L8JB 1NCAH 1TMCA 4PJHE 4DGIH 1MWAH 5I8EB 2JB5L 3FO2A 3O6FD 4JREB 5FA4B 5T1MA 3RZWA 4KMTH 3BYTA 2DLEA 5MI0B 3GJEB 3JWDH 5E5MA 4UILL 4M3JA 4XP9L 4YQXL 1BLNA 4LBEA 2E9BA 4LSQH 4LPUA 3V5KB 2UVFA 4P99A 3VWJC 5JQ6L 4WUUD 3UZQA 5I2IA 5TE6L 4HPYL 2CR6A 3C5ZB 1A6UH 3U36B 3QSKB 3ALWA 4K07A 4PJXA 4JFDD 1ED3B 1P1ZA 5GS1B 1CVSC 2R0KL 4CNIB 1DN0A 1UENA 1V3KA 3H7BB 4OI8A 4KK8C 5DUBB 4RMVA 2AJYL 1FP5A 1SYVA 3VFOA 2GJZA 5IMLB 1RK0B 1IGTA 1UB6B 4EN3D 2VL5B 4OV5B 1P9MA 3DURB 4I1NB 1PAMA 3NPSC 3QA3B 1RK1A 5IB2A 4HAFA 1JNLH 4MS8C 1A7PL 1GGCL 3MXWL 5K9OB 2DBLH 4XVTH 5F3HA 1FDLL 4EI5B 4P4KA 3VXOA 2AJSH 5C07A 4ZQKB 4AM0A 1UWGL 3MRHA 2P24B 2QHRH 4MLSA 2EH8L 5DGQA 4TTGA 3UTSB 1NGYA 4KK5C 1WFNA 1OVZA 1QRNB 1TVDA 3AB0C 3EYUL 2Z31A 3ULVH 2NY4B 2J4WH 2HRLA 3CCHA 4JFPA 3KWWA 1U8JB 5C0CD 1J7VR 1XF3A 2YD9A 3HE7C 5ID0B 3O0RH 1B6UA 2XA8L 4APQA 1J1PL 1NGQL 1ETZB 4S1QH 3Q5YA 1U8QB 1DR9A 3AAZB 3O3AA 5IK3B 4AIZB 4WHDA 3VMNA 4RMWA 1BAFL 1MSPA 4KZDH 1JPSH 3OKOA 4PJBA 2UZIL 1HZHL 2MTPA 1MCBA 2JIXA 3NZHH 1S9YA 4YIQA 5IFHL 2XG4A 2HH0L 1GGBL 1CDYA 2DQIH 3MOAH 5C6TL 3QQ3B 5DEGA 3A0OA 4LCWB 3KPNB 2IC2A 3P4MA 1HHIB 1YEKH 2AXGB 1MCWM 4ZUTB 3VE0B 2ZG2A 3QUXD 5E1HB 3ARBB 2NXZB 2H32H 4NYLB 3EOAA 4XNQA 1KACB 1X5JA 2H9GA 4GAYA 5BXFB 3O6FA 3DHMA 1NMCB 4KTDH 4RIRB 2NXYB 1HH9B 2LTQC 3U7AA 1I7RA 3TZVB 3KJ6L 4R0LC 4OFVA 3L5IA 2ZUQC 3V6FA 5INCB 4ZTPH 1M71A 4F7CB 5JQHC 1AR1C 3V7AE 2W60B 2ARJQ 5DJYA 5D2NE 4QHLB 4ZFOL 2HAZA 4KH2A 3BPCB 3VD5A 4N0YL 3X12B 2V2WA 2R0WL 4PJBF 4GKSA 4NKIH 1A47A 5BS0E 3X3FH 1JNJA 4JFDA 1OWRM 4ELMF 2IQAA 2D0GA 4OUUA 2Z0BA 3VXTB 2DJSA 2J6EH 4LRNL 4N8CH 4YXHL 4EN3A 2CIKA 4YBQC 3T08A 1CDGA 2A1WH 1NAKH 1ULVA 5JORB 1K4CB 2YKLL 4PJFF 3RWDB 4H1LG 3M07A 3C09C 5HVWA 3CSGA 4D0BA 4U1LA 5FA3A 5KSUB 4NM4L 2L7UA 5F7YC 4ZFZB 1UJ3C 2HTLC 2RJMA 1HYSC 1DL7H 3LPGA 5C2BH 3SGKA 2OBGA 2ERJC 4ETYA 3TCLB 2E3VA 1BFSA 3BH8B 3WV0A 1UM5H 1CIDA 1KELH 4CMHC 4WV1B 5DA4A 3CVHA 1D6EA 2GT9B 5C0CA 1WICA 3QDMB 1ZHNA 4YUEL 4N68A 4O2FB 3OKMB 4R97C 1QLEH 1MCHA 1IVLA 5JW4Q 4JB9H 4E9LA 3MFFB 1FGVH 2Q86B 2CRZA 3RHWK 4NOBA 1BBJB 4ESKA 1KN4H 2Q1EA 4M9OA 3KPQA 1TNMA 2B8OT 2DYPD 3MUHL 1AQKH 3RDTC 3LS4H 2ZKHL 3RY6C 3UJJH 1LE5B 2YEZB 1BX2B 4M5ZL 1MVUB 5E95B 3S4SB 4PRDA 1DBJL 4NQVB 2A9MH 5KAQG 3KGRA 3KPMB 4P2RB 5KVFL 5J12C 4HKJB 4TOYL 4G6FB 4RQQB 4MQ7A 4I4WA 4M7ZC 2NCMA 5JW5B 1Y6MR 3VH8B 4TUOA 3B9EA 4TYUA 5DTFB 3BN9C 3W5NA 5ALCL 4O2EB 4L8DA 4TTDD 5I74B 5CAYB 3UJTH 4O02L 1KLUB 1FIGL 1NFDF 3QH3B 5C86A 1DQQB 1KCUL 1EFQA 3W9DB 4YBLB 3OXRB 3O8XD 4CN4A 1OW0C 5EOQL 4LIQH 4D9LH 4UOJA 4X6CB 3E2HC 2NW2A 4Y7MA 1QFWH 4F33A 3ROOB 3EYVA 3C6SA 1XR8A 3KPSE 5C70A 2R0ZH 5EBGA 3B6SB 4GSDH 4BSVB 5CD3B 3P0VL 1P7KB 1MIEH 3TPUE 1I9IL 5KANI 4FOMA 2NR6C 1HXYA 1RZIA 2RHEA 3CGTA 3KYOA 3FQTB 2GK0B 2DKMA 5C7XL 3QEUA 4L9LA 2WY3A 5CSGA 1A9BA 3EFDH 1OTSD 3WO4C 2QSQA 5IHUH 1OL0A 1IM9D 1E4WL 2E9WA 1TETL 1BGXH 3U9UA 3REVA 3TO2A 1U8KB 3DECA 3L3JB 2H8PB 2I07B 3S6CA 4TUKL 2J8OA 5JHLH 5IVOA 2CLRB 5E56A 2IQ9L 5E9DB 2IADB 2Y9RT 3VXPA 4AEIL 4NSKB 3I6KA 1G6RB 5IBUG 3H42L 4C55A 5F8RC 3WS6A 3UC0L 3HUJB 2BVPA 1B0WA 4UIMB 4WI3A 1ZMYA 3WFCL 4ZNCD 1NCWH 3KJ4B 3SBWA 4QY8B 2CDFB 1OT1A 2ADFH 3QNYA 4LVOC 2A2QT 3MJ9L 3UTTB 2BHZA 4J3WA 4MA8H 4ZPTB 2PUQT 1MRFL 1EO5A 3HN3A 4LASH 1IC1A 2G2RB 4CVXB 3SDDC 1R3JB 3A6BH 5IR1B 1VKXB 3T0ED 1CT8B 4ONGL 5F6IC 1ES0A 1CD8A 3G6DH 4NJ9H 4XPBH 4YWGL 5KAQF 2QADB 1AI1L 3KNBB 4G42A 2VN7A 4WTZA 4MWFA 5L7XH 1TZHA 1Z6JT 1F4AA 4X6EB 3W0WD 2G5RA 2DLGA 3HB3D 4OCYL 4OGYL 1MHPL 2YA1A 3HZVA 4U1SB 5KG9A 1JWMB 4PRHD 5D7JD 5KTEH 5BQ7B 5D1XB 3FT2B 4MXVF 2DYPA 3CDCA 4BK5A 5ICYA 3DV6B 2J8UA 2D03L 2VR4A 4LU5L 2E27H 3P73B 1NGWA 4LARH 5DO2C 4A2MA 2AV1A 3BH9B 4PJ8B 4XMLH 5D5ME 5HGGS 4DOHE 1CGTA 3D69B 4X7CC 1CDHA 5LCVH 2B4CH 4HF5H 1HN1A 3ARGC 5GGUB 1AGFA 4NUGH 1FAIL 1KCSH 4AT6A 1T0NB 1KB5H 2AK1L 2B5IB 4OGXL 7FABL 4XP4L 5F7HA 3EGSA 1RUAH 1JZ6A 4JKWA 1T7YA 4ZAKD 3DYMA 2GY5A 