4CZOA

Crystal structure of the extralong fungal manganese peroxidase from ceriporiopsis subvermispora in complex with manganese
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
367
structure length
367
Chain Sequence
PTAVCSDGTRVSNAVCCDFVSLGQDLQSMVLQGDCGEDAHEIIRLTFHDAVAISRKLGPSAGGGADGSMLLFPLVEPEFAASNGIDDSVNNLIPFLSLHPTISAGDLVQFAGAVALSNCPGAPRVQFLAGRPNHTIAAIDGLIPEPQDNVTSILERFDDAGGFTPFEVVSLLASHTIARADKVDPTLDAAPFDTTPFTFDSQIFLEVLLKGVGFPGLDNNTGEVSSPLPLGDTSTGGKDTGLMRLQSDFALAHDPRTACFWQGFVDQQEFMSQSFASAFAKLAVLGHNTDDLIDCSEVVPVPKPAVDKPTTFPATTGPQDLELSCLAERFPTLSVDPGAQETLIPHCSDGLENCTSVQFSGPATDSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Implications of the C-Terminal Tail in the Catalytic and Stability Properties of Manganese Peroxidases from Ligninolytic Fungi
pubmed doi rcsb
molecule keywords EXTRALONG MANGANESE PEROXIDASE
molecule tags Oxidoreductase
source organism Ceriporiopsis subvermispora
total genus 111
structure length 367
sequence length 367
ec nomenclature ec 1.11.1.13: Manganese peroxidase.
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.420.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 2 Peroxidase, domain 2 4czoA02
1.10.520.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 Peroxidase; domain 1 4czoA01
4PAEA 1ML2A 4JPTA 1CYFA 3FJWA 4NVLA 1CCPA 1JDRA 3EXBA 1YYGA 2VKAA 3CCPA 3M2FA 1AEQA 2AS3A 1ARYA 4JB4A 1B82A 2E39A 2W23A 3R98A 1H5GA 5SYWA 4CCPA 4JM6A 3X16A 1CPGA 4A7MA 1AEJA 1BGPA 1YZPA 1S6VA 3E2OA 5L86A 1U2LA 6ATJA 1Z53A 3FKGA 1AEDA 2B0ZA 3FM1A 1AEOA 2VCFX 1SJ2A 1LY9A 2PCBA 1HCHA 1LLPA 5SXTA 4CVIA 1CPFA 2X08A 4BM2A 5CIHA 4BLYA 5ABNA 1H5CA 4BM3A 4P4QA 2XILA 1CCIA 2XIHA 2N18A 2RBUX 1U2KA 1DSGA 1BEJA 1H5EA 2XI6A 4NVBA 1U75A 5JHYA 4NVHB 1HSRA 2RC2X 2VO2X 3M5QA 3RIWA 4FEFA 4XVAA 5CICA 1APXA 1UB2A 5SX3A 2RC1X 5KQKA 5FNBA 1C8IA 2EUPA 5CCPA 1EBEA 5EJXA 1GZBA 1FHFA 3VLHA 2XJ8A 5KSFA 1H58A 1GX2A 5KQIA 7CCPA 1ARUA 1H5IA 1PA2A 2CCDA 1AEFA 1LY8A 1OAGA 5FNEA 2VCNA 5ABOA 5KQ3A 1CMUA 3M26A 4NVCA 1H57A 2AS6A 1MN2A 2GHCX 1GWTA 1OAFA 5CIEA 1ITKA 2GHHX 4C50A 4BM1A 1SOGA 1QGJA 3ZCGA 1DJ1A 1CCBA 1KXMA 1JCIA 4BM0A 5SYXA 1BJ9A 1H5AA 1AEMA 5ABQA 1CCLA 4JMZA 1U74A 2EUQA 1CCJA 3HDLA 5SYJA 1DSOA 4CZOA 5JHXA 4CZPA 5L02A 4C51A 3M2AA 2B10A 5KQ2A 1AEBA 5SX6A 1KRJA 4NVMB 1CCGA 3Q3UA 3FM4A 1MK8A 4JM8A 5JQRA 1SDQA 2EUSA 5SYLA 2XIFA 3VLIA 4A6ZA 1CMTA 4JMTA 5SYYA 4CCXA 1GWUA 3UW8A 2VNZX 2EUNA 2Y6AA 3M25A 1LYCA 1QPAA 1U2JA 4A5GA 5SXXA 1GW2A 1H55A 3WXOA 2EUUA 1CCEA 5KSKA 4JPUA 5EJTA 1CK6A 4NVNB 1MNPA 1CMQA 2YCGA 1YZRA 4JN0A 5KQ6A 5SYHA 2GGNX 3VLKA 2BCNA 2WD4A 5SW6A 1B85A 2CCAA 4USCA 3E2NA 4JM9A 1H5MA 4JM5A 5CJHA 5AOGA 2CCPA 2RBZX 4JMSA 5SX0A 4A78A 3ATJA 3UT2A 1V0HX 4CZRA 3FM6A 1W4WA 2Y6BA 1YYDA 3WNUA 2B11A 2PCCA 5SW5A 