4CZPA

Crystal structure of the extralong fungal manganese peroxidase from ceriporiopsis subvermispora in complex with manganese (anomalous data)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
367
structure length
367
Chain Sequence
PTAVCSDGTRVSNAVCCDFVSLGQDLQSMVLQGDCGEDAHEIIRLTFHDAVAISRKLGPSAGGGADGSMLLFPLVEPEFAASNGIDDSVNNLIPFLSLHPTISAGDLVQFAGAVALSNCPGAPRVQFLAGRPNHTIAAIDGLIPEPQDNVTSILERFDDAGGFTPFEVVSLLASHTIARADKVDPTLDAAPFDTTPFTFDSQIFLEVLLKGVGFPGLDNNTGEVSSPLPLGDTSTGGKDTGLMRLQSDFALAHDPRTACFWQGFVDQQEFMSQSFASAFAKLAVLGHNTDDLIDCSEVVPVPKPAVDKPTTFPATTGPQDLELSCLAERFPTLSVDPGAQETLIPHCSDGLENCTSVQFSGPATDSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Implications of the C-Terminal Tail in the Catalytic and Stability Properties of Manganese Peroxidases from Ligninolytic Fungi
pubmed doi rcsb
molecule keywords EXTRALONG MANGANESE PEROXIDASE
molecule tags Oxidoreductase
source organism Ceriporiopsis subvermispora
total genus 113
structure length 367
sequence length 367
ec nomenclature ec 1.11.1.13: Manganese peroxidase.
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.420.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 2 Peroxidase, domain 2 4czpA02
1.10.520.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 Peroxidase; domain 1 4czpA01
4NVCA 1CCPA 1H5MA 5L86A 4OQ7A 1BJ9A 1CCAA 4CZRA 2VO2X 3M5QA 1GWOA 1BEPA 1CPGA 1DSEA 1SBMA 4JPUA 3M2GA 1A2GA 1YYGA 4BLKA 5SX2A 1W4WA 2B0ZA 5SXSA 4ATJA 4XV5A 2XJ8A 3M2HA 5SW5A 2B10A 5ABNA 3VLIA 1A2FA 4JMBA 2EUPA 1UB2A 1MNPA 1EBEA 1H55A 3WXOA 5SX1A 3R99A 2EUQA 1ML2A 5CJHA 4C51A 1YYDA 3VLLA 1ARXA 2YCGA 5SX6A 1AEQA 1U2JA 1S6VA 2E3BA 3UT2A 1DS4A 2BOQA 1CMTA 1GWUA 2XILA 5SYHA 1H5AA 4JMTA 5JHXA 1LY9A 1B80A 4JM8A 1BEJA 5CICA 2GB8A 3ZCGA 1YZPA 4CVIA 4NVLA 1B85A 1QO4A 1AEJA 2RC0X 1BGPA 5CCPA 2XJ5A 1H5KA 5AOGA 4A7MA 2AS2A 1AEGA 1AA4A 1DSOA 4NVFA 3ZCYA 2CCAA 1DSPA 3M25A 3ZCHA 4XV4A 4CZOA 2XJ6A 1AESA 4XV8A 5CIHA 2PCBA 3WNUA 1CCCA 2RBXX 2ATJA 2CCDA 5EJTA 1AC8A 1DJ1A 1FHFA 2ICVA 1HCHA 4BLXA 5JHZA 3FM6A 4CZNA 4CCXA 1GZAA 2Y5AA 2WD4A 4NVHB 1QPAA 5SYKA 1ARVA 1H5HA 1LY8A 1U74A 1CPEA 1CCJA 1AEBA 2E39A 1H5GA 2XIHA 1S73A 3VLMA 2CEPA 5JQRA 5SXRA 1KXNA 3ATJA 2Y6AA 1CCIA 2E3AA 5L05A 5SYXA 1CCKA 2RC2X 1IYNA 2VNXX 1MKRA 3RRWA 2RBWX 1BEMA 5KQKA 3M23A 3M29A 1YZRA 5SYUA 1AEEA 2EUSA 1CCEA 2GHEX 1CCGA 1KRJA 5ABOA 4NVEA 4JQJA 5KSFA 1KOKA 1MN1A 1STQA 1KXMA 1DCCA 1H5EA 1U2LA 3FJWA 2X07A 1DSGA 4JPTA 2ANZA 7ATJA 1ZBYA 4CZPA 1LYKA 2V2EA 1DJ5A 2VKAA 5SW4A 1CMQA 2AQDA 1AEMA 1AEUA 5AMMA 5CIGA 1BESA 2JTIA 2RBZX 4C50A 3M2IA 4NVDA 4BLLA 2V23A 6ATJA 2RBUX 5KQHA 4NVGB 2VCSA 7CCPA 5SXQA 4NVNB 3FM1A 4XV6A 1AEKA 5KQ0A 1U75A 1H3JA 2CYPA 4FEFA 4CCPA 1CK6A 1Z53A 5KQ2A 5D6MA 1H58A 1ATJA 5JHYA 4XVAA 4NVMB 2GHDX 3UW8A 3CCXA 