1V3LA 1LDPL 1TJGH 2PO6C 5EG6C 5DEFA 3ARXA 5D2LE 1R24B 2PETA 5KN5A 2YWZA 4K71C 3CX5J 3O8XA 5CP7A 1FVEA 1LO5A 3M8OL 4K7PY 3LQAL 1I8MB 2E7LE 3STZB 4DKFL 3F7YA 4HPOH 1I1FB 4YDKL 3C60B 2E6QA 5EPMA 5FO7B 3VD3A 3PP3K 5SV4A 3CFCL 5EIIA 1BJMA 3CPLB 5D71H 3QAZC 5EC1B 2CK2A 2ICWA 4D0DB 3GB7A 3B9AA 4HUUB 3RZCC 4M93C 5DK2A 4Z78B 3QRFM 3CX5K 3STLB 43C9B 1HEZA 1KOAA 2QTEA 3ARFD 5EZLA 1DLFH 3L7FB 4W68A 5AAMA 5L0QB 3L6FA 5HYEA 2BRRL 1G9ML 4LLVA 5GJTH 1IE5A 2QBWA 1ADQA 2R4SL 5HGBB 1J0JA 1XIWC 4KHXL 1FLRH 2P5WB 4KKAC 4WUKL 2PW2A 3BISA 3EDFA 4F7TB 5FHAL 1GGYA 3SDXF 2IFFL 3ILQD 4I2XA 4I3RL 5HGHB 5KW9H 4PJ7B 1EXUB 5FUOH 1BFTA 3BGMA 3IDMA 5BRZD 1L7IH 2BNRB 4M7JL 1FVCA 1X4XA 3MA9L 4ZXBD 2MPAH 5C0EB 3EJYC 3HMWL 4AQ1B 2FGWH 3WHE0 1YPZB 4WW2B 3MLRL 4G7YL 4L4VE 4WI2A 4K3JH 3BPNC 3D0LB 5EUOB 4HKBB 5IWLA 3T0EA 3JV6A 3WIIH 2IAND 1J8HB 2R1YA 3PWNA 4QHUB 1M6OA 5HDBF 5D7SH 4ODSH 5DJZB 2GJ6A 3U2SA 3CSYA 3KXFE 3FQXA 1YEIH 4PRHA 5D7JA 4QXUH 3NCJL 4KTEL 3GSNB 2IAMD 3GSVB 1WIUA 1FBIH 2F5BH 4JVWA 4DKEL 5HYJE 4W70A 1GZPB 3LHPH 4UOW1 4J4PD 4R2GD 5ISZA 2CMRL 3VXME 1N6QH 3C08L 3D18A 3QG6B 3WUWG 4DGVH 4G6JL 3EDEA 2BSTA 2ZJSL 1Q0YH 1A9EA 1KIUA 5ESQA 3LY6A 4LSUL 3QWOA 1OAUH 4NQXA 1U6AH 4HHAB 3MV9A 3VI3F 3DSFL 4W81A 3MO1B 1UKQA 1OAZH 4HS3A 1XMWA 4NRXB 1A6ZA 4D94A 5C8JB 2VLRE 4QRSB 4ZAKA 2X70B 1QPPA 1UCBL 4FZ8H 3G5VA 4X4XA 5I8KH 5I1IH 3D85B 5H37G 4AH2A 3LIZH 3PL6C 5CCKL 2PXYB 1AGEB 1M7IA 4OAWB 3WNPA 1KJMB 3TVMB 8FABB 5IQ9A 1RVFH 4X6DB 4DZ8A 5BZWB 4DVBA 4OLXH 2NY2B 5F93C 3VWKC 1ZTXH 4DZBB 2Y06L 4PB9L 1I1AA 1AD9A 3BUYB 1IQDA 1TPXB 4XAKE 2ARJA 1ODAA 4OD3L 4M48H 2NY1C 2MNUA 4IRJA 1KTDA 1S9VB 2YD6A 1JV5A 4XT1C 4YPJA 3RGVC 3MA7B 3OKNA 4Z7UE 1BQHA 3BRFA 1TQCB 1M7XA 4CBPA 4R96A 4X5XA 2FH6A 1MREH 1KJ2A 4RFNB 2AJVH 2X4UA 3NACL 4I3SH 3LZFL 4Y5XA 3SKNB 2IPTL 4U1JB 1HILA 2FB4H 1OB1A 1IGIL 1JFQL 1K6QL 2NX5B 1FNHA 4NO2A 2EE6A 3Q2CA 4Z7WB 1X5GA 4ZXBA 4JRYE 1ZVHA 5HHNA 2BMKA 2HP4A 4H88H 3BD5A 1MFDL 4L8CA 4M9PA 4B7LA 1CF8H 1OM3L 2FYYB 3SJVA 4JDVA 4C56E 5AG8A 3V79C 3NIDE 3RKDC 2IANA 1AO7E 3RUGA 5CLWA 3VDAA 4Y4HB 2BJML 5L2KE 4P5TD 2G75A 4OLVL 2XQBL 4OCRH 5I30L 2AGJL 2N4IA 1QBLH 3DX6B 2IBGA 4RNRA 3TBWA 4WEUD 3BQUD 5CKGA 3RTQD 2GKIA 4QGYA 3HLAA 1VEOA 3PP4H 4NT6B 1BZ9B 1HSAA 3LEYH 3OAZH 2A6DB 2R56H 3TT3L 1OHQA 4PG2C 1D3CA 4NN6C 1WZ1H 1ZGLM 2IAMA 1P4LB 5GISH 1YECH 1MCOH 3H9HB 3O45B 4KDTC 4V3DB 1A4KA 4Z7VA 1N3NB 2C3HA 4J4PA 4KK6C 1I7UA 2NY6B 3CSBA 4PJEE 5DQ9B 4FQ1L 3TM6A 3Q3GB 3WFBH 4FQCL 3D5OF 1NMBL 2DD8L 2UVEA 5C9KA 1OSPL 3GIZL 4U31A 3IGAA 3X3GL 3BE1H 4OLUL 5EBMA 2X4QA 3QHZH 4M1CC 4X4ME 3QUKA 3TN0D 2WBJB 4NZUH 1H3PL 1X6LA 3V0WH 4EJ1C 1W0VA 3GGWB 4HZLB 3VJ6B 5GS0D 3MRCA 1YQ2A 5ANME 4I9WE 1EX0A 4ZD3L 4UNUA 5J6GA 5CBAA 1F00I 2H32B 3ARED 5IB4A 4GRMA 4EI6A 3DROB 4LSSH 2MMXA 1U8LB 2EYRA 5DRNB 3X11A 2JCCE 2P42B 5DD6B 2VLKD 1BBDH 2D0HA 4TULL 3KYNB 2OTPA 5HD8C 4PP8C 5D6DC 1ADQH 2J12B 5E8OB 4WCYH 3T4AB 1YEDA 3FQUA 3H9YA 2EIBA 3VFMB 1H3UA 2ZUYA 4OZ4B 1EZVX 3T1FA 4PJAA 1IM3A 3HC4L 1SYSB 4M7KL 4P23D 2AKRB 4JFOA 5F9OL 4OFPA 1FH5H 1S8DA 4LEXH 4YC2B 2DAVA 3QUMB 1JTOA 2MKWA 4JQXA 4GG8B 2MCG1 3EOYG 5KS9E 3KPRA 2VE6B 3T3ME 5H8DA 1RURH 3BZ4B 3RA7H 5DFVD 1G9NL 2DL2A 1EHLH 5HI3D 3IU4H 2EKJA 4JQVA 3VFUB 2CK0L 4A6YB 1VACA 4G5ZH 1XCQA 3HZYB 4P5TA 3QPXH 4KFZC 1D5XA 5EA0H 4L8BB 4NC2B 1ZGLP 4IM8A 5I1LA 4PJCE 4ODXA 4P5MA 3UJIL 2A83B 3PGDB 3O11B 5EZOH 1DFBH 5FOBA 4LLQB 4Z77B 2CH8A 1J10A 1T20A 1A6TA 3HR5A 1CFSB 4J1UB 4LF3B 1UZ6E 4MAYA 4YHYC 3IVKB 1FFOA 3GDBA 3O3EB 5FYJD 3IDGB 1WAAF 3OR7A 1A1MA 3OG6B 1FQ9C 1WIPA 2E8ZA 5DRWA 5K9QI 4LLMB 5C0IB 3L5HA 1YEFH 1N6VA 1OCWL 5HPOA 3A67H 2B7DT 2W0KA 4JJHA 1OGAD 1BWMA 4XTRC 2CO6B 3VFVA 1PZ5A 1WIOA 2ZOKA 4PREA 1KN2H 4UDTB 5ETUA 2QQLH 5EWIH 4ZTOL 5DD1L 1CS6A 5C0GA 5DMYA 3H7LA 3FO2B 5I8CB 3BDBA 2B0SH 3KPOA 2K7PA 3AREA 4F80A 1U95B 3LSOA 1HE7A 5E5MB 4I77H 3RVXD 4QRPD 1BLNB 4LBEB 3L3KA 4YE4H 5E94A 3CXDL 5MP6L 1OTTC 