3RRWA 2IA8A 1CMPA 2CYPA 1KOKA 2RBXX 2E3AA 1KXNA 1BEQA 7ATJA 5SX1A 4NVAA 4FCSA 2V23A 2GHEX 5SX7A 1BVAA 1B80A 2ANZA 1H5KA 1GWOA 1A2FA 4XV8A 5AL9A 5SXRA 4A71A 1ARPA 2RBVX 4FCNA 1AEHA 1ARWA 4NVKB 1AEUA 5SYKA 1DCCA 4ATJA 1CCCA 2XJ5A 1AESA 1H5HA 1GZAA 3M23A 1CPEA 1KZMA 5AMMA 4XV5A 2AS4A 4JQJA 1AC4A 4JMBA 3M27A 3M28A 5SW4A 5L05A 1H3JA 1W4YA 4BM4A 2YLJA 3FMUA 3M2EA 4JPLA 5SX2A 4FDQA 2GHKX 1SCHA 4CUOA 1SBMA 2X07A 4XV7A 5SYIA 3M2IA 4NVEA 4GEDA 2AS2A 5CIFA 1LGAA 4NVDA 3CCXA 1DSEA 1AA4A 4BLKA 3M2DA 2VNXX 1DSPA 5SXQA 3R99A 2RBTX 4NVJB 2CL4X 5JHZA 1MKRA 3M2CA 2V2EA 4JQNA 1RYCA 5D6MA 1DS4A 2Y5AA 1CCKA 2XJ6A 1ZBYA 1CCAA 4XV4A 2BOQA 2EURA 2GB8A 5ALAA 3M2GA 1ZBZA 3ZCHA 5SYVA 1CPDA 5SXWA 2CEPA 2ATJA 3M29A 2AS1A 1IYNA 4JMAA 1BEPA 1H5DA 5SYUA 3VLLA 3ZCYA 2VCSA 5JPRA 1MKQA 1S73A 4BLLA 4JQKA 3M8MA 3VLJA 3VLMA 1AEGA 5SX0B 2RBYX 1AETA 2ICVA 2AQDA 4XV6A 4NVGB 5SXSA 1BEMA 1H5LA 4BLXA 4OQ7A 4G05A 4CZNA 4JMVA 1AEKA 1H5FA 1ATJA 1STQA 1ARXA 1AENA 4BLZA 2B12A 1A2GA 5CIDA 1MN1A 2RBWX 2EUOA 1BEKA 2EUTA 1QO4A 1ARVA 5KQHA 2JTIA 4BLNA 1AEVA 3M2BA 6CCPA 4JQMA 3RIVA 1LYKA 4NVIB 5KQ0A 1AC8A 3M2HA 1DJ5A 5CIGA 4CZQA 2RC0X 1BESA 4NVFA 4NVOB 4JMWA 4CVJA 1H5JA 2E3BA 4NFGA 2GHDX 1AEEA 5CIBA
chains in the Genus database with same CATH superfamily
2ZCAA 4PAEA 1ML2A 4JPTA 1CYFA 3FJWA 4NVLA 1CCPA 1JDRA 3EXBA 1YYGA 2VKAA 3CCPA 3M2FA 1AEQA 2AS3A 1ARYA 4JB4A 1B82A 3WA8A 2E39A 2W23A 3R98A 1H5GA 5SYWA 4CCPA 4JM6A 3X16A 1CPGA 4A7MA 1AEJA 1BGPA 1YZPA 1S6VA 3E2OA 5L86A 1U2LA 6ATJA 1Z53A 3FKGA 1AEDA 2B0ZA 3FM1A 1AEOA 2VCFX 1ABVA 1SJ2A 1LY9A 2PCBA 1HCHA 1LLPA 5SXTA 4CVIA 1CPFA 2X08A 4BM2A 5H9FB 5CIHA 4BLYA 5ABNA 1H5CA 4BM3A 2BO5A 4P4QA 2XILA 1CCIA 2XIHA 2JMXA 2N18A 2RBUX 1U2KA 4JZAA 1DSGA 1BEJA 1H5EA 2XI6A 4NVBA 1U75A 5JHYA 4NVHB 1HSRA 2RC2X 2VO2X 3M5QA 3RIWA 4FEFA 4XVAA 5CICA 1APXA 1UB2A 5SX3A 2RC1X 5KQKA 5FNBA 1C8IA 2EUPA 5CCPA 1EBEA 5EJXA 1GZBA 1FHFA 3VLHA 2XJ8A 5KSFA 1H58A 1GX2A 5KQIA 7CCPA 1ARUA 1H5IA 1PA2A 2CCDA 1AEFA 1LY8A 1OAGA 5FNEA 2VCNA 5ABOA 5KQ3A 1CMUA 3M26A 4NVCA 1H57A 2AS6A 1MN2A 2GHCX 1GWTA 1OAFA 5CIEA 1ITKA 4H79A 2GHHX 4C50A 4BM1A 1SOGA 1QGJA 3ZCGA 1DJ1A 1CCBA 1KXMA 1JCIA 4BM0A 5SYXA 1BJ9A 1H5AA 1AEMA 5ABQA 1CCLA 4JMZA 1U74A 2EUQA 1CCJA 3HDLA 5SYJA 1DSOA 4CZOA 5JHXA 4CZPA 5L02A 4C51A 3M2AA 2B10A 5KQ2A 1AEBA 5SX6A 1KRJA 4NVMB 1CCGA 3Q3UA 3FM4A 1MK8A 4JM8A 5JQRA 1SDQA 2EUSA 5SYLA 2XIFA 3VLIA 4A6ZA 1CMTA 4JMTA 5SYYA 4CCXA 1GWUA 3UW8A 2VNZX 2EUNA 2Y6AA 3M25A 1LYCA 1QPAA 1U2JA 4A5GA 5SXXA 1GW2A 1H55A 3WXOA 2EUUA 1CCEA 5KSKA 4JPUA 5EJTA 1CK6A 4NVNB 1MNPA 1CMQA 2YCGA 1YZRA 4JN0A 5KQ6A 5SYHA 2GGNX 3VLKA 4H7AA 2BCNA 2WD4A 5SW6A 1B85A 2CCAA 4USCA 3E2NA 4JM9A 1H5MA 4JM5A 5CJHA 5AOGA 2CCPA 2RBZX 4JMSA 5SX0A 4A78A 3ATJA 3UT2A 1V0HX 4CZRA 3FM6A 1W4WA 2Y6BA 1YYDA 3WNUA 