4GEDA 4JM6A 4BLYA 2VNZX 1HSRA 3FMUA 1CPDA 1QGJA 4A78A 1AEVA 2EUOA 5KQIA 1GX2A 4BM4A 4BM3A 1V0HX 1CMPA 1OAFA 5SX0B 3M2EA 4NVJB 4JMWA 1SCHA 4BM0A 4JM9A 1JCIA 1LYCA 1BEKA 1B82A 2EURA 5SXWA 4JMZA 3M28A 3M8MA 1U2KA 4JQNA 2B11A 1ZBZA 2GHHX 2RBTX 5SYIA 4JMAA 3M2DA 1H5IA 5CIDA 5ABQA 3E2NA 3M2FA 2W23A 2Y6BA 3FKGA 2GHKX 3M2AA 1H5CA 1AENA 1KZMA 5KSKA 1C8IA 5SYWA 5SYVA 2YLJA 4JB4A 4A6ZA 1PA2A 1ARUA 1ARYA 1APXA 1W4YA 5ALAA 5FNBA 2RC1X 3HDLA 4XV7A 4CZQA 1CPFA 2CCPA 1AEDA 1H57A 2RBVX 4P4QA 5FNEA 2EUNA 6CCPA 2GGNX 1AEHA 2N18A 3VLKA 3VLJA 2AS4A 4FDQA 2XI6A 3E2OA 1ARPA 1BVAA 1SJ2A 3RIVA 4CVJA 4JMSA 4NVAA 3RIWA 5SYJA 4JMVA 4FCNA 4BM2A 4A71A 4NVOB 1AC4A 1LGAA 2BCNA 1H5LA 4USCA 3CCPA 2AS3A 4FCSA 5JPRA 5SYLA 5CIBA 4JM5A 2B12A 5SX0A 1AEOA 5CIFA 4CUOA 2IA8A 3M26A 1MN2A 1SOGA 2AS6A 4A5GA 5SYYA 4JN0A 3X16A 3M2CA 1RYCA 2VCNA 3M2BA 4BLZA 1CYFA 2RBYX 5KQ3A 1SDQA 4PAEA 5SX3A 2PCCA 5AL9A 1AEFA 3VLHA 1OAGA 4BLNA 5SXXA 1GW2A 2CL4X 3FM4A 3EXBA 4NVBA 2EUTA 2GHCX 5L02A 1H5DA 1BEQA 1MKQA 1CMUA 1MK8A 4JQKA 1H5JA 4NVIB 2XIFA 5KQ6A 4JPLA 4NVKB 3M27A 5SX7A 2VCFX 4NFGA 4G05A 5CIEA 1LLPA 1GZBA 1ARWA 1H5FA 4JQMA 4BM1A 1JDRA 2EUUA 3R98A 5SW6A 1CCLA 2X08A 5SXTA 1GWTA 3Q3UA 1ITKA 5EJXA 1AETA 1CCBA 2AS1A
chains in the Genus database with same CATH superfamily
4NVCA 1CCPA 1H5MA 5L86A 4OQ7A 1BJ9A 1CCAA 4CZRA 2VO2X 3M5QA 1GWOA 1BEPA 1CPGA 1DSEA 1SBMA 4JPUA 3M2GA 1A2GA 1YYGA 4BLKA 5SX2A 1W4WA 2B0ZA 5SXSA 4ATJA 4XV5A 2XJ8A 3M2HA 5SW5A 2B10A 5ABNA 3VLIA 1A2FA 4JMBA 2EUPA 1UB2A 1ABVA 1MNPA 1EBEA 1H55A 3WXOA 5SX1A 3R99A 2EUQA 1ML2A 5CJHA 4C51A 1YYDA 3VLLA 2BO5A 1ARXA 2YCGA 5SX6A 1AEQA 1U2JA 1S6VA 2E3BA 3UT2A 1DS4A 2BOQA 1CMTA 1GWUA 2XILA 5SYHA 1H5AA 4JMTA 5JHXA 1LY9A 1B80A 4JM8A 1BEJA 5CICA 2GB8A 3ZCGA 1YZPA 4CVIA 4NVLA 1B85A 1QO4A 1AEJA 2RC0X 1BGPA 5CCPA 2XJ5A 1H5KA 5AOGA 4A7MA 2AS2A 1AEGA 1AA4A 1DSOA 4NVFA 3ZCYA 2CCAA 4H79A 1DSPA 3M25A 3ZCHA 4XV4A 4CZOA 2XJ6A 1AESA 4XV8A 5CIHA 2PCBA 3WNUA 1CCCA 2RBXX 2ATJA 2CCDA 5EJTA 1AC8A 1DJ1A 1FHFA 2ICVA 1HCHA 4BLXA 5JHZA 3FM6A 5H9FB 4CZNA 4CCXA 1GZAA 2Y5AA 2WD4A 4NVHB 2OEBA 1QPAA 5SYKA 2ZCAA 1ARVA 1H5HA 1LY8A 1U74A 1CPEA 1CCJA 1AEBA 2E39A 1H5GA 2XIHA 1S73A 3VLMA 2CEPA 5JQRA 5SXRA 1KXNA 3ATJA 2Y6AA 1CCIA 2E3AA 5L05A 5SYXA 1CCKA 2RC2X 1IYNA 2VNXX 1MKRA 3RRWA 2RBWX 1BEMA 5KQKA 3M23A 3M29A 3WA8A 1YZRA 5SYUA 1AEEA 2EUSA 1CCEA 2GHEX 1CCGA 1KRJA 5ABOA 4NVEA 4JQJA 5KSFA 1KOKA 1MN1A 1STQA 1KXMA 1DCCA 1H5EA 1U2LA 3FJWA 2X07A 1DSGA 4JPTA 2ANZA 7ATJA 1ZBYA 4CZPA 1LYKA 2V2EA 1DJ5A 2VKAA 5SW4A 1CMQA 2AQDA 1AEMA 1AEUA 5AMMA 5CIGA 2WSSS 1BESA 2JTIA 2RBZX 4C50A 3M2IA 4NVDA 4BLLA 2V23A 4H7AA 2ZOPA 6ATJA 2RBUX 5KQHA 4NVGB 2VCSA 7CCPA 5SXQA 4NVNB 3FM1A 4XV6A 1AEKA 5KQ0A 1U75A 1H3JA 2CYPA 4FEFA 4CCPA 1CK6A 1Z53A 5KQ2A 5D6MA 1H58A 1ATJA 5JHYA 4XVAA 