2FR4B 4PLOB 1BF2A 5I18H 1SY6A 2V2TA 1JTPA 4JGMA 3ULUL 4QHKI 5DT1H 2EKSA 4ETQB 4F9PA 4G7VH 1MFEH 5E6IC 4NBYB 4D9RD 1KJ2H 4PJXB 5ABDE 5ALBL 1P1ZB 3F7VB 3VFGH 1GZQA 1JGVH 1DN0B 5DURB 5EUKA 3OR6B 4M1GL 1ZLSL 5IROC 3W11C 3VFOB 4C4KO 4HWBL 1KPUA 4V2CB 1BEYH 1IGTB 4FZEH 1T7VA 2F19H 3V9FA 2FLRT 2LFGA 3WN5C 1XGYH 1OF2A 4MZ3A 2WWMD 1RK1B 4N90E 5IB2B 3O2DH 3EYFB 4R4NC 5DUPH 2OZ4A 4GQPH 3HCVA 4MX7A 5F3HB 3QNZA 1FYTE 4P4KB 3B8SA 4KVNH 4X4YB 4XC3L 4AM0B 1KJVB 5D8JL 2F54B 1F4WL 4YX2L 3T04D 4LLUA 3EO1A 4ZFGH 2M1KA 4KRMB 2VIRB 2Y1VA 3QO1A 3GBLA 4YH6A 3CCHB 3P0YL 4JFPB 1G7MA 5ITBH 4IRZH 3SE3C 2NY7L 3DWTA 1XF3B 1P6FA 1X5KA 1LMKA 4APQB 4L29B 4PGCA 1RZ8A 2R69H 4GKNA 1MJ8L 3H0TA 5JR1L 4NPYA 1CBVL 3O3AB 3S7GA 2YD7A 1YY8A 2R1WB 1CE1H 3GBML 4HUVA 4PRPD 3D2UA 3GMPA 3OKOB 1W72B 4PJBB 1J5OH 3BXNA 3ZL4L 3E8UH 4P46D 4XGZB 5LWYL 5F7KC 1EVUA 1JGEA 1OPGL 4ELMB 3QIBD 4OSUH 4OZIA 3QFDA 1V3JA 1OGAA 1T89A 5DEGB 4KHTL 4L3CB 4E42A 3P4MB 2YWYA 3LS5L 2CR3A 1NKOA 1X6NA 4BQ6A 1JYWA 4GXVH 2Q8AH 4P2YA 5DK0A 5I9QB 3LN4A 1C7TA 4FXKA 2H9GB 4GAYB 3QQ9D 1IBGL 3O6FB 2YPVL 3L3GA 3LQAC 3ULUE 1I1CA 1N0XH 4Y16C 3RVUD 2OL3B 1ZLVH 2C26A 2V2XA 1XF2B 3SO3C 2B1AL 3V6FB 3PWUA 1IZJA 4QRPA 1UM6L 2IH3B 1RUPL 3GFUA 2B1HH 3DV4A 4DTGH 2YK1L 1KCRL 2MWCA 4ENED 1INDH 5IMMB 3LB6C 4NP4H 4WUUB 2V2WB 4P2RE 3THMH 5FO9B 4GJTB 4GKSB 1FZMA 1U36A 4KROC 2MQ0A 1HKLL 3MXVL 4JFDB 5B39G 3MLXL 2IQAB 1FO0A 1Z9MA 4OUUB 5AYUL 5DK3A 5GZOC 3OKLA 4MNQE 1KIQA 1BD2D 4EN3B 2HFTA 2CIKB 2RCSH 1NCBL 3QIUC 1IGYA 1NGZA 3WHXB 4UQ2B 3VXUB 4KI5D 1N8ZA 3V6ZA 4D0BB 4U1LB 5FA3B 4MB4A 5FYLL 3NOIA 5FECA 1HINH 3ARVA 5HYSA 4DUWA 3MRLA 3FCTA 4MA1C 3I3DA 3QFJE 2JJSC 3S98A 2JJUA 2CLVA 2VSCA 1YJDL 3NZ8A 1F6AB 2YSSB 1DQLL 3CVHB 1D6EB 5C0CB 1P7HL 4XWGL 5IVXF 1ZHNB 1A6WL 4R4FL 1D9KD 3LAFA 4OCNC 4QRRA 3KLHD 2C4FT 3VI4F 2F53D 2DQUL 3H9SD 1UVQA 2APBA 5EO1A 3CAFA 5K59F 1JZ2A 1YEJL 3B9KB 1RSFA 3KPQB 5GRVK 5IB1A 5D1ZD 4LQFL 4JR9L 4Y2OA 5EU6A 3DO7A 2PTTA 3FHQA 5J1AA 3TH4T 4MXQC 4HSQA 2BK8A 4OZHF 3DYPA 3JXAA 1SEQL 4PRDB 4P46A 9CGTA 2B20A 1AJ7L 4KRPD 5I1CH 2MFNA 5IEKB 4KMLB 4U1IA 3C5JA 3RX5A 4K9EL 4NM8H 2DOCA 4MQ7B 4X7DC 3PV6B 5DFTA 4ZS6D 1RUQH 2Z8VC 4TUOB 5GS0H 4P2OC 1DQDL 1MEXL 4L8DB 5ICXA 3QUXB 2EDTA 3K4ZA 3FO0L 1ACYH 5BMFH 4U6XB 4QGTA 3DTXA 4QHKJ 4GAGH 4AQOA 1AGCA 1BM3H 1ZHKA 2K3TA 3WD5H 4LDEB 4OLWH 1SY6H 3MV11 2NW2B 3MCLL 4F37F 4F33B 4UUJA 3BN3B 3EYVB 5IFJA 3C6SB 3BMVA 2KKQA 2DQCH 5E2VH 3UXFA 4XCYB 3L5WB 3MJ8A 5IP4A 1HXYB 1RZIB 2VXVH 4Z5RB 4KZEH 5GGVL 5HVHB 3KYOB 3T3PF 2JK5B 3QEUB 4L9LB 3S36X 3RAJL 1A9BB 3V52H 4JZNB 5FCSH 2G60L 2XPGA 5DJCA 2HJKA 5FYLE 2WBWB 3REVB 3TO2B 4NN7C 4XHQA 1IAOB 1BD2A 2X1QA 2OZ4H 3B2VH 1A6VH 1CWVA 4JN2A 3G6AA 1ITCA 1KT2B 1G0XA 1K5NA 1T5XB 2XIDA 3I6KB 4XVJH 4ZUSB 4GQ9L 5I73B 4X99B 4HX1B 4XPFH 3MR9A 1KC5H 5ESVA 1F6LL 1IGML 4M1DH 2BVPB 4WU5A 1KJ3L 3OBAA 4FABL 4YPGA 5EU5B 2EO9A 1AQDB 4IJ3B 3WFDL 1CLYL 3EHBC 2X05A 2AJ3B 2WM0A 4J3TA 2BVEA 4JREC 5LGJB 5EBWB 1NH6A 4JDZA 1I9RH 1VPOL 4YHPA 5KSAA 1NCAL 3ARYA 5MI0C 4DGIL 4G8GA 2XZZA 3VGHA 4HIHB 1ES0B 4FQPA 1UFUA 3MRBA 1LO4H 5FOJA 4OF0A 2IEPA 3VA2C 4G42B 1D9KA 1JRHH 3V6OC 2BVQA 1EAPB 1TZHB 4KMTL 2X4RA 3JWDL 3HZVB 1SEBB 3LN5B 5KG9B 4PJIA 4WJ5B 3R1GL 5FM5M 1CFQA 4GKOA 2W38A 2DMBA 3C5ZC 2DYPB 5D1ZA 5D6CB 4OTXH 5ICYB 4NZRL 4LSQL 4LPXA 5GS1C 3HMXA 1Q1JL 1SJEA 3NN8A 4PBXA 2OR7A 4YNYB 3PABA 2AV1B 3VFRA 4KI5F 2IALA 2JJWA 4OZGE 1A6UL 3P4OA 1URLA 3SDCD 4PJ9A 3GSOA 5AD0A 5IHLB 1RZKH 2RQ8A 1FV1B 4PJHA 1GC1H 4LSTH 3I3BA 4RBPH 32C2B 3FB6A 4CVZA 5T1KA 4AT6B 1J8HE 2H41A 3SDXB 3EGSB 4EI5C 5DDHA 2DWEA 5M95B 5DEFB 1A3LH 2RGSA 1K3ZA 3WL9A 3O8XB 5CP7B 1JNLL 3OJVC 3VRLE 4FG6D 1HOCA 5HHOA 2DBLL 4XVTL 3O6LL 2NY4C 3U7YH 3ZKMD 3MACH 4H25B 5EPMB 3GM8A 3TBSA 2F5AH 2QHRL 4WI9A 1FL3A 5BS0D 4JKPL 5GSRA 1FO0H 2DMKA 3ULVL 2ICWB 2J4WL 4PJGF 3NVQA 5TE4H 1QFWI 2EDYA 4NHUA 2IPKB 1MCFA 1U8OB 3G04A 5DK2B 4G8IB 1JMXA 2DWDA 1IM9B 2CPCA 4V1DD 