2B11A 2PCCA 5SW5A 3RRWA 2IA8A 1CMPA 2CYPA 1KOKA 2RBXX 2E3AA 1KXNA 1BEQA 7ATJA 5SX1A 4NVAA 2WSSS 4FCSA 2V23A 2GHEX 5SX7A 1BVAA 1B80A 2ANZA 1H5KA 4QYZB 1GWOA 1A2FA 4XV8A 5AL9A 5SXRA 4A71A 1ARPA 2RBVX 4FCNA 1AEHA 1ARWA 4NVKB 1AEUA 5SYKA 1DCCA 4ATJA 1CCCA 2XJ5A 2ZOPA 1AESA 1H5HA 1GZAA 3M23A 1CPEA 1KZMA 5AMMA 3X1LF 4XV5A 2AS4A 4JQJA 1AC4A 4JMBA 3M27A 3M28A 5SW4A 5L05A 1H3JA 1W4YA 4BM4A 2YLJA 3FMUA 3M2EA 4JPLA 5SX2A 4FDQA 2GHKX 1SCHA 4CUOA 1SBMA 4GKFA 2X07A 4XV7A 5SYIA 3M2IA 4NVEA 4GEDA 2AS2A 5CIFA 1LGAA 4NVDA 3CCXA 1DSEA 1AA4A 4BLKA 3M2DA 2VNXX 1DSPA 5SXQA 3R99A 2RBTX 4NVJB 2CL4X 5JHZA 1MKRA 3M2CA 2V2EA 4JQNA 1RYCA 5D6MA 1DS4A 2Y5AA 1CCKA 2XJ6A 1ZBYA 1CCAA 4U7UB 4XV4A 2BOQA 2EURA 2GB8A 5ALAA 3M2GA 1ZBZA 3ZCHA 5SYVA 1CPDA 5SXWA 2CEPA 2ATJA 3M29A 2AS1A 2OEBA 1IYNA 4JMAA 1BEPA 1H5DA 5SYUA 3VLLA 3ZCYA 2VCSA 5JPRA 1MKQA 1S73A 4BLLA 4JQKA 3M8MA 3VLJA 3VLMA 5H9EB 1AEGA 5SX0B 2RBYX 1AETA 2ICVA 2AQDA 4XV6A 4NVGB 5SXSA 1BEMA 1H5LA 4BLXA 4OQ7A 4G05A 5CD4J 4CZNA 4JMVA 1AEKA 1H5FA 1ATJA 1STQA 1ARXA 1AENA 4BLZA 2B12A 1A2GA 5CIDA 1MN1A 2RBWX 2EUOA 1BEKA 2EUTA 1QO4A 1ARVA 5KQHA 2JTIA 4BLNA 1AEVA 3M2BA 6CCPA 4JQMA 3RIVA 1LYKA 4NVIB 5KQ0A 1AC8A 3M2HA 1DJ5A 5CIGA 4CZQA 2RC0X 1BESA 4NVFA 4NVOB 4JMWA 4CVJA 2A7UB 1H5JA 2E3BA 4NFGA 2GHDX 1AEEA 5CIBA
chains in the Genus database with same CATH topology
2ZCAA 4PAEA 1ML2A 4JPTA 1CYFA 3FJWA 4NVLA 1CCPA 1JDRA 3EXBA 1YYGA 2VKAA 3CCPA 3M2FA 1AEQA 2AS3A 1ARYA 4JB4A 1B82A 3WA8A 2E39A 2W23A 3R98A 1H5GA 5SYWA 4CCPA 4JM6A 3X16A 1CPGA 4A7MA 1AEJA 1BGPA 1YZPA 1S6VA 3E2OA 5L86A 1U2LA 6ATJA 1Z53A 3FKGA 1AEDA 2B0ZA 3FM1A 1AEOA 2VCFX 1SJ2A 1LY9A 2PCBA 1HCHA 1LLPA 5SXTA 4CVIA 1CPFA 2X08A 4BM2A 5H9FB 5CIHA 4BLYA 5ABNA 1H5CA 4BM3A 4P4QA 2XILA 1CCIA 2XIHA 2N18A 2RBUX 1U2KA 4JZAA 1DSGA 1BEJA 1H5EA 2XI6A 4NVBA 1U75A 5JHYA 4NVHB 1HSRA 2RC2X 2VO2X 3M5QA 3RIWA 4FEFA 4XVAA 5CICA 1APXA 1UB2A 5SX3A 2RC1X 5KQKA 5FNBA 1C8IA 2EUPA 5CCPA 1EBEA 5EJXA 1GZBA 1FHFA 3VLHA 2XJ8A 5KSFA 1H58A 1GX2A 5KQIA 7CCPA 1ARUA 1H5IA 1PA2A 2CCDA 1AEFA 1LY8A 1OAGA 5FNEA 2VCNA 5ABOA 5KQ3A 1CMUA 3M26A 4NVCA 1H57A 2AS6A 1MN2A 2GHCX 1GWTA 1OAFA 5CIEA 1ITKA 4H79A 2GHHX 4C50A 4BM1A 1SOGA 1QGJA 3ZCGA 1DJ1A 1CCBA 1KXMA 1JCIA 4BM0A 5SYXA 1BJ9A 1H5AA 1AEMA 5ABQA 1CCLA 4JMZA 1U74A 2EUQA 1CCJA 3HDLA 5SYJA 1DSOA 4CZOA 5JHXA 4CZPA 5L02A 4C51A 3M2AA 2B10A 5KQ2A 1AEBA 5SX6A 1KRJA 4NVMB 1CCGA 3Q3UA 3FM4A 1MK8A 4JM8A 5JQRA 1SDQA 2EUSA 5SYLA 2XIFA 3VLIA 4A6ZA 1CMTA 4JMTA 5SYYA 4CCXA 1GWUA 3UW8A 2VNZX 2EUNA 2Y6AA 3M25A 1LYCA 1QPAA 1U2JA 4A5GA 5SXXA 1GW2A 1H55A 3WXOA 2EUUA 1CCEA 5KSKA 4JPUA 5EJTA 1CK6A 4NVNB 1MNPA 1CMQA 2YCGA 1YZRA 4JN0A 5KQ6A 5SYHA 2GGNX 3VLKA 4H7AA 2BCNA 2WD4A 5SW6A 1B85A 2CCAA 4USCA 3E2NA 4JM9A 1H5MA 4JM5A 5CJHA 5AOGA 2CCPA 2RBZX 4JMSA 5SX0A 