4NVMB 2GHDX 3UW8A 3CCXA 4U7UB 4GEDA 4JM6A 4BLYA 2VNZX 1HSRA 3FMUA 1CPDA 1QGJA 4A78A 1AEVA 2EUOA 5KQIA 1GX2A 4BM4A 4BM3A 1V0HX 1CMPA 1OAFA 5SX0B 3M2EA 4NVJB 4JMWA 1SCHA 4BM0A 4JM9A 1JCIA 1LYCA 1BEKA 1B82A 2EURA 5SXWA 4JMZA 3M28A 3M8MA 1U2KA 4JQNA 2B11A 1ZBZA 2GHHX 2RBTX 5SYIA 4JMAA 3M2DA 1H5IA 5CIDA 5ABQA 3E2NA 3M2FA 2W23A 2Y6BA 3FKGA 2GHKX 3M2AA 1H5CA 1AENA 1KZMA 5KSKA 1C8IA 5CD4J 5SYWA 5SYVA 2YLJA 5H9EB 4JB4A 4A6ZA 1PA2A 1ARUA 1ARYA 1APXA 1W4YA 5ALAA 5FNBA 2RC1X 3HDLA 4XV7A 4CZQA 1CPFA 2CCPA 1AEDA 1H57A 2RBVX 4P4QA 5FNEA 2EUNA 6CCPA 2GGNX 1AEHA 2N18A 3VLKA 3VLJA 2AS4A 4FDQA 2XI6A 2A7UB 3E2OA 1ARPA 1BVAA 1SJ2A 3RIVA 4CVJA 4JMSA 4NVAA 3RIWA 5SYJA 4JMVA 4FCNA 4BM2A 4A71A 4NVOB 1AC4A 1LGAA 2BCNA 1H5LA 4USCA 3CCPA 2AS3A 4FCSA 5JPRA 5SYLA 5CIBA 4JM5A 2B12A 5SX0A 1AEOA 5CIFA 4CUOA 2IA8A 4JZAA 3M26A 1MN2A 1SOGA 2AS6A 3X1LF 4A5GA 5SYYA 4JN0A 3X16A 3M2CA 1RYCA 2VCNA 3M2BA 4BLZA 1CYFA 2RBYX 5KQ3A 1SDQA 4PAEA 5SX3A 4GKFA 2PCCA 5AL9A 1AEFA 3VLHA 1OAGA 4BLNA 5SXXA 1GW2A 2CL4X 3FM4A 3EXBA 4NVBA 2EUTA 2GHCX 5L02A 1H5DA 1BEQA 1MKQA 1CMUA 1MK8A 4JQKA 1H5JA 4NVIB 2XIFA 5KQ6A 4QYZB 4JPLA 4NVKB 3M27A 5SX7A 2VCFX 4NFGA 4G05A 5CIEA 1LLPA 1GZBA 1ARWA 1H5FA 4JQMA 4BM1A 1JDRA 2EUUA 3R98A 5SW6A 1CCLA 2JMXA 2X08A 5SXTA 1GWTA 3Q3UA 1ITKA 5EJXA 1AETA 1CCBA 2AS1A
chains in the Genus database with same CATH topology
4NVCA 1CCPA 1H5MA 5L86A 4OQ7A 1BJ9A 1CCAA 4CZRA 2VO2X 3M5QA 1GWOA 1BEPA 1CPGA 1DSEA 1SBMA 4JPUA 3M2GA 1A2GA 1YYGA 4BLKA 5SX2A 1W4WA 2B0ZA 5SXSA 4ATJA 4XV5A 2XJ8A 3M2HA 5SW5A 2B10A 5ABNA 3VLIA 1A2FA 4JMBA 2EUPA 1UB2A 1MNPA 1EBEA 1H55A 3WXOA 5SX1A 3R99A 2EUQA 1ML2A 5CJHA 4C51A 1YYDA 3VLLA 1ARXA 2YCGA 5SX6A 1AEQA 1U2JA 1S6VA 2E3BA 3UT2A 1DS4A 2BOQA 1CMTA 1GWUA 2XILA 5SYHA 1H5AA 4JMTA 5JHXA 1LY9A 1B80A 4JM8A 1BEJA 5CICA 2GB8A 3ZCGA 1YZPA 4CVIA 4NVLA 1B85A 1QO4A 1AEJA 2RC0X 1BGPA 5CCPA 2XJ5A 1H5KA 5AOGA 4A7MA 2AS2A 1AEGA 1AA4A 1DSOA 4NVFA 3ZCYA 2CCAA 4H79A 1DSPA 3M25A 3ZCHA 4XV4A 4CZOA 2XJ6A 1AESA 4XV8A 5CIHA 2PCBA 3WNUA 1CCCA 2RBXX 2ATJA 2CCDA 5EJTA 1AC8A 1DJ1A 1FHFA 2ICVA 1HCHA 4BLXA 5JHZA 3FM6A 5H9FB 4CZNA 4CCXA 1GZAA 2Y5AA 2WD4A 4NVHB 1QPAA 5SYKA 2ZCAA 1ARVA 1H5HA 1LY8A 1U74A 1CPEA 1CCJA 1AEBA 2E39A 1H5GA 2XIHA 1S73A 3VLMA 2CEPA 5JQRA 5SXRA 1KXNA 3ATJA 2Y6AA 1CCIA 2E3AA 5L05A 5SYXA 1CCKA 2RC2X 1IYNA 2VNXX 1MKRA 3RRWA 2RBWX 1BEMA 5KQKA 3M23A 3M29A 3WA8A 1YZRA 5SYUA 1AEEA 2EUSA 1CCEA 2GHEX 1CCGA 1KRJA 5ABOA 4NVEA 4JQJA 5KSFA 1KOKA 1MN1A 1STQA 1KXMA 1DCCA 1H5EA 1U2LA 3FJWA 2X07A 1DSGA 4JPTA 2ANZA 7ATJA 1ZBYA 4CZPA 1LYKA 2V2EA 1DJ5A 2VKAA 5SW4A 1CMQA 2AQDA 1AEMA 1AEUA 5AMMA 5CIGA 1BESA 2JTIA 2RBZX 4C50A 3M2IA 4NVDA 4BLLA 2V23A 4H7AA 6ATJA 2RBUX 5KQHA 4NVGB 2VCSA 7CCPA 5SXQA 4NVNB 3FM1A 4XV6A 1AEKA 5KQ0A 1U75A 1H3JA 2CYPA 4FEFA 4CCPA 1CK6A 