4WFGE 1HEZB 5EZLB 3TNNB 3O0RL 3L6FB 5HHPB 4EZMA 3HG1E 4HMDA 4S1QL 1I8LC 3RPIA 4EIZC 2EDEA 3DRQB 4J7RA 3L3HB 1YMHB 2PW2B 2P47B 3B9VA 4NNXA 1J88A 4HT1L 1OGTB 4I2XB 4JPVH 1MF2L 4KZDL 1JPSL 4P3DA 3IDMB 3BP7A 2Y07H 3MGOA 3EZJB 4JO3H 4YAQA 3NZHL 1FVCB 3QXDA 3ARBC 2NXZC 1G9NC 2W9DH 2DQIL 1ONQA 4K3EH 2OI9A 1NMCC 3HC0B 2NXYC 3CUPA 1EFXD 2AQ1A 3HS0A 3T0EB 3TZVC 3VGEA 1KEGH 4FQHB 1NEZA 3UBXG 5D7IE 2R1YB 3PWNB 1M6OB 5H94A 2XZCH 1EHNA 3MRMB 4KTDL 1WBXA 3U2SB 5TQ2H 3CSYB 3W0WB 5FCUL 3FQXB 5MENE 4KQ4H 4PRHB 1MRCL 4PGZA 5CJBA 5D7JB 4ZTPL 3B2UC 3TIEB 4S1DD 4X5LA 4D8PA 1I3GH 1NFIA 2NX5E 3L9RA 2LU3A 1SVCP 2EE3A 4LHUG 1ZT1A 1CXLA 4M6NH 5I6XB 3D18B 1FIEA 1M4KA 3SDCA 3X3FL 4KGJA 2BNQA 5ESQB 2YRZA 1B4RA 4C58B 4AYFA 5IF0A 2YS4A 1X9QA 4ZS7H 4U1HA 4DUXA 4XXDA 4HS3B 2J6EL 5IJKA 2DRUA 3FRPA 4N8CL 3Q1SL 5A1AA 4ZAKB 2A1WL 4N0FA 3BW9B 1NAKL 4ZO7A 2PYFA 3G5VB 3OZ9H 3ULVE 4OF5A 1H3WM 2J5LB 3MV8E 4JM2D 3AY4A 2DDQH 3KPSD 3KPLA 1MIMH 1CGWA 4WV1C 5JOFA 1NUFA 35C8H 2X1WL 1DL7L 5IHZA 5C2BL 2YRPA 3GI9H 4AL8L 4LKXB 4DVBB 1WLHA 3WUWB 3D9AH 4FNLH 5FM5O 1KELL 4HWEH 2O5YH 3CD4A 1AD9B 4V2BA 1IQDB 4PP1D 5D1QD 3W81A 5IGXL 1KTDB 4V1DA 5FGBA 4N8PA 5CGYD 2DIBA 3ARFB 1QLEL 3QIWD 1JV5B 3ZDXE 3WE6B 2ZZUT 2HVKA 4JB9L 4XNYH 4YDLB 3OKNB 1FGVL 2Q7YB 1BQHB 2A38A 2ZPKH 1KN4L 3QUZD 4R96B 4X5XB 2EEBA 2X4UB 1CXKA 2KQMA 1AQKL 1FVDB 3LS4L 4Y5XB 1NL0H 3BFOA 5BRZB 1HILB 1AKJD 3UJJL 5CSZA 5I1DA 5FIEA 2Y5EA 1YNLH 4NO2B 1QSFE 2A9ML 2A73A 4ZXBB 5I74C 5J9PB 1YNTB 5HHNB 2BMKB 2AJUH 1HHHB 1BVZA 1CLOH 3FFCE 4HUKB 5JLZA 5LBSH 4O4YH 4J3UA 4YBLC 3IB4A 1EFXA 1PLGL 4FXGA 1DUYA 2IANB 3N06B 3RUGB 3STBA 3AMKA 1S9WB 3DJ9A 3NCMA 3P9WB 4RNRB 3TBWB 2FX8H 2QQKH 3MREA 2R0LH 3BI9X 3HLAB 4H20H 4LIQL 1X4ZA 4D9LL 5JOEA 4WO4D 3SCMA 3HMXH 1HSAB 1QFWL 1RZFH 4L4TD 2IAMB 2R0ZL 1XGQB 4ZMAT 1A4KB 1AE6H 4JN1L 4K7FA 1GH7A 5DJDB 4R2GB 2ZWLT 5A2KH 1WT5A 3MUGA 3QO0A 4ZO6A 1Q9WA 4WFHD 3EFDL 4LAQL 3WJLA 4S10A 5IHUL 1PEZA 3BP5A 5B8CB 3IGAB 1BGXL 2HJLA 3LV3A 1WBZA 5EBMB 2X4QB 2H26A 3ZTNH 4H5SA 5JHLL 4XCEA 4PP2B 3KJ4C 1J9CT 4M61B 3TBYA 3WHE1 1G1CA 5TPWH 4P0DA 3CVIH 4E41A 2CD0A 3MRCB 2WUCH 3PG2A 4JM2A 4JY6A 3KPSA 2G9HB 4U1NB 3IAPA 2EDDA 3SE8H 4ACPA 2MHAB 5J6GB 1RIHH 5IB4B 2BVOB 4EI6B 4UNVA 2ADFL 4J12A 4XB8A 2QADC 4KU1A 4NKQB 4MA8L 3BZEB 2UZXB 3WLBB 3X11B 2FL5B 3LKPB 3I75A 5IMOA 3A6BL 2IWGA 4NJ9L 1PX3A 3G6DL 4WFED 4XPBL 1MFCH 4JFFE 5D1QA 5D1XC 5L2KD 2CRYA 4HAGA 5IT2H 5DWUL 5J56B 1BWWA 1RI8A 4YHZL 1BVKA 2XOTA 4LLYA 4XXCC 4CUCA 3QUZA 2EIDA 4PJ8C 1J0YA 4JFQB 3NMEA 3HI1B 1IM3B 1BOGB 1HHJA 1BFOB 4PJDF 2Q87A 3BP4A 3TFKC 4LARL 4X8JA 1AKJA 1AGDB 2C7UA 1OAXH 1JN6A 2Z4QA 4XMLL 4WWKA 2B5IC 4ZOCA 4MSWB 1ZVSB 2QJDA 4KJYA 5F7FA 1S7UA 4BZ1H 4OD1H 5LCVL 4LIQE 2B4CL 4HF5L 5LGHH 5DJ6B 1IGFH 3ARUA 4UQ3A 5DVOA 1KCSL 3MNZA 4EUPG 2GCYA 4H26A 1VACB 1RUAL 1W8OA 4PGBA 1XCQB 4IS6B 2OCFD 2K7QA 4P5TB 3KXFD 4S2SB 1D5XB 3C60C 4JFXA 1FL5A 1UQSB 3QULA 5I1LB 1PDKA 3BQUB 3RTQB 4JVPA 4HPOL 3ARDA 4H1LH 4L4TA 1Z2KA 5HYJD 2RBLA 1CYGA 4CMMA 1T20B 3HR5B 2HLAA 4IHOA 3VXMD 5D5MA 5D71L 1FCCA 5L0QC 3QXTA 3DMMD 4UAOB 3DYOA 3OR7B 3VFNA 1A1MB 4QTHA 1DE4A 3SDAD 3U7WH 4LPCA 1LO0H 5DRWB 1FFQA 1FZKA 5C07E 3MRJA 3KLAA 4W6XB 5T5NG 3R06B 1DLFL 3AFLA 2W0LA 1J0HA 5GJTL 5BJTB 2VLRD 3LKNA 2CLZB 2ZOKB 5CJ5A 1FLRL 4PREB 5D2LA 3TN0B 5ETUB 1S7TA 5CJQH 1A2YB 4WW2C 1U3HD 5I76B 3SE9H 5KW9L 5FUOL 3MBEA 5C0FB 3IKCA 4GW5A 3ZKNC 4UDUA 4X9FA 4Y89A 3LD8B 2WINB 3AREB 4O2CA 2MPAL 3DARA 4LCYA 3FQWA 5CJXC 5IM7B 3L3KB 2R8SH 3CVHL 4K3JL 5E94B 2DI8A 1QBMH 5JO5A 3D6GA 4OIBA 5D5MF 2VLKB 1E4JA 4XAKD 3TWCH 3WIIL 2VDPL 5L2KA 5LJYH 3AMLA 5D7SL 4PV8B 1DTUA 3FB8A 3I02B 5DJXB 4HMCA 5I0ZA 1YEIL 2ID5A 2W92A 4QXUL 4G6MH 5DRZA 3GHBH 5FB8B 5EUKB 1H5BB 1S7WA 4N0UA 3RU8H 1OLLA 5M7QA 1FBIL 3SOBH 1XCTA 4X7FC 3LHPL 4P23B 4JRYD 4AENB 1OF2B 1FG2A 4ODWA 4N0CC 1WTGT 4X8XA 3CK0L 4DGVL 1WFTA 1Q0YL 4G9FE 1Y6NR 5HDQH 1OAUL 1PY4A 4NFDA 1U6AL 5JIIA 1DSFH 