4A78A 3ATJA 3UT2A 1V0HX 4CZRA 3FM6A 1W4WA 2Y6BA 1YYDA 3WNUA 2B11A 2PCCA 5SW5A 3RRWA 2IA8A 1CMPA 2CYPA 1KOKA 2RBXX 2E3AA 1KXNA 1BEQA 7ATJA 5SX1A 4NVAA 4FCSA 2V23A 2GHEX 5SX7A 1BVAA 1B80A 2ANZA 1H5KA 4QYZB 1GWOA 1A2FA 4XV8A 5AL9A 5SXRA 4A71A 1ARPA 2RBVX 4FCNA 1AEHA 1ARWA 4NVKB 1AEUA 5SYKA 1DCCA 4ATJA 1CCCA 2XJ5A 1AESA 1H5HA 1GZAA 3M23A 1CPEA 1KZMA 5AMMA 4XV5A 2AS4A 4JQJA 1AC4A 4JMBA 3M27A 3M28A 5SW4A 5L05A 1H3JA 1W4YA 4BM4A 2YLJA 3FMUA 3M2EA 4JPLA 5SX2A 4FDQA 2GHKX 1SCHA 4CUOA 1SBMA 2X07A 4XV7A 5SYIA 3M2IA 4NVEA 4GEDA 2AS2A 5CIFA 1LGAA 4NVDA 3CCXA 1DSEA 1AA4A 4BLKA 3M2DA 2VNXX 1DSPA 5SXQA 3R99A 2RBTX 4NVJB 2CL4X 5JHZA 1MKRA 3M2CA 2V2EA 4JQNA 1RYCA 5D6MA 1DS4A 2Y5AA 1CCKA 2XJ6A 1ZBYA 1CCAA 4U7UB 4XV4A 2BOQA 2EURA 2GB8A 5ALAA 3M2GA 1ZBZA 3ZCHA 5SYVA 1CPDA 5SXWA 2CEPA 2ATJA 3M29A 2AS1A 1IYNA 4JMAA 1BEPA 1H5DA 5SYUA 3VLLA 3ZCYA 2VCSA 5JPRA 1MKQA 1S73A 4BLLA 4JQKA 3M8MA 3VLJA 3VLMA 5H9EB 1AEGA 5SX0B 2RBYX 1AETA 2ICVA 2AQDA 4XV6A 4NVGB 5SXSA 1BEMA 1H5LA 4BLXA 4OQ7A 4G05A 5CD4J 4CZNA 4JMVA 1AEKA 1H5FA 1ATJA 1STQA 1ARXA 1AENA 4BLZA 2B12A 1A2GA 5CIDA 1MN1A 2RBWX 2EUOA 1BEKA 2EUTA 1QO4A 1ARVA 5KQHA 2JTIA 4BLNA 1AEVA 3M2BA 6CCPA 4JQMA 3RIVA 1LYKA 4NVIB 5KQ0A 1AC8A 3M2HA 1DJ5A 5CIGA 4CZQA 2RC0X 1BESA 4NVFA 4NVOB 4JMWA 4CVJA 1H5JA 2E3BA 4NFGA 2GHDX 1AEEA 5CIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PAE A;  1ML2 A;  4JPT A;  1CYF A;  3FJW A;  4NVL A;  1CCP A;  1JDR A;  3EXB A;  1YYG A;  2VKA A;  3CCP A;  3M2F A;  1AEQ A;  2AS3 A;  1ARY A;  4JB4 A;  1B82 A;  2E39 A;  2W23 A;  3R98 A;  1H5G A;  5SYW A;  4CCP A;  4JM6 A;  3X16 A;  1CPG A;  4A7M A;  1AEJ A;  1BGP A;  1YZP A;  1S6V A;  3E2O A;  5L86 A;  1U2L A;  6ATJ A;  1Z53 A;  3FKG A;  1AED A;  2B0Z A;  3FM1 A;  1AEO A;  2VCF X;  1SJ2 A;  1LY9 A;  2PCB A;  1HCH A;  1LLP A;  5SXT A;  4CVI A;  1CPF A;  2X08 A;  4BM2 A;  5CIH A;  4BLY A;  5ABN A;  1H5C A;  4BM3 A;  4P4Q A;  2XIL A;  1CCI A;  2XIH A;  2N18 A;  2RBU X;  1U2K A;  1DSG A;  1BEJ A;  1H5E A;  2XI6 A;  4NVB A;  1U75 A;  5JHY A;  4NVH B;  1HSR A;  2RC2 X;  2VO2 X;  3M5Q A;  3RIW A;  4FEF A;  4XVA A;  5CIC A;  1APX A;  1UB2 A;  5SX3 A;  2RC1 X;  5KQK A;  5FNB A;  1C8I A;  2EUP A;  5CCP A;  1EBE A;  5EJX A;  1GZB A;  1FHF A;  3VLH A;  2XJ8 A;  5KSF A;  1H58 A;  1GX2 A;  5KQI A;  7CCP A;  1ARU A;  1H5I A;  1PA2 A;  2CCD A;  1AEF A;  1LY8 A;  1OAG A;  5FNE A;  2VCN A;  5ABO A;  5KQ3 A;  1CMU A;  3M26 A;  4NVC A;  1H57 A;  2AS6 A;  1MN2 A;  2GHC X;  1GWT A;  1OAF A;  5CIE A;  1ITK A;  2GHH X;  4C50 A;  4BM1 A;  1SOG A;  1QGJ A;  3ZCG A;  1DJ1 A;  1CCB A;  1KXM A;  1JCI A;  4BM0 A;  5SYX A;  1BJ9 A;  1H5A A;  1AEM A;  5ABQ A;  1CCL A;  4JMZ A;  1U74 A;  2EUQ A;  1CCJ A;  3HDL A;  5SYJ A;  1DSO A;  4CZO A;  5JHX A;  4CZP