1Z53A 5KQ2A 5D6MA 1H58A 1ATJA 5JHYA 4XVAA 4NVMB 2GHDX 3UW8A 3CCXA 4U7UB 4GEDA 4JM6A 4BLYA 2VNZX 1HSRA 3FMUA 1CPDA 1QGJA 4A78A 1AEVA 2EUOA 5KQIA 1GX2A 4BM4A 4BM3A 1V0HX 1CMPA 1OAFA 5SX0B 3M2EA 4NVJB 4JMWA 1SCHA 4BM0A 4JM9A 1JCIA 1LYCA 1BEKA 1B82A 2EURA 5SXWA 4JMZA 3M28A 3M8MA 1U2KA 4JQNA 2B11A 1ZBZA 2GHHX 2RBTX 5SYIA 4JMAA 3M2DA 1H5IA 5CIDA 5ABQA 3E2NA 3M2FA 2W23A 2Y6BA 3FKGA 2GHKX 3M2AA 1H5CA 1AENA 1KZMA 5KSKA 1C8IA 5CD4J 5SYWA 5SYVA 2YLJA 5H9EB 4JB4A 4A6ZA 1PA2A 1ARUA 1ARYA 1APXA 1W4YA 5ALAA 5FNBA 2RC1X 3HDLA 4XV7A 4CZQA 1CPFA 2CCPA 1AEDA 1H57A 2RBVX 4P4QA 5FNEA 2EUNA 6CCPA 2GGNX 1AEHA 2N18A 3VLKA 3VLJA 2AS4A 4FDQA 2XI6A 3E2OA 1ARPA 1BVAA 1SJ2A 3RIVA 4CVJA 4JMSA 4NVAA 3RIWA 5SYJA 4JMVA 4FCNA 4BM2A 4A71A 4NVOB 1AC4A 1LGAA 2BCNA 1H5LA 4USCA 3CCPA 2AS3A 4FCSA 5JPRA 5SYLA 5CIBA 4JM5A 2B12A 5SX0A 1AEOA 5CIFA 4CUOA 2IA8A 4JZAA 3M26A 1MN2A 1SOGA 2AS6A 4A5GA 5SYYA 4JN0A 3X16A 3M2CA 1RYCA 2VCNA 3M2BA 4BLZA 1CYFA 2RBYX 5KQ3A 1SDQA 4PAEA 5SX3A 2PCCA 5AL9A 1AEFA 3VLHA 1OAGA 4BLNA 5SXXA 1GW2A 2CL4X 3FM4A 3EXBA 4NVBA 2EUTA 2GHCX 5L02A 1H5DA 1BEQA 1MKQA 1CMUA 1MK8A 4JQKA 1H5JA 4NVIB 2XIFA 5KQ6A 4QYZB 4JPLA 4NVKB 3M27A 5SX7A 2VCFX 4NFGA 4G05A 5CIEA 1LLPA 1GZBA 1ARWA 1H5FA 4JQMA 4BM1A 1JDRA 2EUUA 3R98A 5SW6A 1CCLA 2X08A 5SXTA 1GWTA 3Q3UA 1ITKA 5EJXA 1AETA 1CCBA 2AS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NVC A;  1CCP A;  1H5M A;  5L86 A;  4OQ7 A;  1BJ9 A;  1CCA A;  4CZR A;  2VO2 X;  3M5Q A;  1GWO A;  1BEP A;  1CPG A;  1DSE A;  1SBM A;  4JPU A;  3M2G A;  1A2G A;  1YYG A;  4BLK A;  5SX2 A;  1W4W A;  2B0Z A;  5SXS A;  4ATJ A;  4XV5 A;  2XJ8 A;  3M2H A;  5SW5 A;  2B10 A;  5ABN A;  3VLI A;  1A2F A;  4JMB A;  2EUP A;  1UB2 A;  1MNP A;  1EBE A;  1H55 A;  3WXO A;  5SX1 A;  3R99 A;  2EUQ A;  1ML2 A;  5CJH A;  4C51 A;  1YYD A;  3VLL A;  1ARX A;  2YCG A;  5SX6 A;  1AEQ A;  1U2J A;  1S6V A;  2E3B A;  3UT2 A;  1DS4 A;  2BOQ A;  1CMT A;  1GWU A;  2XIL A;  5SYH A;  1H5A A;  4JMT A;  5JHX A;  1LY9 A;  1B80 A;  4JM8 A;  1BEJ A;  5CIC A;  2GB8 A;  3ZCG A;  1YZP A;  4CVI A;  4NVL A;  1B85 A;  1QO4 A;  1AEJ A;  2RC0 X;  1BGP A;  5CCP A;  2XJ5 A;  1H5K A;  5AOG A;  4A7M A;  2AS2 A;  1AEG A;  1AA4 A;  1DSO A;  4NVF A;  3ZCY A;  2CCA A;  1DSP A;  3M25 A;  3ZCH A;  4XV4 A;  4CZO A;  2XJ6 A;  1AES A;  4XV8 A;  5CIH A;  2PCB A;  3WNU A;  1CCC A;  2RBX X;  2ATJ A;  2CCD A;  5EJT A;  1AC8 A;  1DJ1 A;  1FHF A;  2ICV A;  1HCH A;  4BLX A;  5JHZ A;  3FM6 A;  4CZN A;  4CCX A;  1GZA A;  2Y5A A;  2WD4 A;  4NVH B;  1QPA A;  5SYK A;  1ARV A;  1H5H A;  1LY8 A;  1U74 A;  1CPE A;  1CCJ A;  1AEB A;  2E39 A;  1H5G A;  2XIH A;  1S73 A;  3VLM A;  2CEP A;  5JQR A;  5SXR A;  1KXN A;  3ATJ A;  2Y6A A;  1CCI A;  2E3A A;  5L05 A;  5SYX A;  1CCK A;  2RC2 X;  1IYN