4C56D 1I7ZB 3BJ91 43CAB 4TUJA 1AO7D 4JCLA 1FE8H 2ZUTA 3BIKA 2X4NB 5KSBE 2ILLA 1S7QA 4RGNB 3CFDB 2FJGA 3QO1B 3KXFA 2PXYC 3H3PH 4FZ8L 4EDXA 1UGNA 5T5NF 3OB8A 4BZ2H 4YBHA 3TVMC 3GJFK 1O0VA 5I1IL 4OT1L 3LIZL 2NY2C 4HH9A 1BPVA 4LOUC 3MUZ1 4PGCB 5B3NA 4MNGB 1RZ8B 5SWQA 4GKNB 4NPYB 4OCWH 1TPXC 2UUDK 3G6JF 3CZJA 3VXNB 2W07A 1RVFL 4KJPD 1YY8B 4OLXL 3WKML 1DJSA 1ZTXL 4IIQA 2UYLA 4M4PA 3SDAA 3BXNB 2M26A 1NANH 3VG9B 2YMXH 1TQCC 3QRGH 4RFNC 4IRSD 2IPUK 1PVHA 4M48L 3ES6A 1JGEB 4HWUA 4G9DA 4IOFC 2OR8A 3TJHC 1HCVA 2VLRA 1GAFH 1HQRA 3KYMB 4E42B 1MREL 3FJTA 1PKOA 2AJVL 4I3SL 1U3HA 1IEAB 4U3HA 5CZXC 3LN4B 2EYSA 2ITCB 3TYGH 3WIHA 3H2WA 1JZ3A 1PG7X 1TJIH 3LRHA 3WSQL 4F7EA 1DANT 4H88L 1QA9A 1YN7B 3PWVA 2VRAA 2OMNA 5KANG 2V2XB 1J1XH 4Y4HC 3PWUB 4QRPB 5B4MC 2QV2A 3MYJA 5TE7H 4RWYH 3DV4B 1I4FA 4KJWC 1B9ZA 4TSCH 1G7QA 2C1PB 2RFXB 1R5WA 3ULVC 2DLHA 4KVCL 4PLKD 2H6PA 2H2SD 1PG7H 4OCRL 4Z7UA 3IAGC 1QBLL 1C5DB 2F15A 1DLHA 1VFAA 1XGUB 5DQJB 3PP4L 1FO0B 1NDMA 3DVNA 2R56L 1CQKA 2A77H 1N7MH 1N5AB 1WZ1L 2NY6C 3BKJL 5GISL 1YECL 1MCOL 3QDHA 3OKLB 3IJHB 1KIQB 5EIVA 1Q8MA 3B3IA 1IKFH 1NGZB 2BC4B 4JRYA 4KMQA 3VD7A 1U3JA 4OZHB 3DUSB 1AD0B 4JHWL 4FRWA 4YDIH 4ZO8A 5B38A 1N8ZB 3WFBL 1U8IB 3V6ZB 3MRNB 2WBJC 3CDGB 3MRKB 2W0FB 1KF9B 1YQVH 4XAWH 5FECB 3CLFH 4C56A 4GG6F 5HYSB 1OT2A 2AVGA 1IC5H 3FTGA 1AO7A 3MRLB 4HV8B 4L1DA 4PY8I 2QSCL 3FO9A 3QHZL 4U6HA 3I50H 5EO0B 2APFA 3V0WL 2CLVB 3NZ8B 5DHVA 4L3AA 2CUMA 5B39B 1ZANH 5MEOB 4S1RH 2ESVE 1Z3GH 3BO8A 4GUPA 5KOMC 2I27N 4RX4D 2XQYG 1UEYA 1UVQB 4KUCD 3RIAK 3MJGX 5EO1B 5CEYA 4LSSL 1MI5E 3GZKA 5C09A 3MLUH 5AZ2H 3NA4A 3GNML 4PJEA 4JZOA 1CG9B 4PRPB 3DO7B 2PTTB 1BBDL 4Y5VA 2LVCA 3H8NA 1JPST 1KPRA 2X44D 1R5VB 1ADQL 3TO4D 1CLZH 2XICA 3ALPA 4PGDA 2V7NA 4Z0XA 4WCYL 3MLTA 3QIBB 5L9DH 3RVTC 3F5WA 3PDDA 5FDWA 2I5YH 4X4MA 2M2DA 4JM4L 1ZHBA 3PWJA 3GM0A 3NIDF 2VLME 1WWBX 4HEPG 2FHFA 4YC2C 5F8QC 3RL2A 3RNQA 3BIBX 4HIIB 3TCXA 5ANMA 4JAMA 3TH3T 2AABH 5IB3A 4V3EB 4NFCA 4LPWA 4LEXL 2P8PA 3BEWA 5AG9A 2YD8A 4PRNA 3RVWD 3T2OA 4KV5E 5JA8B 1AGCB 1ZHKB 4JO4H 4L3EE 3IDJA 1FN4A 2FEDC 3LVEA 2FD6H 3RA7L 4UUJB 2GEEA 2J8UE 3GBNH 1EEUA 1EHLL 1NC2D 2DQHH 5IIEB 3S5LA 1U8MA 4NKOA 1RJZA 3QPXL 4MS8A 4GKZB 1FFPA 5EA0L 3PP3H 2CUIA 2VZVA 1CGSH 1E4KC 1T1ZB 5EZOL 2XPGB 2HJKB 3MUJA 2P8LA 5HI5D 1TNNA 4JG0H 4JCMA 2VQTA 1BD2B 1KCGC 1MOEA 3DUUA 5ACMA 4HQQH 4N90D 3S37H 1QQDA 3TF7A 5F88B 4PV9A 1U93A 1HCFX 2CXGA 4WU5B 3WDIA 2XXCB 2V17H 3HE7A 4DGYH 4YPGB 1IFHH 1YEFL 2WIIB 2B39A 3EYQD 4ZYKB 3ZLQC 4DFIA 2JCCF 3A67L 4LLAA 4Z8FH 4UI2A 3HI6H 1FZJA 4BH8A 1KN2L 4TQEH 2VB5A 1XF4A 2QQLL 5EWIL 4PJCA 3JWOL 4YR6A 2C9AA 1EJOH 2HTKD 1OP3K 1R3IL 3MRBB 5C9JA 2F53B 1EGJH 4I0CC 3RWHA 5I1AB 1PY9A 3BD4A 3H9SB 3LDBB 1QO3A 4I77L 3B5HA 3MRPB 1CFQB 3OAYH 3FT4A 4HJGA 4TVSa 1T2QH 4KKBC 1KCKA 4I2XE 4WNQB 4YE4L 5D1ZB 5C0JA 4WY7L 5BVPH 4GW1A 1SJEB 3NN8B 4PJGB 5KS9F 1XH3A 3PABB 1F4XH 3VFRB 2IALB 4KRPB 4G7VL 1MFEL 5KJRL 3P4OB 1F58H 3LKRB 1GPOH 1KJ2L 4LSDA 1WITA 3IFOA 3OHXA 3VFGL 1IGJA 1JGVL 1P9MC 3QNXA 5JPNA 4PJHB 2J1KA 1YEEH 3MC0A 2XTJE 5BZDA 3FB6B 4CVZB 2VDRH 3WIHH 1BEYL 2H2PC 3IDNA 4Z95H 4PJCF 2F19L 4MQXD 2GJ6E 4P4KC 2DWEB 4TNVK 4D0CA 5CMAB 1XGYL 5CIPB 2XKNA 2BHUA 3WL9B 1C8PA 2HLFD 2WV3A 4FS0A 3O2DL 5DUPL 1JIBA 2KPNA 5EC2A 5F7NC 1A8JH 4Y4FD 1HOCB 4HLJA 1NLDH 3K3QA 4KUCF 1UZ6F 4KVNL 4I13B 3SGDH 3IT8D 4RA0C 3SGJC 3TBSB 2OS7A 5HSFA 1NC2A 4O51B 5C1MB 3QWQB 5ISZE 1FL3B 4M8VA 1T03H 5DJ8B 2QR0A 4ZFGL 5GGQH 4APQC 4LFHG 3U4AA 4NHUB 5ITBL 1VHPA 3G04B 3MV9E 1FHGA 4IRZL 3FOMA 3CZFB 1DEEA 3F6LA 4MNQD 5DJ2B 2R69L 3S35X 4JHBA 3RPIB 5LXGH 3ULSA 1JFMA 3ZYJA 5EZJA 2X7LB 5HPMA 1GXEA 2QKIB 3HAEA 1CE1L 4NNXB 1EMTH 2ICCA 1D5MA 3FQNA 1JCKA 1T2JA 2VNCA 3E8UL 3ZE2E 5IW3A 4YAQB 2HT4C 1JHLH 3EIFA 4RDQG 4CU6A 2B4CC 1A1NA 1N2RB 4OSUL 1JGDB 3RWCA 5I9QC 3NIFE 3GUTB 1ONQB 4OBRA 4F57H 3QFJD 5F9JB 3O6FC 1U92A 2R1XB 4WFFD 3RDTA 3CUPB 2FATL 4XMPH 1QVOA 4GXVL 3WJJC 