A;  5L02 A;  4C51 A;  3M2A A;  2B10 A;  5KQ2 A;  1AEB A;  5SX6 A;  1KRJ A;  4NVM B;  1CCG A;  3Q3U A;  3FM4 A;  1MK8 A;  4JM8 A;  5JQR A;  1SDQ A;  2EUS A;  5SYL A;  2XIF A;  3VLI A;  4A6Z A;  1CMT A;  4JMT A;  5SYY A;  4CCX A;  1GWU A;  3UW8 A;  2VNZ X;  2EUN A;  2Y6A A;  3M25 A;  1LYC A;  1QPA A;  1U2J A;  4A5G A;  5SXX A;  1GW2 A;  1H55 A;  3WXO A;  2EUU A;  1CCE A;  5KSK A;  4JPU A;  5EJT A;  1CK6 A;  4NVN B;  1MNP A;  1CMQ A;  2YCG A;  1YZR A;  4JN0 A;  5KQ6 A;  5SYH A;  2GGN X;  3VLK A;  2BCN A;  2WD4 A;  5SW6 A;  1B85 A;  2CCA A;  4USC A;  3E2N A;  4JM9 A;  1H5M A;  4JM5 A;  5CJH A;  5AOG A;  2CCP A;  2RBZ X;  4JMS A;  5SX0 A;  4A78 A;  3ATJ A;  3UT2 A;  1V0H X;  4CZR A;  3FM6 A;  1W4W A;  2Y6B A;  1YYD A;  3WNU A;  2B11 A;  2PCC A;  5SW5 A;  3RRW A;  2IA8 A;  1CMP A;  2CYP A;  1KOK A;  2RBX X;  2E3A A;  1KXN A;  1BEQ A;  7ATJ A;  5SX1 A;  4NVA A;  4FCS A;  2V23 A;  2GHE X;  5SX7 A;  1BVA A;  1B80 A;  2ANZ A;  1H5K A;  1GWO A;  1A2F A;  4XV8 A;  5AL9 A;  5SXR A;  4A71 A;  1ARP A;  2RBV X;  4FCN A;  1AEH A;  1ARW A;  4NVK B;  1AEU A;  5SYK A;  1DCC A;  4ATJ A;  1CCC A;  2XJ5 A;  1AES A;  1H5H A;  1GZA A;  3M23 A;  1CPE A;  1KZM A;  5AMM A;  4XV5 A;  2AS4 A;  4JQJ A;  1AC4 A;  4JMB A;  3M27 A;  3M28 A;  5SW4 A;  5L05 A;  1H3J A;  1W4Y A;  4BM4 A;  2YLJ A;  3FMU A;  3M2E A;  4JPL A;  5SX2 A;  4FDQ A;  2GHK X;  1SCH A;  4CUO A;  1SBM A;  2X07 A;  4XV7 A;  5SYI A;  3M2I A;  4NVE A;  4GED A;  2AS2 A;  5CIF A;  1LGA A;  4NVD A;  3CCX A;  1DSE A;  1AA4 A;  4BLK A;  3M2D A;  2VNX X;  1DSP A;  5SXQ A;  3R99 A;  2RBT X;  4NVJ B;  2CL4 X;  5JHZ A;  1MKR A;  3M2C A;  2V2E A;  4JQN A;  1RYC A;  5D6M A;  1DS4 A;  2Y5A A;  1CCK A;  2XJ6 A;  1ZBY A;  1CCA A;  4XV4 A;  2BOQ A;  2EUR A;  2GB8 A;  5ALA A;  3M2G A;  1ZBZ A;  3ZCH A;  5SYV A;  1CPD A;  5SXW A;  2CEP A;  2ATJ A;  3M29 A;  2AS1 A;  1IYN A;  4JMA A;  1BEP A;  1H5D A;  5SYU A;  3VLL A;  3ZCY A;  2VCS A;  5JPR A;  1MKQ A;  1S73 A;  4BLL A;  4JQK A;  3M8M A;  3VLJ A;  3VLM A;  1AEG A;  5SX0 B;  2RBY X;  1AET A;  2ICV A;  2AQD A;  4XV6 A;  4NVG B;  5SXS A;  1BEM A;  1H5L A;  4BLX A;  4OQ7 A;  4G05 A;  4CZN A;  4JMV A;  1AEK A;  1H5F A;  1ATJ A;  1STQ A;  1ARX A;  1AEN A;  4BLZ A;  2B12 A;  1A2G A;  5CID A;  1MN1 A;  2RBW X;  2EUO A;  1BEK A;  2EUT A;  1QO4 A;  1ARV A;  5KQH A;  2JTI A;  4BLN A;  1AEV A;  3M2B A;  6CCP A;  4JQM A;  3RIV A;  1LYK A;  4NVI B;  5KQ0 A;  1AC8 A;  3M2H A;  1DJ5 A;  5CIG A;  4CZQ A;  2RC0 X;  1BES A;  4NVF A;  4NVO B;  4JMW A;  4CVJ A;  1H5J A;  2E3B A;  4NFG A;  2GHD X;  1AEE A;  5CIB A; 
#chains in the Genus database with same CATH topology