A;  2VNX X;  1MKR A;  3RRW A;  2RBW X;  1BEM A;  5KQK A;  3M23 A;  3M29 A;  1YZR A;  5SYU A;  1AEE A;  2EUS A;  1CCE A;  2GHE X;  1CCG A;  1KRJ A;  5ABO A;  4NVE A;  4JQJ A;  5KSF A;  1KOK A;  1MN1 A;  1STQ A;  1KXM A;  1DCC A;  1H5E A;  1U2L A;  3FJW A;  2X07 A;  1DSG A;  4JPT A;  2ANZ A;  7ATJ A;  1ZBY A;  4CZP A;  1LYK A;  2V2E A;  1DJ5 A;  2VKA A;  5SW4 A;  1CMQ A;  2AQD A;  1AEM A;  1AEU A;  5AMM A;  5CIG A;  1BES A;  2JTI A;  2RBZ X;  4C50 A;  3M2I A;  4NVD A;  4BLL A;  2V23 A;  6ATJ A;  2RBU X;  5KQH A;  4NVG B;  2VCS A;  7CCP A;  5SXQ A;  4NVN B;  3FM1 A;  4XV6 A;  1AEK A;  5KQ0 A;  1U75 A;  1H3J A;  2CYP A;  4FEF A;  4CCP A;  1CK6 A;  1Z53 A;  5KQ2 A;  5D6M A;  1H58 A;  1ATJ A;  5JHY A;  4XVA A;  4NVM B;  2GHD X;  3UW8 A;  3CCX A;  4GED A;  4JM6 A;  4BLY A;  2VNZ X;  1HSR A;  3FMU A;  1CPD A;  1QGJ A;  4A78 A;  1AEV A;  2EUO A;  5KQI A;  1GX2 A;  4BM4 A;  4BM3 A;  1V0H X;  1CMP A;  1OAF A;  5SX0 B;  3M2E A;  4NVJ B;  4JMW A;  1SCH A;  4BM0 A;  4JM9 A;  1JCI A;  1LYC A;  1BEK A;  1B82 A;  2EUR A;  5SXW A;  4JMZ A;  3M28 A;  3M8M A;  1U2K A;  4JQN A;  2B11 A;  1ZBZ A;  2GHH X;  2RBT X;  5SYI A;  4JMA A;  3M2D A;  1H5I A;  5CID A;  5ABQ A;  3E2N A;  3M2F A;  2W23 A;  2Y6B A;  3FKG A;  2GHK X;  3M2A A;  1H5C A;  1AEN A;  1KZM A;  5KSK A;  1C8I A;  5SYW A;  5SYV A;  2YLJ A;  4JB4 A;  4A6Z A;  1PA2 A;  1ARU A;  1ARY A;  1APX A;  1W4Y A;  5ALA A;  5FNB A;  2RC1 X;  3HDL A;  4XV7 A;  4CZQ A;  1CPF A;  2CCP A;  1AED A;  1H57 A;  2RBV X;  4P4Q A;  5FNE A;  2EUN A;  6CCP A;  2GGN X;  1AEH A;  2N18 A;  3VLK A;  3VLJ A;  2AS4 A;  4FDQ A;  2XI6 A;  3E2O A;  1ARP A;  1BVA A;  1SJ2 A;  3RIV A;  4CVJ A;  4JMS A;  4NVA A;  3RIW A;  5SYJ A;  4JMV A;  4FCN A;  4BM2 A;  4A71 A;  4NVO B;  1AC4 A;  1LGA A;  2BCN A;  1H5L A;  4USC A;  3CCP A;  2AS3 A;  4FCS A;  5JPR A;  5SYL A;  5CIB A;  4JM5 A;  2B12 A;  5SX0 A;  1AEO A;  5CIF A;  4CUO A;  2IA8 A;  3M26 A;  1MN2 A;  1SOG A;  2AS6 A;  4A5G A;  5SYY A;  4JN0 A;  3X16 A;  3M2C A;  1RYC A;  2VCN A;  3M2B A;  4BLZ A;  1CYF A;  2RBY X;  5KQ3 A;  1SDQ A;  4PAE A;  5SX3 A;  2PCC A;  5AL9 A;  1AEF A;  3VLH A;  1OAG A;  4BLN A;  5SXX A;  1GW2 A;  2CL4 X;  3FM4 A;  3EXB A;  4NVB A;  2EUT A;  2GHC X;  5L02 A;  1H5D A;  1BEQ A;  1MKQ A;  1CMU A;  1MK8 A;  4JQK A;  1H5J A;  4NVI B;  2XIF A;  5KQ6 A;  4JPL A;  4NVK B;  3M27 A;  5SX7 A;  2VCF X;  4NFG A;  4G05 A;  5CIE A;  1LLP A;  1GZB A;  1ARW A;  1H5F A;  4JQM A;  4BM1 A;  1JDR A;  2EUU A;  3R98 A;  5SW6 A;  1CCL A;  2X08 A;  5SXT A;  1GWT A;  3Q3U A;  1ITK A;  5EJX A;  1AET A;  1CCB A;  2AS1 A; 
#chains in the Genus database with same CATH topology