1GL4B 1NEZB 2Q8AL 5BVJA 1G7HA 3OV6A 5H94B 5AEAA 1E6OH 1A4JB 4H0HB 4TSBH 2HMID 1N0XL 3VG0H 3NCFB 4WHYH 4GRWH 1F97A 3HZMA 5FO8A 4MJID 2OTWB 1XR9A 2B1HL 2YUVA 2NY3D 4DTGL 3MPCA 1JRHI 4D8PB 3S4SG 1INDL 1NFIB 3L9RB 2YN3A 4NP4L 1ZT1B 4ZFFA 2D9QB 2O5XH 1CGUA 3FFDB 3L5JA 3SDCB 2DQEH 1FYHB 2HJFB 5CLTA 4EN3C 4U49A 3MODH 5IF0B 3SJVE 4U1HB 1UZ8A 1NBZA 1KIPA 3U0WH 4XXDB 5EOTB 1TTFA 1U2CA 3NCYP 3W9EA 1IAIH 2LAGB 2Y36H 2RCSL 3BESR 4N0FB 4XNUH 2R29H 4JRWA 4XPHH 3R0MA 2PYFB 1S5HB 3BKYH 3OAUH 2X5PA 4ORGB 1DBAH 4Y4FA 4OFIA 4L8SB 2IJ0C 2FHCA 4U6YA 5D2NB 1HHKA 1HINL 3O2VH 5E5UB 5T33H 5JOFB 4Z7VE 2BY1A 3N1GC 4BZYA 5IHZB 4LHUB 1YNKH 5BS0B 2XY2A 2ATKA 2X4SB 5MERA 5I66A 3CFJA 5LG1A 4HFUH 4RDQF 3B9KC 4F8TA 5FYLD 3EJYD 4V1DB 4Z7OE 5JIKA 2EXYD 3D3VA 4TPRH 1QD0A 2A6JA 2HVKB 4MNQA 1UXWB 2YD3A 1V05A 4MA3A 4UB0H 3U6RA 5A2IH 4NRZB 5D70L 2GK2A 2Q3AA 3ULUF 1G7PA 1I3RB 3O4LA 2LE9A 5I1GH 1NCCH 2A73B 3QUXC 3CIQA 3UAJD 2QQQA 3PGCA 1SJVA 2ZG1A 4NM8L 4X9HA 3QFJA 1MCEA 2FDBP 1RUQL 3SKMB 1WZMA 3WNMA 2JELH 3FONB 5GS0L 4HLZH 2DF3A 3HNVH 2ZSWA 3ECBA 4FXGB 1HH6B 2G5BA 4XBPA 3HPLB 4K3DL 4F7MA 2VL4A 2YPLA 1R3LA 1C5BH 3MREB 1DQJA 4U1MA 1BM3L 4PJAE 3WD5L 4OLWL 1CZ8H 1EEYA 1SY6L 4BQCA 4NDMA 4MJIA 3TGXA 5HVHC 4B53A 2DQCL 4L9LC 4QOKE 5E2VL 3PQYA 3RVVD 5K9QG 5EOCH 2VLLB 4FFYL 2GW5A 1HSBA 4MCYA 2EDWA 4K7FB 3IXTB 2Y5TB 5T1DL 2VXVL 4KJQD 4KZEL 1GOHA 3KPRE 5F7EH 1S7XB 3DI2B 4CGTA 1ORSB 1Q9WB 3RFZC 1MAMH 3BP5B 1ZHLA 1T2XA 4RAVB 5I73C 1OAYH 4HS8H 5FGCB 3WS6C 3IYLW 2ATPB 1NGPH 2H26B 4EKXA 4H5SB 4ZFOB 3P4LA 3B2VL 2OZ4L 1A6VL 3C6LD 3ELAT 4LL9A 5I1HH 3TBYB 3D1MC 4P9MH 2N7AA 4IJ3C 4PR5A 4L1HA 5BW7C 4XPFL 4HJ0C 2HWZH 2NY1D 4M1DL 4JM2B 5ADOH 3KPSB 1KG0A 3PXHA 4IEFB 2Q8BH 1NKRA 3RBGA 1XIWA 3GI8L 4C57C 4LP5A 5EO9A 5GSVB 3FMGH 1D5ZA 1EEZA 5IMOB 3I75B 1W8NA 4KQ3H 1I9RL 3QXWA 4MGXA 3OWEA 1LO3H 3JV5A 2IH1B 5T1LD 3EYOA 5D1QB 2YR3A 1LO4L 2X89A 4PUBH 1JRHL 4KXZH 2VITA 3HG1D 2AQ3A 3QIWB 4JGUA 3SY0A 1LQSR 1CFTA 1FNFA 4LLYB 1CD1A 3QUZB 4HXAH 3I3EA 5E2WL 4OTXL 3E3QC 4N8VA 3BP4B 4X8JB 3UYRH 4ISVA 2WQ8A 3CH1A 1AKJB 5DD0H 2HKHH 1BF8A 2J8HA 2C7UB 5F1OB 4DN3H 1JN6B 2Z4QB 4M7LH 1M7DB 4HUMB 4TTDC 3U82B 2WUBH 4KK9D 5I16B 4Q2ZA 1SM3H 2K9UA 3QCVH 4J3XA 2GUOA 5J11B 3MJ7B 3NFNA 1RZKL 5E2UH 1GC1L 4LSTL 3GMLB 3O8XC 2FJHA 3MNZB 5C0RH 2GCYB 4H26B 4P4RA 3DGCR 1Z9OA 2FIKA 1A3LL 1WQVT 6FABH 1RPQA 5MEND 3QULB 3WXWH 5JUEH 1A1OB 3DGGA 2EC9T 4WO4B 2XZQH 3E0GA 4L4TB 3U7YL 3MACL 4CMMB 1HQ4B 3K80A 2F5AL 2HLAB 1OTSC 1WWAX 4IHOB 5H35B 5D5MB 5FV2A 4NN5B 3MOQA 3JZ7A 4DOHB 5CHNA 2EYTA 1FO0L 1INQA 1TTGA 3VFNB 3LEVH 1DE4B 3AS1A 3S88H 1EAJA 5D7LA 4ORZC 3PL6A 3KLAB 3VD9A 2EE9A 3BKCH 3QHFH 5JIPA 3MV01 1IAMA 5ENWA 4K3HA 4UT7H 3SPVB 1E4XL 2FLBT 3LKNB 3RY4A 1DQMH 5D2LB 3C6LA 3VWKA 3HZKA 3MV8D 4R7DB 4CKVX 2DQTH 4JPVL 1Y0LA 1F3JB 3IKCB 4G3YH 2Y07L 2X4PA 2XKUA 3I84A 4WGWB 5I1JH 4UDUB 5D93B 3LMJH 4JO3L 3ME0A 3BZFA 5IWLC 3T0EC 4O2CB 2CDEA 4PJ7F 2X9YA 4LCYB 1PKQA 3VFPA 2FO4B 2UWEA 2W9DL 4DW2H 4Q0XH 2VZUA 4K3EL 4DCQB 1QTYT 3FOLA 3EOBA 4GW4A 1KENH 4HC1H 5C08D 3HB3C 1YPZF 4OZGF 4WW2F 2OX5A 5T1LA 5D7JC 4DVRH 4Q9CA 5L2KB 2F8OA 1KCLA 4I5BA 1WZKA 1ND0A 4OZIE 3HG1A 1F2QA 1OGAE 2D0FA 5TQ2L 4MJ6A 1KTLA 1Q9LA 4XVUD 4KQ4L 4QEGA 2UY6A 3WEXA 5I6XC 5DRZB 5TGBA 3TNMA 4N0UB 1MWAA 4H0IA 1OARH 1AR2A 3LH2H 2X4OB 1I3GL 1YMMA 1QSFD 4Y8DC 1AFVH 2DS4A 2ORBH 1HNGA 3F58H 4ODWB 1FG2B 2P48B 4YGVA 4M6NL 5CEZH 3FFCD 5J1TC 4U7KA 3CFKA 4L4VB 1W0WA 1EBPA 5J0BA 4PG2A 2FEEI 2BOCB 4ZAKC 2N7BA 4ZUWB 4ZS7L 2FBJH 3M1BA 4QHMA 4QF1A 2J5LC 4LNVA 5IFAL 1QHOA 3MUY1 1WISA 3BIKB 3B4NA 4DQOH 3JWOC 1IAKB 1B2WL 2FJGB 4D9RE 3KXFB 1ZSDB 3T77A 4POUB 5E24E 2DICA 3ZKXB 4EDXB 2V7HB 3OZ9L 4XCNA 5HDLA 2N56A 4Z0BL 2DDQL 5F89B 3VFWA 3V4VH 4QYOB 4YHKL 2VAAA 1MIML 3C8KA 3MGTB 5HHQA 5HYJB 5SWQB 1H9VA 4FFEX 2OJZH 3VXMB 4Q9QH 2EDOA 3GI9L 3IF1A 1F4YH 3ARFC 3DMMB 4YDLC 4YJZL 3D9AL 4FNLL 2UYLB 4N9GB 4HWEL 3GSQB 5DGRA 4TNWF 5CILL 1R6VA 