4D01A

Crystal structure of the extracellular domain of the human alpha9 nicotinic acetylcholine receptor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
214
structure length
212
Chain Sequence
b'DGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDEEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEURONAL ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-9
publication title Crystal Structures of Free and Antagonist-Bound States of Human Alpha9 Nicotinic Receptor Extracellular Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 46
structure length 212
sequence length 214
ec nomenclature
pdb deposition date 2014-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4d01A00
2XQ4A 2XQ8A 3WTKA 2BG9E 5AINA 3WTLA 2Y54A 4UY2A 2W8FA 5AFMA 3PEOA 4ILBA 4LMKA 2Y7YA 3RIFA 2YKSA 5BRXA 4QACA 5HEGA 3PMZA 1UW6A 3WTNA 4UM3A 2XNVA 2XYTA 3U8LA 2WN9A 2XQ3A 3T4MA 4AFTA 5LG3A 2ZJUA 4NZBA 4QABA 4HQPA 3U8MA 4ZZBA 4ZRUA 2BYRA 5BW2A 4HFEA 4ZK1A 3RHWA 3WTJA 3RQWA 1I9BA 4TNWA 4NPPA 3ZDGA 4TWDA 4WV9A 2WNLA 3LSVA 5IUXA 5J0ZA 2XNTA 2YN6A 2YOEA 3SQ9A 2XYSA 5HEUA 4ZR6A 5FJVA 3WTIA 4AFGA 4COFA 3RQUA 3WTHA 4X5TA 3TLVA 4B5DA 2BG9C 5CFBA 2XZ6A 2VL0A 3UQ7A 3ZKRA 2XZ5A 2PH9A 2XNUA 3UUBA 3JAEA 3SQ6A 3P50A 2PGZA 4IL9A 2WNJA 4PIRA 5CO5A 3ZDHA 5AFLA 4DBMA 4F8HA 4HFHA 5L47A 5J5IA 4HFDA 3JAFA 3UU6A 3SH1A 3TLWA 2BR7A 5J5FA 2WNCA 4ILAA 5AFNA 5L4HA 5J5GA 3C79A 5AFMB 1UX2A 2YMEA 2BYSA 5HEOA 3U8KA 4QH5A 2XQ6A 3C84A 3EHZA 4ALXA 4XK9A 5LXBA 3UU5A 4UXUA 4ZJTA 3RI5A 2BR8A 5AFHA 4Z91A 4FRRA 3GUAA 2X00A 5HCJA 3WTMA 5JMEA 5L4EA 5HCMA 4IREA 3JADA 4D01A 4EZ1A 3WTOA 4UM3S 2BJ0A 4HFBA 4BQTA 5J5HA 4LMJA 2BYQA 2W8GA 4ZJSA 5HEJA 3U8NA 2WZYA 4IL4A 3EAMA 3UU8A 3RIAA 4Z90A 2Y58A 2Y56A 5BP0A 5KZUA 3IGQA 5AFJA 2QC1B 3UU3A 4LMLA 2BG9A 3TLSA 4QAAA 4ILCA 4TWFA 4AFHA 2XQAA 2BYNA 2C9TA 2Y57A 2UZ6A 1UV6A 4QH1A 3TLTA 4ZK4A 3UU4A 5AFKA 2XQ5A 2XQ7A 3UQ4A 3SIOA 4BFQA 2XQ9A 3TLUA 3P4WA 5KE4A 4XHEA 2ZJVA 2X00D 2YMDA 5HEHA 5SYOA 5TVCA 4UM3P 4A97A 2BYPA 3U8JA 2BG9B 4HFCA 3EI0A 4QH4A 4TNVA 4A98A 4HFIA 4ZZCA 4TWHA 4UM1A 3WIPA
chains in the Genus database with same CATH superfamily