 4NVC A;  1CCP A;  1H5M A;  5L86 A;  4OQ7 A;  1BJ9 A;  1CCA A;  4CZR A;  2VO2 X;  3M5Q A;  1GWO A;  1BEP A;  1CPG A;  1DSE A;  1SBM A;  4JPU A;  3M2G A;  1A2G A;  1YYG A;  4BLK A;  5SX2 A;  1W4W A;  2B0Z A;  5SXS A;  4ATJ A;  4XV5 A;  2XJ8 A;  3M2H A;  5SW5 A;  2B10 A;  5ABN A;  3VLI A;  1A2F A;  4JMB A;  2EUP A;  1UB2 A;  1ABV A;  1MNP A;  1EBE A;  1H55 A;  3WXO A;  5SX1 A;  3R99 A;  2EUQ A;  1ML2 A;  5CJH A;  4C51 A;  1YYD A;  3VLL A;  2BO5 A;  1ARX A;  2YCG A;  5SX6 A;  1AEQ A;  1U2J A;  1S6V A;  2E3B A;  3UT2 A;  1DS4 A;  2BOQ A;  1CMT A;  1GWU A;  2XIL A;  5SYH A;  1H5A A;  4JMT A;  5JHX A;  1LY9 A;  1B80 A;  4JM8 A;  1BEJ A;  5CIC A;  2GB8 A;  3ZCG A;  1YZP A;  4CVI A;  4NVL A;  1B85 A;  1QO4 A;  1AEJ A;  2RC0 X;  1BGP A;  5CCP A;  2XJ5 A;  1H5K A;  5AOG A;  4A7M A;  2AS2 A;  1AEG A;  1AA4 A;  1DSO A;  4NVF A;  3ZCY A;  2CCA A;  4H79 A;  1DSP A;  3M25 A;  3ZCH A;  4XV4 A;  4CZO A;  2XJ6 A;  1AES A;  4XV8 A;  5CIH A;  2PCB A;  3WNU A;  1CCC A;  2RBX X;  2ATJ A;  2CCD A;  5EJT A;  1AC8 A;  1DJ1 A;  1FHF A;  2ICV A;  1HCH A;  4BLX A;  5JHZ A;  3FM6 A;  5H9F B;  4CZN A;  4CCX A;  1GZA A;  2Y5A A;  2WD4 A;  4NVH B;  2OEB A;  1QPA A;  5SYK A;  2ZCA A;  1ARV A;  1H5H A;  1LY8 A;  1U74 A;  1CPE A;  1CCJ A;  1AEB A;  2E39 A;  1H5G A;  2XIH A;  1S73 A;  3VLM A;  2CEP A;  5JQR A;  5SXR A;  1KXN A;  3ATJ A;  2Y6A A;  1CCI A;  2E3A A;  5L05 A;  5SYX A;  1CCK A;  2RC2 X;  1IYN A;  2VNX X;  1MKR A;  3RRW A;  2RBW X;  1BEM A;  5KQK A;  3M23 A;  3M29 A;  3WA8 A;  1YZR A;  5SYU A;  1AEE A;  2EUS A;  1CCE A;  2GHE X;  1CCG A;  1KRJ A;  5ABO A;  4NVE A;  4JQJ A;  5KSF A;  1KOK A;  1MN1 A;  1STQ A;  1KXM A;  1DCC A;  1H5E A;  1U2L A;  3FJW A;  2X07 A;  1DSG A;  4JPT A;  2ANZ A;  7ATJ A;  1ZBY A;  4CZP A;  1LYK A;  2V2E A;  1DJ5 A;  2VKA A;  5SW4 A;  1CMQ A;  2AQD A;  1AEM A;  1AEU A;  5AMM A;  5CIG A;  2WSS S;  1BES A;  2JTI A;  2RBZ X;  4C50 A;  3M2I A;  4NVD A;  4BLL A;  2V23 A;  4H7A A;  2ZOP A;  6ATJ A;  2RBU X;  5KQH A;  4NVG B;  2VCS A;  7CCP A;  5SXQ A;  4NVN B;  3FM1 A;  4XV6 A;  1AEK A;  5KQ0 A;  1U75 A;  1H3J A;  2CYP A;  4FEF A;  4CCP A;  1CK6 A;  1Z53 A;  5KQ2 A;  5D6M A;  1H58 A;  1ATJ A;  5JHY A;  4XVA A;  4NVM B;  2GHD X;  3UW8 A;  3CCX A;  4U7U B;  4GED A;  4JM6 A;  4BLY A;  2VNZ X;  1HSR A;  3FMU A;  1CPD A;  1QGJ A;  4A78 A;  1AEV A;  2EUO A;  5KQI A;  1GX2 A;  4BM4 A;  4BM3 A;  1V0H X;  1CMP A;  1OAF A;  5SX0 B;  3M2E A;  4NVJ B;  4JMW A;  1SCH A;  4BM0 A;  4JM9 A;  1JCI A;  1LYC A;  1BEK A;  1B82 A;  2EUR A;  5SXW A;  4JMZ A;  3M28 A;  3M8M A;  1U2K A;  4JQN A;  2B11 A;  1ZBZ A;  2GHH X;  2RBT X;  5SYI A;  4JMA A;  3M2D A;  1H5I A;  5CID A;  5ABQ A;  3E2N A;  3M2F A;  2W23 A;  2Y6B A;  3FKG A;  2GHK X;  3M2A A;  1H5C A;  1AEN A;  1KZM A;  5KSK A;  1C8I A;  5CD4 J;  5SYW A;  5SYV A;  2YLJ A;  5H9E