 2ZCA A;  4PAE A;  1ML2 A;  4JPT A;  1CYF A;  3FJW A;  4NVL A;  1CCP A;  1JDR A;  3EXB A;  1YYG A;  2VKA A;  3CCP A;  3M2F A;  1AEQ A;  2AS3 A;  1ARY A;  4JB4 A;  1B82 A;  3WA8 A;  2E39 A;  2W23 A;  3R98 A;  1H5G A;  5SYW A;  4CCP A;  4JM6 A;  3X16 A;  1CPG A;  4A7M A;  1AEJ A;  1BGP A;  1YZP A;  1S6V A;  3E2O A;  5L86 A;  1U2L A;  6ATJ A;  1Z53 A;  3FKG A;  1AED A;  2B0Z A;  3FM1 A;  1AEO A;  2VCF X;  1ABV A;  1SJ2 A;  1LY9 A;  2PCB A;  1HCH A;  1LLP A;  5SXT A;  4CVI A;  1CPF A;  2X08 A;  4BM2 A;  5H9F B;  5CIH A;  4BLY A;  5ABN A;  1H5C A;  4BM3 A;  2BO5 A;  4P4Q A;  2XIL A;  1CCI A;  2XIH A;  2JMX A;  2N18 A;  2RBU X;  1U2K A;  4JZA A;  1DSG A;  1BEJ A;  1H5E A;  2XI6 A;  4NVB A;  1U75 A;  5JHY A;  4NVH B;  1HSR A;  2RC2 X;  2VO2 X;  3M5Q A;  3RIW A;  4FEF A;  4XVA A;  5CIC A;  1APX A;  1UB2 A;  5SX3 A;  2RC1 X;  5KQK A;  5FNB A;  1C8I A;  2EUP A;  5CCP A;  1EBE A;  5EJX A;  1GZB A;  1FHF A;  3VLH A;  2XJ8 A;  5KSF A;  1H58 A;  1GX2 A;  5KQI A;  7CCP A;  1ARU A;  1H5I A;  1PA2 A;  2CCD A;  1AEF A;  1LY8 A;  1OAG A;  5FNE A;  2VCN A;  5ABO A;  5KQ3 A;  1CMU A;  3M26 A;  4NVC A;  1H57 A;  2AS6 A;  1MN2 A;  2GHC X;  1GWT A;  1OAF A;  5CIE A;  1ITK A;  4H79 A;  2GHH X;  4C50 A;  4BM1 A;  1SOG A;  1QGJ A;  3ZCG A;  1DJ1 A;  1CCB A;  1KXM A;  1JCI A;  4BM0 A;  5SYX A;  1BJ9 A;  1H5A A;  1AEM A;  5ABQ A;  1CCL A;  4JMZ A;  1U74 A;  2EUQ A;  1CCJ A;  3HDL A;  5SYJ A;  1DSO A;  4CZO A;  5JHX A;  4CZP A;  5L02 A;  4C51 A;  3M2A A;  2B10 A;  5KQ2 A;  1AEB A;  5SX6 A;  1KRJ A;  4NVM B;  1CCG A;  3Q3U A;  3FM4 A;  1MK8 A;  4JM8 A;  5JQR A;  1SDQ A;  2EUS A;  5SYL A;  2XIF A;  3VLI A;  4A6Z A;  1CMT A;  4JMT A;  5SYY A;  4CCX A;  1GWU A;  3UW8 A;  2VNZ X;  2EUN A;  2Y6A A;  3M25 A;  1LYC A;  1QPA A;  1U2J A;  4A5G A;  5SXX A;  1GW2 A;  1H55 A;  3WXO A;  2EUU A;  1CCE A;  5KSK A;  4JPU A;  5EJT A;  1CK6 A;  4NVN B;  1MNP A;  1CMQ A;  2YCG A;  1YZR A;  4JN0 A;  5KQ6 A;  5SYH A;  2GGN X;  3VLK A;  4H7A A;  2BCN A;  2WD4 A;  5SW6 A;  1B85 A;  2CCA A;  4USC A;  3E2N A;  4JM9 A;  1H5M A;  4JM5 A;  5CJH A;  5AOG A;  2CCP A;  2RBZ X;  4JMS A;  5SX0 A;  4A78 A;  3ATJ A;  3UT2 A;  1V0H X;  4CZR A;  3FM6 A;  1W4W A;  2Y6B A;  1YYD A;  3WNU A;  2B11 A;  2PCC A;  5SW5 A;  3RRW A;  2IA8 A;  1CMP A;  2CYP A;  1KOK A;  2RBX X;  2E3A A;  1KXN A;  1BEQ A;  7ATJ A;  5SX1 A;  4NVA A;  2WSS S;  4FCS A;  2V23 A;  2GHE X;  5SX7 A;  1BVA A;  1B80 A;  2ANZ A;  1H5K A;  4QYZ B;  1GWO A;  1A2F A;  4XV8 A;  5AL9 A;  5SXR A;  4A71 A;  1ARP A;  2RBV X;  4FCN A;  1AEH A;  1ARW A;  4NVK B;  1AEU A;  5SYK A;  1DCC A;  4ATJ A;  1CCC A;  2XJ5 A;  2ZOP A;  1AES A;  1H5H A;  1GZA A;  3M23 A;  1CPE A;  1KZM A;  5AMM A;  3X1L F;  4XV5 A;  2AS4 A;  4JQJ A;  1AC4 A;  4JMB A;  3M27 A;  3M28 A;  5SW4 A;  5L05 A;  1H3J A;  1W4Y A;  4BM4 A;  2YLJ A;  3FMU A;  