2XQ4A 2XQ8A 3WTKA 2BG9E 5AINA 3WTLA 2Y54A 4UY2A 2W8FA 5AFMA 3PEOA 4ILBA 4LMKA 2Y7YA 3RIFA 2YKSA 5BRXA 4QACA 5HEGA 3PMZA 1UW6A 3WTNA 4UM3A 2XNVA 2XYTA 3U8LA 2WN9A 2XQ3A 3T4MA 4AFTA 5LG3A 2ZJUA 4NZBA 4QABA 4HQPA 3U8MA 4ZZBA 4ZRUA 2BYRA 5BW2A 4HFEA 4ZK1A 3RHWA 3WTJA 3RQWA 1I9BA 4TNWA 4NPPA 3ZDGA 4TWDA 4WV9A 2WNLA 3LSVA 5IUXA 5J0ZA 2XNTA 2YN6A 2YOEA 3SQ9A 2XYSA 5HEUA 4ZR6A 5FJVA 3WTIA 4AFGA 4COFA 3RQUA 3WTHA 4X5TA 3TLVA 4B5DA 2BG9C 5CFBA 2XZ6A 2VL0A 3UQ7A 3ZKRA 2XZ5A 2PH9A 2XNUA 3UUBA 3JAEA 3SQ6A 3P50A 2PGZA 4IL9A 2WNJA 4PIRA 5CO5A 3ZDHA 5AFLA 4DBMA 4F8HA 4HFHA 5L47A 5J5IA 4HFDA 3JAFA 3UU6A 3SH1A 3TLWA 2BR7A 5J5FA 2WNCA 4ILAA 5AFNA 5L4HA 5J5GA 3C79A 5AFMB 1UX2A 2YMEA 2BYSA 5HEOA 3U8KA 4QH5A 2XQ6A 3C84A 3EHZA 4ALXA 4XK9A 5LXBA 3UU5A 4UXUA 4ZJTA 3RI5A 2BR8A 5AFHA 4Z91A 4FRRA 3GUAA 2X00A 5HCJA 3WTMA 5JMEA 5L4EA 5HCMA 4IREA 3JADA 4D01A 4EZ1A 3WTOA 4UM3S 2BJ0A 4HFBA 4BQTA 5J5HA 4LMJA 2BYQA 2W8GA 4ZJSA 5HEJA 3U8NA 2WZYA 4IL4A 3EAMA 3UU8A 3RIAA 4Z90A 2Y58A 2Y56A 5BP0A 5KZUA 3IGQA 5AFJA 2QC1B 3UU3A 4LMLA 2BG9A 3TLSA 4QAAA 4ILCA 4TWFA 4AFHA 2XQAA 2BYNA 2C9TA 2Y57A 2UZ6A 1UV6A 4QH1A 3TLTA 4ZK4A 3UU4A 5AFKA 2XQ5A 2XQ7A 3UQ4A 3SIOA 4BFQA 2XQ9A 3TLUA 3P4WA 5KE4A 4XHEA 2ZJVA 2X00D 2YMDA 5HEHA 5SYOA 5TVCA 4UM3P 4A97A 2BYPA 3U8JA 2BG9B 4HFCA 3EI0A 4QH4A 4TNVA 4A98A 4HFIA 4ZZCA 4TWHA 4UM1A 3WIPA
chains in the Genus database with same CATH topology
2XQ4A 2XQ8A 3WTKA 2BG9E 5AINA 3WTLA 2Y54A 4UY2A 2W8FA 5AFMA 3PEOA 4ILBA 4LMKA 2Y7YA 3RIFA 2YKSA 5BRXA 4QACA 5HEGA 3PMZA 1UW6A 3WTNA 4UM3A 2XNVA 2XYTA 3U8LA 2WN9A 2XQ3A 3T4MA 4AFTA 5LG3A 2ZJUA 4NZBA 4QABA 4HQPA 3U8MA 4ZZBA 4ZRUA 2BYRA 5BW2A 4HFEA 4ZK1A 3RHWA 3WTJA 3RQWA 1I9BA 4TNWA 4NPPA 3ZDGA 4TWDA 4WV9A 2WNLA 3LSVA 5IUXA 5J0ZA 2XNTA 2YN6A 2YOEA 3SQ9A 2XYSA 5HEUA 4ZR6A 5FJVA 3WTIA 4AFGA 4COFA 3RQUA 3WTHA 4X5TA 3TLVA 4B5DA 2BG9C 5CFBA 2XZ6A 2VL0A 3UQ7A 3ZKRA 2XZ5A 2PH9A 2XNUA 3UUBA 3JAEA 3SQ6A 3P50A 2PGZA 4IL9A 2WNJA 4PIRA 5CO5A 3ZDHA 5AFLA 4DBMA 4F8HA 4HFHA 5L47A 5J5IA 4HFDA 3JAFA 3UU6A 3SH1A 3TLWA 2BR7A 5J5FA 2WNCA 4ILAA 5AFNA 5L4HA 5J5GA 3C79A 5AFMB 1UX2A 2YMEA 2BYSA 5HEOA 3U8KA 4QH5A 2XQ6A 3C84A 3EHZA 4ALXA 4XK9A 5LXBA 3UU5A 4UXUA 4ZJTA 3RI5A 2BR8A 5AFHA 4Z91A 4FRRA 3GUAA 2X00A 5HCJA 3WTMA 5JMEA 5L4EA 5HCMA 4IREA 3JADA 4D01A 4EZ1A 3WTOA 4UM3S 2BJ0A 4HFBA 4BQTA 5J5HA 4LMJA 2BYQA 