B;  4JB4 A;  4A6Z A;  1PA2 A;  1ARU A;  1ARY A;  1APX A;  1W4Y A;  5ALA A;  5FNB A;  2RC1 X;  3HDL A;  4XV7 A;  4CZQ A;  1CPF A;  2CCP A;  1AED A;  1H57 A;  2RBV X;  4P4Q A;  5FNE A;  2EUN A;  6CCP A;  2GGN X;  1AEH A;  2N18 A;  3VLK A;  3VLJ A;  2AS4 A;  4FDQ A;  2XI6 A;  2A7U B;  3E2O A;  1ARP A;  1BVA A;  1SJ2 A;  3RIV A;  4CVJ A;  4JMS A;  4NVA A;  3RIW A;  5SYJ A;  4JMV A;  4FCN A;  4BM2 A;  4A71 A;  4NVO B;  1AC4 A;  1LGA A;  2BCN A;  1H5L A;  4USC A;  3CCP A;  2AS3 A;  4FCS A;  5JPR A;  5SYL A;  5CIB A;  4JM5 A;  2B12 A;  5SX0 A;  1AEO A;  5CIF A;  4CUO A;  2IA8 A;  4JZA A;  3M26 A;  1MN2 A;  1SOG A;  2AS6 A;  3X1L F;  4A5G A;  5SYY A;  4JN0 A;  3X16 A;  3M2C A;  1RYC A;  2VCN A;  3M2B A;  4BLZ A;  1CYF A;  2RBY X;  5KQ3 A;  1SDQ A;  4PAE A;  5SX3 A;  4GKF A;  2PCC A;  5AL9 A;  1AEF A;  3VLH A;  1OAG A;  4BLN A;  5SXX A;  1GW2 A;  2CL4 X;  3FM4 A;  3EXB A;  4NVB A;  2EUT A;  2GHC X;  5L02 A;  1H5D A;  1BEQ A;  1MKQ A;  1CMU A;  1MK8 A;  4JQK A;  1H5J A;  4NVI B;  2XIF A;  5KQ6 A;  4QYZ B;  4JPL A;  4NVK B;  3M27 A;  5SX7 A;  2VCF X;  4NFG A;  4G05 A;  5CIE A;  1LLP A;  1GZB A;  1ARW A;  1H5F A;  4JQM A;  4BM1 A;  1JDR A;  2EUU A;  3R98 A;  5SW6 A;  1CCL A;  2JMX A;  2X08 A;  5SXT A;  1GWT A;  3Q3U A;  1ITK A;  5EJX A;  1AET A;  1CCB A;  2AS1 A; 
#chains in the Genus database with same CATH homology
 4NVC A;  1CCP A;  1H5M A;  5L86 A;  4OQ7 A;  1BJ9 A;  1CCA A;  4CZR A;  2VO2 X;  3M5Q A;  1GWO A;  1BEP A;  1CPG A;  1DSE A;  1SBM A;  4JPU A;  3M2G A;  1A2G A;  1YYG A;  4BLK A;  5SX2 A;  1W4W A;  2B0Z A;  5SXS A;  4ATJ A;  4XV5 A;  2XJ8 A;  3M2H A;  5SW5 A;  2B10 A;  5ABN A;  3VLI A;  1A2F A;  4JMB A;  2EUP A;  1UB2 A;  1MNP A;  1EBE A;  1H55 A;  3WXO A;  5SX1 A;  3R99 A;  2EUQ A;  1ML2 A;  5CJH A;  4C51 A;  1YYD A;  3VLL A;  1ARX A;  2YCG A;  5SX6 A;  1AEQ A;  1U2J A;  1S6V A;  2E3B A;  3UT2 A;  1DS4 A;  2BOQ A;  1CMT A;  1GWU A;  2XIL A;  5SYH A;  1H5A A;  4JMT A;  5JHX A;  1LY9 A;  1B80 A;  4JM8 A;  1BEJ A;  5CIC A;  2GB8 A;  3ZCG A;  1YZP A;  4CVI A;  4NVL A;  1B85 A;  1QO4 A;  1AEJ A;  2RC0 X;  1BGP A;  5CCP A;  2XJ5 A;  1H5K A;  5AOG A;  4A7M A;  2AS2 A;  1AEG A;  1AA4 A;  1DSO A;  4NVF A;  3ZCY A;  2CCA A;  4H79 A;  1DSP A;  3M25 A;  3ZCH A;  4XV4 A;  4CZO A;  2XJ6 A;  1AES A;  4XV8 A;  5CIH A;  2PCB A;  3WNU A;  1CCC A;  2RBX X;  2ATJ A;  2CCD A;  5EJT A;  1AC8 A;  1DJ1 A;  1FHF A;  2ICV A;  1HCH A;  4BLX A;  5JHZ A;  3FM6 A;  5H9F B;  4CZN A;  4CCX A;  1GZA A;  2Y5A A;  2WD4 A;  4NVH B;  1QPA A;  5SYK A;  2ZCA A;  1ARV A;  1H5H A;  1LY8 A;  1U74 A;  1CPE A;  1CCJ A;  1AEB A;  2E39 A;  1H5G A;  2XIH A;  1S73 A;  3VLM A;  2CEP A;  5JQR A;  5SXR A;  1KXN A;  3ATJ A;  2Y6A A;  1CCI A;  2E3A A;  5L05 A;  