3M2E A;  4JPL A;  5SX2 A;  4FDQ A;  2GHK X;  1SCH A;  4CUO A;  1SBM A;  4GKF A;  2X07 A;  4XV7 A;  5SYI A;  3M2I A;  4NVE A;  4GED A;  2AS2 A;  5CIF A;  1LGA A;  4NVD A;  3CCX A;  1DSE A;  1AA4 A;  4BLK A;  3M2D A;  2VNX X;  1DSP A;  5SXQ A;  3R99 A;  2RBT X;  4NVJ B;  2CL4 X;  5JHZ A;  1MKR A;  3M2C A;  2V2E A;  4JQN A;  1RYC A;  5D6M A;  1DS4 A;  2Y5A A;  1CCK A;  2XJ6 A;  1ZBY A;  1CCA A;  4U7U B;  4XV4 A;  2BOQ A;  2EUR A;  2GB8 A;  5ALA A;  3M2G A;  1ZBZ A;  3ZCH A;  5SYV A;  1CPD A;  5SXW A;  2CEP A;  2ATJ A;  3M29 A;  2AS1 A;  2OEB A;  1IYN A;  4JMA A;  1BEP A;  1H5D A;  5SYU A;  3VLL A;  3ZCY A;  2VCS A;  5JPR A;  1MKQ A;  1S73 A;  4BLL A;  4JQK A;  3M8M A;  3VLJ A;  3VLM A;  5H9E B;  1AEG A;  5SX0 B;  2RBY X;  1AET A;  2ICV A;  2AQD A;  4XV6 A;  4NVG B;  5SXS A;  1BEM A;  1H5L A;  4BLX A;  4OQ7 A;  4G05 A;  5CD4 J;  4CZN A;  4JMV A;  1AEK A;  1H5F A;  1ATJ A;  1STQ A;  1ARX A;  1AEN A;  4BLZ A;  2B12 A;  1A2G A;  5CID A;  1MN1 A;  2RBW X;  2EUO A;  1BEK A;  2EUT A;  1QO4 A;  1ARV A;  5KQH A;  2JTI A;  4BLN A;  1AEV A;  3M2B A;  6CCP A;  4JQM A;  3RIV A;  1LYK A;  4NVI B;  5KQ0 A;  1AC8 A;  3M2H A;  1DJ5 A;  5CIG A;  4CZQ A;  2RC0 X;  1BES A;  4NVF A;  4NVO B;  4JMW A;  4CVJ A;  2A7U B;  1H5J A;  2E3B A;  4NFG A;  2GHD X;  1AEE A;  5CIB A; 
#chains in the Genus database with same CATH homology
 2ZCA A;  4PAE A;  1ML2 A;  4JPT A;  1CYF A;  3FJW A;  4NVL A;  1CCP A;  1JDR A;  3EXB A;  1YYG A;  2VKA A;  3CCP A;  3M2F A;  1AEQ A;  2AS3 A;  1ARY A;  4JB4 A;  1B82 A;  3WA8 A;  2E39 A;  2W23 A;  3R98 A;  1H5G A;  5SYW A;  4CCP A;  4JM6 A;  3X16 A;  1CPG A;  4A7M A;  1AEJ A;  1BGP A;  1YZP A;  1S6V A;  3E2O A;  5L86 A;  1U2L A;  6ATJ A;  1Z53 A;  3FKG A;  1AED A;  2B0Z A;  3FM1 A;  1AEO A;  2VCF X;  1SJ2 A;  1LY9 A;  2PCB A;  1HCH A;  1LLP A;  5SXT A;  4CVI A;  1CPF A;  2X08 A;  4BM2 A;  5H9F B;  5CIH A;  4BLY A;  5ABN A;  1H5C A;  4BM3 A;  4P4Q A;  2XIL A;  1CCI A;  2XIH A;  2N18 A;  2RBU X;  1U2K A;  4JZA A;  1DSG A;  1BEJ A;  1H5E A;  2XI6 A;  4NVB A;  1U75 A;  5JHY A;  4NVH B;  1HSR A;  2RC2 X;  2VO2 X;  3M5Q A;  3RIW A;  4FEF A;  4XVA A;  5CIC A;  1APX A;  1UB2 A;  5SX3 A;  2RC1 X;  5KQK A;  5FNB A;  1C8I A;  2EUP A;  5CCP A;  1EBE A;  5EJX A;  1GZB A;  1FHF A;  3VLH A;  2XJ8 A;  5KSF A;  1H58 A;  1GX2 A;  5KQI A;  7CCP A;  1ARU A;  1H5I A;  1PA2 A;  2CCD A;  1AEF A;  1LY8 A;  1OAG A;  5FNE A;  2VCN A;  5ABO A;  5KQ3 A;  1CMU A;  3M26 A;  4NVC A;  1H57 A;  2AS6 A;  1MN2 A;  2GHC X;  1GWT A;  1OAF A;  5CIE A;  1ITK A;  4H79 A;  2GHH X;  4C50 A;  4BM1 A;  1SOG A;  1QGJ A;  3ZCG A;  1DJ1 A;  1CCB A;  1KXM A;  1JCI A;  4BM0 A;  5SYX A;  1BJ9 A;  1H5A A;  1AEM A;  5ABQ A;  1CCL A;  4JMZ A;  1U74 A;  2EUQ A;  