4X6DF 1U91A 2APXA 3ILQC 3AUVA 4Y5XC 4XNYL 2ADIA 4ZDHA 1TJHH 1RV6X 4ZUUB 4YHLL 2VLRB 1G84A 5BV7B 1X5XA 4OLYH 4NQDE 5D7IF 2AEWA 4ZXBC 4HXBH 2O26U 1ZWIA 4MJ4A 1DVFD 1I1YA 5HXMA 1U3HB 4OM1H 5D6DA 4LNRA 1NL0L 2W59A 4QRRE 4YXKH 4I0PB 1YNLL 1BIIB 1NCDL 1MJUH 2PW1A 2OK0H 1QA9B 1RUKH 3PWVB 1CLOL 1X44A 5BOZG 4O4YL 5HGAA 2V5YA 5CWSA 2I9LA 1FJ1A 5EU6E 1NJ9A 1OP9A 4PGEA 5C08A 2NMSA 1G7QB 4JFFD 3UPCA 1N26A 2H6PB 4K8RC 1C12B 1JVKA 2BCKA 5D9SA 2IAMC 4HIEA 4Z7UB 1DLHB 2FX8L 2QQKL 4ZPVB 4C83A 2R0LL 5KVGH 4N5EC 2P44B 3GSWA 4J4PC 3HMXL 1YN6A 3DVNB 2FX7H 4R2GC 3PDOA 1RZFL 3JUYA 5CKAA 1J1OH 1NMAH 4JKLA 4GOSA 1GOGA 1TZIA 3ULVF 3B3IB 1AE6L 1IILE 1QSFA 5B8CC 5ICZA 4JRYB 5C71A 2YBRB 4FQQA 5DEZA 3C2AH 3FFCA 4BUHA 5ACLA 2DLIA 4R9HA 4G80A 4YZFE 2YXFA 5KVEH 2BXYA 4XCFH 1S9XA 3ZT7A 1FNAA 3RNKA 4C56B 1GVIA 3FTGB 4NQSA 1AO7B 4J8RA 3IKKA 2YUXA 3ZTNL 4U6HB 2ZUXA 3M17A 3WDHA 2R2BA 2FSEB 4YHMH 5DHVB 1GJIA 5TPWL 1Q72H 3D0VA 3ZDXF 3CVIL 4Y5YA 2XTLA 3HC3H 1LEKB 2WUCL 1JPTH 3BO8B 2GSGB 4GUPB 4NKMB 3SE8L 4TVPH 2VZTA 1RIHL 1T6VN 2JB5H 5LAXA 3LQZB 5CEYB 4CAGA 4BA8A 2VH5H 3LKSA 4Q6IA 4LEOA 3PWLA 4OJFH 5J3HC 4X7TB 3MRFA 4PJEB 5TH2A 1LE9A 1RHHB 5DUML 2LU7A 3HNSH 4Y5VB 5C07D 1X5ZA 3LRSA 1MFCL 1BJ1H 4X6BA 4IRSB 5F1NB 4WWID 5IT2L 4U7SA 1P2CA 4JFEA 4PGDB 2V7NB 4Z0XB 3MLTB 2Z31D 3F5WB 5DMGD 3DXAE 4J3OC 4HPYH 3P30H 3EKCA 1I8IA 1ZHBB 3PWJB 1B0RA 1JGLH 3DRTA 3L3OA 4G8GE 1NANI 3MRRA 5B3JE 3RNQB 1DVFA 4JQXC 3K2UH 5L2JB 1MCNA 4TN9A 5ANMB 2DM3A 1RIUH 2AJYH 3P3YA 5IB3B 4M6OH 5HYFA 1OAXL 2P8PB 2PYEA 4PJIE 4JQVC 4K23H 4OD1L 1FN4B 2JCCB 4P5TC 1F4HA 4X0KA 5LGHL 5IROA 1A7PH 1GGCH 1IGFL 1JNHA 4JO1H 4BSJA 2JIXD 3PNWA 3CU1A 1DBBH 3LRGA 3BQUC 3RTQC 4JFFA 1KXQE 2VC2L 3D25A 3B5GA 3V4UH 2CKBH 3S5LB 1U8MB 1JPGA 2UZYB 4JY4A 5L6YH 5DHYB 1UWGH 4RGOL 1RJZB 4RSVA 3UDWA 1GIGL 4MJ2A 1TZGH 4ZODA 4G8FA 2Y7QA 1N59B 1J12A 1YYMH 1LNUA 5IBTH 3WFHA 3HKFA 4UAOC 4OFDA 1FFNA 2P8LB 3MV7D 1VFBB 3VXRA 3FQRA 2PR4H 4PJFE 2FX9H 3Q6FB 4WTWA 3K8KA 1YDPA 2NYYD 5EIQA 4O5LH 5KS9B 4G9FD 3SE3A 5HHOE 4JPKH 5KVMC 3U7WL 1U93B 3DBXB 5E7BA 4EVNB 4UT6H 1LO0L 3X13A 4LKCA 4HWZA 5FF6B 3TN0C 1QFOA 1RULH 5FUCC 3AS3A 3PDGA 3DI3B 3S34H 5GS0C 4OIIH 3LD8C 1MFAL 3AREC 4NHUE 1U8PA 4PJCB 5CJQL 1T66C 5BO1L 5JMRA 3SE9L 5MEQA 2HYMA 2R4RH 2DLFL 3SN6N 4NFBA 1CE6A 5IW6A 3V0AC 3BPOB 5C9JB 2BOBA 3GIVA 2VXTL 3Q6GH 1YUHB 3LOWA 1QO3B 2NTSP 4FP8H 5E8PA 5DS8A 3FT4B 3TLRA 4F9PC 4HJGB 1T21A 2EZ0D 2GY7B 3KJ6H 5C0JB 1C1EL 1QBML 4XPGH 4DFHA 5IB5A 3EYSH 1QLRA 4WW1B 4GW1B 3ZTJG 1NBQA 2YC1A 3N1PC 4F3FB 3TWCL 4NC1C 3TO4B 4XH2A 2OJEA 4LPTA 1H5BC 3MNWA 1B88A 4Y16A 2AERT 5GIRA 4P23C 3IFOB 3OHXB 1IGJB 5JPNB 3SQBA 4NJAH 1LEGA 4R4BB 5EU3A 1LK2A 3GHBL 1KNOB 3BWUC 4PJXF 3O6KH 2EDNA 3RU8L 3IDNB 2NW3A 3IS1X 3SOBL 1IL1B 5DFVC 3EO0B 3TJEH 1E28B 1CXHA 1OWWA 4LRNH 5HI3C 4P57B 1MPAH 5HHXL 3GMMA 4LLDA 3F12A 1KFAH 4RGNC 3L3IA 4TRPL 5HDQL 3F6IA 4JANA 1NUGA 4Y4KD 3VXQA 1DSFL 3GSUB 4P2QA 3C2SA 4QTIL 1FE8L 4GBXD 1MCPH 1MCDA 1NC2B 2P5EA 2OSLB 1CFVH 1AGBB 4S0UC 2BNQE 3H3PL 4QWWD 4HS6A 4DK6A 2OXHA 5FKPB 3RL1A 4BZ2L 4NUJB 4N1EA 3ORJA 3FOMB 2Q76A 2DB8A 4UTBL 4ODUB 1MHHA 5HGDB 1ZGLA 4B0MM 4YHNB 1NDGA 3IJYA 4B7IA 4JDTH 3MV7A 5IESH 5FXCH 1KB5A 3VG9C 3QZWA 4OCWL 4PLJD 2JJSA 3ULSB 4FA8A 5EU7E 2KUTA 3HAEB 4NKDA 1FNEA 2E6JA 2XXMB 4G9FA 5DJ0A 1T89C 1FYTB 2YMXL 4OI7A 3QRGL 1S5IH 3V0VA 1CU4L 1MLBB 3S97C 2PCPB 3B83A 3E6FB 5DJAA 2XACC 4M5ZH 5KSBA 1BQUA 1A1NB 1RZKC 2VZSA 3RJDA 3VFTB 1WWWX 1U92B 2Z35A 4OFYD 2OLDA 2E6PA 5AUMA 2BDNH 2X1PA 1LO2H 5SWSE 4ERSH 1QVOB 2ESVD 1U8HA 3NFPB 3GMRA 5SX4H 3RVXC 3P9MB 2I9TA 4HDIA 5T3XH 2AQ2A 4V1DE 5BVJB 2VKXA 3ABZA 1T3FA 3KPPB 5A40E 3TYGL 1NCTA 1TJIL 1A02N 1MI5D 4MLIA 3SKUD 1CICD 5F9WB 1J1XL 1G9EA 5FO8B 1XR9B 2V9TA 4MB3A 2VABA 5TE7L 4RWYL 1ZS8A 2DQFB 3IU3B 2FGZA 4P59H 3LQMA 5JZ7D 1KUMA 2EC8A 2DQGH 1ROWA 1S7SA 3CFIC 1TVHA 3GJFA 5CBEB 2VLMD 1LHZA 5GS2H 4NQEA 2F58H 5KSBF 2YD5A 3DX7A 1UZ8B 1KIPB 