2W8GA 4ZJSA 5HEJA 3U8NA 2WZYA 4IL4A 3EAMA 3UU8A 3RIAA 4Z90A 2Y58A 2Y56A 5BP0A 5KZUA 3IGQA 5AFJA 2QC1B 3UU3A 4LMLA 2BG9A 3TLSA 4QAAA 4ILCA 4TWFA 4AFHA 2XQAA 2BYNA 2C9TA 2Y57A 2UZ6A 1UV6A 4QH1A 3TLTA 4ZK4A 3UU4A 5AFKA 2XQ5A 2XQ7A 3UQ4A 3SIOA 4BFQA 2XQ9A 3TLUA 3P4WA 5KE4A 4XHEA 2ZJVA 2X00D 2YMDA 5HEHA 5SYOA 5TVCA 4UM3P 4A97A 2BYPA 3U8JA 2BG9B 4HFCA 3EI0A 4QH4A 4TNVA 4A98A 4HFIA 4ZZCA 4TWHA 4UM1A 3WIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQ4 A;  2XQ8 A;  3WTK A;  2BG9 E;  5AIN A;  3WTL A;  2Y54 A;  4UY2 A;  2W8F A;  5AFM A;  3PEO A;  4ILB A;  4LMK A;  2Y7Y A;  3RIF A;  2YKS A;  5BRX A;  4QAC A;  5HEG A;  3PMZ A;  1UW6 A;  3WTN A;  4UM3 A;  2XNV A;  2XYT A;  3U8L A;  2WN9 A;  2XQ3 A;  3T4M A;  4AFT A;  5LG3 A;  2ZJU A;  4NZB A;  4QAB A;  4HQP A;  3U8M A;  4ZZB A;  4ZRU A;  2BYR A;  5BW2 A;  4HFE A;  4ZK1 A;  3RHW A;  3WTJ A;  3RQW A;  1I9B A;  4TNW A;  4NPP A;  3ZDG A;  4TWD A;  4WV9 A;  2WNL A;  3LSV A;  5IUX A;  5J0Z A;  2XNT A;  2YN6 A;  2YOE A;  3SQ9 A;  2XYS A;  5HEU A;  4ZR6 A;  5FJV A;  3WTI A;  4AFG A;  4COF A;  3RQU A;  3WTH A;  4X5T A;  3TLV A;  4B5D A;  2BG9 C;  5CFB A;  2XZ6 A;  2VL0 A;  3UQ7 A;  3ZKR A;  2XZ5 A;  2PH9 A;  2XNU A;  3UUB A;  3JAE A;  3SQ6 A;  3P50 A;  2PGZ A;  4IL9 A;  2WNJ A;  4PIR A;  5CO5 A;  3ZDH A;  5AFL A;  4DBM A;  4F8H A;  4HFH A;  5L47 A;  5J5I A;  4HFD A;  3JAF A;  3UU6 A;  3SH1 A;  3TLW A;  2BR7 A;  5J5F A;  2WNC A;  4ILA A;  5AFN A;  5L4H A;  5J5G A;  3C79 A;  5AFM B;  1UX2 A;  2YME A;  2BYS A;  5HEO A;  3U8K A;  4QH5 A;  2XQ6 A;  3C84 A;  3EHZ A;  4ALX A;  4XK9 A;  5LXB A;  3UU5 A;  4UXU A;  4ZJT A;  3RI5 A;  2BR8 A;  5AFH A;  4Z91 A;  4FRR A;  3GUA A;  2X00 A;  5HCJ A;  3WTM A;  5JME A;  5L4E A;  5HCM A;  4IRE A;  3JAD A;  4D01 A;  4EZ1 A;  3WTO A;  4UM3 S;  2BJ0 A;  4HFB A;  4BQT A;  5J5H A;  4LMJ A;  2BYQ A;  2W8G A;  4ZJS A;  5HEJ A;  3U8N A;  2WZY A;  4IL4 A;  3EAM A;  3UU8 A;  3RIA A;  4Z90 A;  2Y58 A;  2Y56 A;  5BP0 A;  5KZU A;  3IGQ A;  5AFJ A;  2QC1 B;  3UU3 A;  4LML A;  2BG9 A;  3TLS A;  4QAA A;  4ILC A;  4TWF A;  4AFH A;  2XQA A;  2BYN A;  2C9T A;  2Y57 A;  2UZ6 A;  1UV6 A;  4QH1 A;  3TLT A;  4ZK4 A;  3UU4 A;  5AFK A;  2XQ5 A;  2XQ7 A;  3UQ4 A;  3SIO A;  4BFQ A;  2XQ9 A;  3TLU A;  3P4W A;  5KE4 A;  4XHE A;  2ZJV A;  2X00 D;  2YMD A;  5HEH A;  5SYO A;  5TVC A;  4UM3 P;  4A97 A;  2BYP A;  3U8J A;  2BG9 B;  4HFC A;  3EI0 A;  4QH4 A;  4TNV A;  4A98 A;  4HFI A;  4ZZC A;  4TWH A;  4UM1 A;  3WIP A; 