1CCJ A;  3HDL A;  5SYJ A;  1DSO A;  4CZO A;  5JHX A;  4CZP A;  5L02 A;  4C51 A;  3M2A A;  2B10 A;  5KQ2 A;  1AEB A;  5SX6 A;  1KRJ A;  4NVM B;  1CCG A;  3Q3U A;  3FM4 A;  1MK8 A;  4JM8 A;  5JQR A;  1SDQ A;  2EUS A;  5SYL A;  2XIF A;  3VLI A;  4A6Z A;  1CMT A;  4JMT A;  5SYY A;  4CCX A;  1GWU A;  3UW8 A;  2VNZ X;  2EUN A;  2Y6A A;  3M25 A;  1LYC A;  1QPA A;  1U2J A;  4A5G A;  5SXX A;  1GW2 A;  1H55 A;  3WXO A;  2EUU A;  1CCE A;  5KSK A;  4JPU A;  5EJT A;  1CK6 A;  4NVN B;  1MNP A;  1CMQ A;  2YCG A;  1YZR A;  4JN0 A;  5KQ6 A;  5SYH A;  2GGN X;  3VLK A;  4H7A A;  2BCN A;  2WD4 A;  5SW6 A;  1B85 A;  2CCA A;  4USC A;  3E2N A;  4JM9 A;  1H5M A;  4JM5 A;  5CJH A;  5AOG A;  2CCP A;  2RBZ X;  4JMS A;  5SX0 A;  4A78 A;  3ATJ A;  3UT2 A;  1V0H X;  4CZR A;  3FM6 A;  1W4W A;  2Y6B A;  1YYD A;  3WNU A;  2B11 A;  2PCC A;  5SW5 A;  3RRW A;  2IA8 A;  1CMP A;  2CYP A;  1KOK A;  2RBX X;  2E3A A;  1KXN A;  1BEQ A;  7ATJ A;  5SX1 A;  4NVA A;  4FCS A;  2V23 A;  2GHE X;  5SX7 A;  1BVA A;  1B80 A;  2ANZ A;  1H5K A;  4QYZ B;  1GWO A;  1A2F A;  4XV8 A;  5AL9 A;  5SXR A;  4A71 A;  1ARP A;  2RBV X;  4FCN A;  1AEH A;  1ARW A;  4NVK B;  1AEU A;  5SYK A;  1DCC A;  4ATJ A;  1CCC A;  2XJ5 A;  1AES A;  1H5H A;  1GZA A;  3M23 A;  1CPE A;  1KZM A;  5AMM A;  4XV5 A;  2AS4 A;  4JQJ A;  1AC4 A;  4JMB A;  3M27 A;  3M28 A;  5SW4 A;  5L05 A;  1H3J A;  1W4Y A;  4BM4 A;  2YLJ A;  3FMU A;  3M2E A;  4JPL A;  5SX2 A;  4FDQ A;  2GHK X;  1SCH A;  4CUO A;  1SBM A;  2X07 A;  4XV7 A;  5SYI A;  3M2I A;  4NVE A;  4GED A;  2AS2 A;  5CIF A;  1LGA A;  4NVD A;  3CCX A;  1DSE A;  1AA4 A;  4BLK A;  3M2D A;  2VNX X;  1DSP A;  5SXQ A;  3R99 A;  2RBT X;  4NVJ B;  2CL4 X;  5JHZ A;  1MKR A;  3M2C A;  2V2E A;  4JQN A;  1RYC A;  5D6M A;  1DS4 A;  2Y5A A;  1CCK A;  2XJ6 A;  1ZBY A;  1CCA A;  4U7U B;  4XV4 A;  2BOQ A;  2EUR A;  2GB8 A;  5ALA A;  3M2G A;  1ZBZ A;  3ZCH A;  5SYV A;  1CPD A;  5SXW A;  2CEP A;  2ATJ A;  3M29 A;  2AS1 A;  1IYN A;  4JMA A;  1BEP A;  1H5D A;  5SYU A;  3VLL A;  3ZCY A;  2VCS A;  5JPR A;  1MKQ A;  1S73 A;  4BLL A;  4JQK A;  3M8M A;  3VLJ A;  3VLM A;  5H9E B;  1AEG A;  5SX0 B;  2RBY X;  1AET A;  2ICV A;  2AQD A;  4XV6 A;  4NVG B;  5SXS A;  1BEM A;  1H5L A;  4BLX A;  4OQ7 A;  4G05 A;  5CD4 J;  4CZN A;  4JMV A;  1AEK A;  1H5F A;  1ATJ A;  1STQ A;  1ARX A;  1AEN A;  4BLZ A;  2B12 A;  1A2G A;  5CID A;  1MN1 A;  2RBW X;  2EUO A;  1BEK A;  2EUT A;  1QO4 A;  1ARV A;  5KQH A;  2JTI A;  4BLN A;  1AEV A;  3M2B A;  6CCP A;  4JQM A;  3RIV A;  1LYK A;  4NVI B;  5KQ0 A;  1AC8 A;  3M2H A;  1DJ5 A;  5CIG A;  4CZQ A;  2RC0 X;  1BES A;  4NVF A;  4NVO B;  4JMW A;  4CVJ A;  1H5J A;  2E3B A;  4NFG A;  2GHD X;  1AEE A;  5CIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...