5SYX A;  1CCK A;  2RC2 X;  1IYN A;  2VNX X;  1MKR A;  3RRW A;  2RBW X;  1BEM A;  5KQK A;  3M23 A;  3M29 A;  3WA8 A;  1YZR A;  5SYU A;  1AEE A;  2EUS A;  1CCE A;  2GHE X;  1CCG A;  1KRJ A;  5ABO A;  4NVE A;  4JQJ A;  5KSF A;  1KOK A;  1MN1 A;  1STQ A;  1KXM A;  1DCC A;  1H5E A;  1U2L A;  3FJW A;  2X07 A;  1DSG A;  4JPT A;  2ANZ A;  7ATJ A;  1ZBY A;  4CZP A;  1LYK A;  2V2E A;  1DJ5 A;  2VKA A;  5SW4 A;  1CMQ A;  2AQD A;  1AEM A;  1AEU A;  5AMM A;  5CIG A;  1BES A;  2JTI A;  2RBZ X;  4C50 A;  3M2I A;  4NVD A;  4BLL A;  2V23 A;  4H7A A;  6ATJ A;  2RBU X;  5KQH A;  4NVG B;  2VCS A;  7CCP A;  5SXQ A;  4NVN B;  3FM1 A;  4XV6 A;  1AEK A;  5KQ0 A;  1U75 A;  1H3J A;  2CYP A;  4FEF A;  4CCP A;  1CK6 A;  1Z53 A;  5KQ2 A;  5D6M A;  1H58 A;  1ATJ A;  5JHY A;  4XVA A;  4NVM B;  2GHD X;  3UW8 A;  3CCX A;  4U7U B;  4GED A;  4JM6 A;  4BLY A;  2VNZ X;  1HSR A;  3FMU A;  1CPD A;  1QGJ A;  4A78 A;  1AEV A;  2EUO A;  5KQI A;  1GX2 A;  4BM4 A;  4BM3 A;  1V0H X;  1CMP A;  1OAF A;  5SX0 B;  3M2E A;  4NVJ B;  4JMW A;  1SCH A;  4BM0 A;  4JM9 A;  1JCI A;  1LYC A;  1BEK A;  1B82 A;  2EUR A;  5SXW A;  4JMZ A;  3M28 A;  3M8M A;  1U2K A;  4JQN A;  2B11 A;  1ZBZ A;  2GHH X;  2RBT X;  5SYI A;  4JMA A;  3M2D A;  1H5I A;  5CID A;  5ABQ A;  3E2N A;  3M2F A;  2W23 A;  2Y6B A;  3FKG A;  2GHK X;  3M2A A;  1H5C A;  1AEN A;  1KZM A;  5KSK A;  1C8I A;  5CD4 J;  5SYW A;  5SYV A;  2YLJ A;  5H9E B;  4JB4 A;  4A6Z A;  1PA2 A;  1ARU A;  1ARY A;  1APX A;  1W4Y A;  5ALA A;  5FNB A;  2RC1 X;  3HDL A;  4XV7 A;  4CZQ A;  1CPF A;  2CCP A;  1AED A;  1H57 A;  2RBV X;  4P4Q A;  5FNE A;  2EUN A;  6CCP A;  2GGN X;  1AEH A;  2N18 A;  3VLK A;  3VLJ A;  2AS4 A;  4FDQ A;  2XI6 A;  3E2O A;  1ARP A;  1BVA A;  1SJ2 A;  3RIV A;  4CVJ A;  4JMS A;  4NVA A;  3RIW A;  5SYJ A;  4JMV A;  4FCN A;  4BM2 A;  4A71 A;  4NVO B;  1AC4 A;  1LGA A;  2BCN A;  1H5L A;  4USC A;  3CCP A;  2AS3 A;  4FCS A;  5JPR A;  5SYL A;  5CIB A;  4JM5 A;  2B12 A;  5SX0 A;  1AEO A;  5CIF A;  4CUO A;  2IA8 A;  4JZA A;  3M26 A;  1MN2 A;  1SOG A;  2AS6 A;  4A5G A;  5SYY A;  4JN0 A;  3X16 A;  3M2C A;  1RYC A;  2VCN A;  3M2B A;  4BLZ A;  1CYF A;  2RBY X;  5KQ3 A;  1SDQ A;  4PAE A;  5SX3 A;  2PCC A;  5AL9 A;  1AEF A;  3VLH A;  1OAG A;  4BLN A;  5SXX A;  1GW2 A;  2CL4 X;  3FM4 A;  3EXB A;  4NVB A;  2EUT A;  2GHC X;  5L02 A;  1H5D A;  1BEQ A;  1MKQ A;  1CMU A;  1MK8 A;  4JQK A;  1H5J A;  4NVI B;  2XIF A;  5KQ6 A;  4QYZ B;  4JPL A;  4NVK B;  3M27 A;  5SX7 A;  2VCF X;  4NFG A;  4G05 A;  5CIE A;  1LLP A;  1GZB A;  1ARW A;  1H5F A;  4JQM A;  4BM1 A;  1JDR A;  2EUU A;  3R98 A;  5SW6 A;  1CCL A;  2X08 A;  5SXT A;  1GWT A;  3Q3U A;  1ITK A;  5EJX A;  1AET A;  1CCB A;  2AS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...