#chains in the Genus database with same CATH topology
 2XQ4 A;  2XQ8 A;  3WTK A;  2BG9 E;  5AIN A;  3WTL A;  2Y54 A;  4UY2 A;  2W8F A;  5AFM A;  3PEO A;  4ILB A;  4LMK A;  2Y7Y A;  3RIF A;  2YKS A;  5BRX A;  4QAC A;  5HEG A;  3PMZ A;  1UW6 A;  3WTN A;  4UM3 A;  2XNV A;  2XYT A;  3U8L A;  2WN9 A;  2XQ3 A;  3T4M A;  4AFT A;  5LG3 A;  2ZJU A;  4NZB A;  4QAB A;  4HQP A;  3U8M A;  4ZZB A;  4ZRU A;  2BYR A;  5BW2 A;  4HFE A;  4ZK1 A;  3RHW A;  3WTJ A;  3RQW A;  1I9B A;  4TNW A;  4NPP A;  3ZDG A;  4TWD A;  4WV9 A;  2WNL A;  3LSV A;  5IUX A;  5J0Z A;  2XNT A;  2YN6 A;  2YOE A;  3SQ9 A;  2XYS A;  5HEU A;  4ZR6 A;  5FJV A;  3WTI A;  4AFG A;  4COF A;  3RQU A;  3WTH A;  4X5T A;  3TLV A;  4B5D A;  2BG9 C;  5CFB A;  2XZ6 A;  2VL0 A;  3UQ7 A;  3ZKR A;  2XZ5 A;  2PH9 A;  2XNU A;  3UUB A;  3JAE A;  3SQ6 A;  3P50 A;  2PGZ A;  4IL9 A;  2WNJ A;  4PIR A;  5CO5 A;  3ZDH A;  5AFL A;  4DBM A;  4F8H A;  4HFH A;  5L47 A;  5J5I A;  4HFD A;  3JAF A;  3UU6 A;  3SH1 A;  3TLW A;  2BR7 A;  5J5F A;  2WNC A;  4ILA A;  5AFN A;  5L4H A;  5J5G A;  3C79 A;  5AFM B;  1UX2 A;  2YME A;  2BYS A;  5HEO A;  3U8K A;  4QH5 A;  2XQ6 A;  3C84 A;  3EHZ A;  4ALX A;  4XK9 A;  5LXB A;  3UU5 A;  4UXU A;  4ZJT A;  3RI5 A;  2BR8 A;  5AFH A;  4Z91 A;  4FRR A;  3GUA A;  2X00 A;  5HCJ A;  3WTM A;  5JME A;  5L4E A;  5HCM A;  4IRE A;  3JAD A;  4D01 A;  4EZ1 A;  3WTO A;  4UM3 S;  2BJ0 A;  4HFB A;  4BQT A;  5J5H A;  4LMJ A;  2BYQ A;  2W8G A;  4ZJS A;  5HEJ A;  3U8N A;  2WZY A;  4IL4 A;  3EAM A;  3UU8 A;  3RIA A;  4Z90 A;  2Y58 A;  2Y56 A;  5BP0 A;  5KZU A;  3IGQ A;  5AFJ A;  2QC1 B;  3UU3 A;  4LML A;  2BG9 A;  3TLS A;  4QAA A;  4ILC A;  4TWF A;  4AFH A;  2XQA A;  2BYN A;  2C9T A;  2Y57 A;  2UZ6 A;  1UV6 A;  4QH1 A;  3TLT A;  4ZK4 A;  3UU4 A;  5AFK A;  2XQ5 A;  2XQ7 A;  3UQ4 A;  3SIO A;  4BFQ A;  2XQ9 A;  3TLU A;  3P4W A;  5KE4 A;  4XHE A;  2ZJV A;  2X00 D;  2YMD A;  5HEH A;  5SYO A;  5TVC A;  4UM3 P;  4A97 A;  2BYP A;  3U8J A;  2BG9 B;  4HFC A;  3EI0 A;  4QH4 A;  4TNV A;  4A98 A;  4HFI A;  4ZZC A;  4TWH A;  4UM1 A;  3WIP A; 