3A6OA 5C7XH 1T04A 2WWMC 2A77L 3JTSA 1N7ML 1BQSA 1P4BH 1E4WH 1UJTA 1TETH 2FWOA 3W9EB 1AXTL 3PGFH 4G8EB 5EZIL 3UTQA 1JI2A 4HD9A 3TA3D 1IKFL 2DM7A 5DQDH 4JRXE 3W39B 1NAMA 4L3ED 4NO0D 4NO3B 4YDIL 4Y4FB 3EZ8A 4U6YB 4BKLA 4XAWL 1YQVL 4Y4KA 4Y19E 1HHKB 3T8XA 2WANA 4LLWA 1IC5L 4G6AD 1IEBA 5DLMH 3VFSA 4GBXA 1OD9A 5J8OA 2YUWA 4Y1AE 1LDSA 5I19H 3I50L 2ZG3A 2ATKB 2MQ3A 1MRFH 4XP1H 3CFJB 1CK0H 3TBVA 4BFEA 3SGDI 3D39E 5J4MA 1XGRA 3JWNC 2ICEB 5FGCE 2A6JB 5T3ZH 4MNQB 2HFFB 1A3RL 3ZT6A 1CTOA 4GRLD 2QLVB 3GJEA 4OCYH 3MLUL 4OGYH 1MCIA 5AZ2L 3QIBC 2GSIA 4LPYA 4E41E 4X9IA 5JDSA 3CMGA 1G7PB 4I48A 2JB6B 5C0AE 3V6OA 1YY9D 2XZAL 1Z0MA 1CLZL 3RIFK 3I2CH 3V5KA 3NIGE 4AJ0A 2YA0A 4DWHA 3FN0L 3PGCB 4JFHE 5L9DL 4HUWA 2I5YL 4MDIB 3QFJB 25C8H 3QQ9C 4OFYA 4XBGB 2MQCA 1ED3A 1EUUA 3ARQA 1XFPA 3RVUC 4EDWH 2ESVA 4WTZG 4XBPB 5E1AA 5DUBA 3RX8A 2HFGH 2AK1H 5IMLA 1RK0A 1UWXK 4FQXD 4HKZA 3WNLA 3SE4C 4G6KL 4ENEC 1MI5A 3UZVB 2VL5A 3C9NB 3O4OB 4OV5A 1CICA 5AAWA 4U1MB 4JO4L 5IQ7L 3QA3A 4NDMB 2FD6L 1CDJA 4MJIB 2YD2A 3GBNL 3QDAA 5K9OA 2NY3B 4BQBA 4DKFH 2VWEC 2X4TA 1JWUA 4DKAA 4EI5A 5EN2B 2MCPH 4YDKH 4S0SD 2DQHL 4MCYB 4ZQKA 5GS3A 2EDXA 2PTUA 3H3KA 1JHTB 1YC8A 2P24A 5ID1B 3ISWA 3UTSA 3VI3E 1QRNA 1CGSL 4LHQB 3L95A 5ECJE 4U4BA 2XTJD 4XRCA 3FT3A 1ZXQA 1CD9B 3GK8H 3O2WH 4KI5C 2ZSVA 2P4AB 4K7PX 2GJ6D 4JG0L 1K4DA 4OB5H 1YEGH 4HK0A 4HQQL 3TA3A 2MOVA 3S37L 4HMEA 4UV4H 4XBEL 3T2NL 5J13B 2AS5M 4L3EA 4NO0A 5IK3A 4AIZA 4XNMB 5E0QA 5FHAH 4NO5B 2OR9H 3I6GB 4L4TE 2V17L 4I3RH 3RX7A 3I85A 4DGYL 1S78D 1IAII 1KG0B 1IFHL 5HDOA 1NLBH 3LN9A 4CN6A 4K7PH 1KEMH 3U46A 1I8LA 5ISZD 1U3ZA 3BWAA 3RWFB 4Z8FL 5EO9B 2IBZY 1D5ZB 3HI6L 5JOPE 3KLHC 4TQEL 1JF6A 3MLRH 4G7YH 4LCWA 3MV9D 3LDBC 1EJOL 4WFHE 1HHIA 1PD6A 2AXGA 3VE0A 3GSRB 5KVDH 3ARBA 5D1ZC 3MGAA 4LVNB 4HUXA 4ELKA 3O3BB 4M00A 4HIXH 1CFTB 4RIRA 1HH9A 2ZUWA 1CD1B 1T1YA 4GRLA 2DQJH 1T2QL 4KRNA 1V3MA 3MQIA 4KRPC 1OAKH 1QFHA 3EBAA 5BVPL 4N8VB 1I75A 1FPTH 3NCJH 4ZS6C 2W60A 4KV5F 4KWUA 4PRIE 1F4XL 4QXWA 5F1SA 5BV7L 2DMCA 3BPCA 2XYCA 2J8UF 1F58L 1GPOL 4WDIB 3X12A 3V5HA 5AZEL 2O5ZL 2GUOB 1LEIB 3NFNB 1W2KT 4HH8A 4ZNEA 2C4FU 1XT5A 2ZJSH 1I1AD 3UCRA 1YEEL 4WENB 2HFEA 2P7TA 2VDRL 2FJHB 4IRJD 4WFEE 4XNXH 3WIHL 1S7VA 5HBBA 1MRDL 4Z95L 4NQCE 1A14H 3VXTA 2FIKB 3MYZA 2GFBA 4FQXA 1LQVA 5ELIA 4I18B 3A6CL 2VDNL 3DGGB 2XWTB 1NLDL 4GS7B 3MBXH 4DJMA 4N0UE 1FORH 3NH7H 1XEDA 1HI6A 1CCZA 2ZNWA 4BFIB 2UV3A 5F1KC 3GJFH 4OZGB 1A7NH 5CZKA 4ZG1A 5CHNB 2EYTB 5GGQL 1INQB 2BSRB 2YPKB 4OQTA 3SJVD 3BGAA 1KB9J 2UUDH 2BY2A 4WV1A 4UBDD 5FEBA 3OAYK 2VDOL 3ARTA 2EH7H 1GOFA 3QDMA 3HI5H 5DC9B 1NAMH 5LXGL 2B2XH 4MAUL 1DEDA 3C6LB 5EDXA 2Q86A 3GMQB 5J6HB 3EAKA 1NEUA 1BBJA 1BVLA 4OF7A 5BCAA 4P2CG 2OMBA 5C2UB 1M05B 3QEQE 2J2ZA 3NACH 3LZFH 3U0TA 3NABL 3RIFF 3BZFB 1KB9K 4RISH 1LE5A 1MVUA 1PKQB 3VFPB 4X80H 4NQVA 4F57L 2XT1B 2RIKA 3FOLB 3OTTA 4GAJH 4GW4B 1MFDH 4HKJA 1U3YA 4RQQA 4IOSD 4OF3A 1UKTA 4XMPL 1MCQA 3VH8A 3G08B 5DTFA 1E6OL 4I5BB 1G7LB 5JDJA 2BFVH 1ND0B 1BQHG 3VD4A 3HG1B 4WEBL 3KHOA 3QH3A 4MJ6B 5KSVA 1KTLB 1A6PA 3KYKH 4OLVH 3W9DA 1Q9LB 3U4EA 2XG5A 3WEXB 1VESA 3SDCC 1II4E 3TNMB 3LPFA 4AIOA 1MWAB 1FNGA 4NZTH 4KXZI 4HGWA 3ROOA 3KS0J 4P9HH 1D5BA 3DVGB 3MLVH 3MRDA 3RJQB 5CD3A 4NNPH 4QXGL 4YGVB 2O5XL 1P7KA 4PIRF 5IJKC 2DQEL 3CFKB 1W0WB 4FQ2L 3FQTA 2GK0A 2WZPD 4FQCH 5JW3L 2EE2A 4QHMB 3UYOD 5D7IB 1XZ0B 4L8SC 1WBYA 1IAIL 1CN4A 3JBG7 5DYOA 4BSWB 5D2NC 2Y36L 1U8KA 4R90L 1HXMA 3UTZA 5DMIH 2H8PA 4XNUL 2I07A 3ZKMC 3OJ2C 2R29L 1XGTB 3LKQB 4XPHL 1MVFA 4EIGB 5MENB 5DD3H 5E9DA 3BKYL 3OAUL 2KDGA 3LCYA 5ACZA 5JXAH 1DBAL 5HVGB 5SWZE 5FK9B 1SVZA 1G6RA 2X42A 4RMTA 2BY0A 2P8MA 2XNAA 4IMLB 4QOKD 2ZOLA 3C8KB 3O2VL 3Q48A 5HHQB 5T33L 1G7IB 1TVBA 2OYPA 5DI8A 4EOWH 1WAAE 4QY8A 2FJFB 1NSNH 4YFLI 4QXTB 1YNKL 3IF1B 4GXUM 3FZUD 3KPRD 3ZE2F 4RFEB 5B21A 4LCUB 4ZPTA 4YFEA 3O2DA 2G2RA 1L0XA 3ZKND 4CVXA 5L8KB 1R3JA 3NIFF 3PIQA 4POYA 1VKXA 4RAUA 4TULH 4QT5A