#chains in the Genus database with same CATH homology
 2XQ4 A;  2XQ8 A;  3WTK A;  2BG9 E;  5AIN A;  3WTL A;  2Y54 A;  4UY2 A;  2W8F A;  5AFM A;  3PEO A;  4ILB A;  4LMK A;  2Y7Y A;  3RIF A;  2YKS A;  5BRX A;  4QAC A;  5HEG A;  3PMZ A;  1UW6 A;  3WTN A;  4UM3 A;  2XNV A;  2XYT A;  3U8L A;  2WN9 A;  2XQ3 A;  3T4M A;  4AFT A;  5LG3 A;  2ZJU A;  4NZB A;  4QAB A;  4HQP A;  3U8M A;  4ZZB A;  4ZRU A;  2BYR A;  5BW2 A;  4HFE A;  4ZK1 A;  3RHW A;  3WTJ A;  3RQW A;  1I9B A;  4TNW A;  4NPP A;  3ZDG A;  4TWD A;  4WV9 A;  2WNL A;  3LSV A;  5IUX A;  5J0Z A;  2XNT A;  2YN6 A;  2YOE A;  3SQ9 A;  2XYS A;  5HEU A;  4ZR6 A;  5FJV A;  3WTI A;  4AFG A;  4COF A;  3RQU A;  3WTH A;  4X5T A;  3TLV A;  4B5D A;  2BG9 C;  5CFB A;  2XZ6 A;  2VL0 A;  3UQ7 A;  3ZKR A;  2XZ5 A;  2PH9 A;  2XNU A;  3UUB A;  3JAE A;  3SQ6 A;  3P50 A;  2PGZ A;  4IL9 A;  2WNJ A;  4PIR A;  5CO5 A;  3ZDH A;  5AFL A;  4DBM A;  4F8H A;  4HFH A;  5L47 A;  5J5I A;  4HFD A;  3JAF A;  3UU6 A;  3SH1 A;  3TLW A;  2BR7 A;  5J5F A;  2WNC A;  4ILA A;  5AFN A;  5L4H A;  5J5G A;  3C79 A;  5AFM B;  1UX2 A;  2YME A;  2BYS A;  5HEO A;  3U8K A;  4QH5 A;  2XQ6 A;  3C84 A;  3EHZ A;  4ALX A;  4XK9 A;  5LXB A;  3UU5 A;  4UXU A;  4ZJT A;  3RI5 A;  2BR8 A;  5AFH A;  4Z91 A;  4FRR A;  3GUA A;  2X00 A;  5HCJ A;  3WTM A;  5JME A;  5L4E A;  5HCM A;  4IRE A;  3JAD A;  4D01 A;  4EZ1 A;  3WTO A;  4UM3 S;  2BJ0 A;  4HFB A;  4BQT A;  5J5H A;  4LMJ A;  2BYQ A;  2W8G A;  4ZJS A;  5HEJ A;  3U8N A;  2WZY A;  4IL4 A;  3EAM A;  3UU8 A;  3RIA A;  4Z90 A;  2Y58 A;  2Y56 A;  5BP0 A;  5KZU A;  3IGQ A;  5AFJ A;  2QC1 B;  3UU3 A;  4LML A;  2BG9 A;  3TLS A;  4QAA A;  4ILC A;  4TWF A;  4AFH A;  2XQA A;  2BYN A;  2C9T A;  2Y57 A;  2UZ6 A;  1UV6 A;  4QH1 A;  3TLT A;  4ZK4 A;  3UU4 A;  5AFK A;  2XQ5 A;  2XQ7 A;  3UQ4 A;  3SIO A;  4BFQ A;  2XQ9 A;  3TLU A;  3P4W A;  5KE4 A;  4XHE A;  2ZJV A;  2X00 D;  2YMD A;  5HEH A;  5SYO A;  5TVC A;  4UM3 P;  4A97 A;  2BYP A;  3U8J A;  2BG9 B;  4HFC A;  3EI0 A;  4QH4 A;  4TNV A;  4A98 A;  4HFI A;  4ZZC A;  4TWH A;  4UM1 A;  3WIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...