4D52A

Crystal structure of fucose binding lectin from aspergillus fumigatus (afl) in complex with l-galactopyranose.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
314
structure length
314
Chain Sequence
STPGAQQVLFRTGIAAVNSTNHLRVYFQDVYGSIRESLYEGSWANGTEKNVIGNAKLGSPVAATSKELKHIRVYTLTEGNTLQEFAYDSGTGWYNGGLGGAKFQVAPYSCIAAVFLAGTDALQLRIYAQKPDNTIQEYMWNGDGWKEGTNLGGALPGTGIGATSFRYTDYNGPSIRIWFQTDDLKLVQRAYDPHKGWYPDLVTIFDRAPPRTAIAATSFGAGNSSIYMRIYFVNSDNTIWQVCWDHGKGYHDKGTITPVIQGSEVAIISWGSFANNGPDLRLYFQNGTYISAVSEWVWNRAHGSQLGRSALPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Aspergillus Fumigatus Lectin Specificity: Afl Binding Sites are Functionally Non-Equivalent.
pubmed doi rcsb
molecule keywords FUCOSE-SPECIFIC LECTIN FLEA
molecule tags Sugar binding protein
source organism Aspergillus fumigatus
total genus 79
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2014-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07938 Fungal_lectin Fungal fucose-specific lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.70 Mainly Beta 6 Propeller Neuraminidase Fucose-specific lectin 4d52A00
4AH4A 4CSDA 4D4UA 4C1YB 4D52C 5EO8A 5EO7A 1IUCA 4AHAA 4D52B 4C1YA 5H47A 1IUBA 1OFZA 4AGIA 4D52A 4AGTA 4UOUA
chains in the Genus database with same CATH superfamily
3SOBB 4FOWA 3TI6A 4XJAA 4MC7A 2HTRA 1W8OA 4M4UA 1INXA 2ZW9A 3S8ZA 4DGRA 2YA4A 1INHA 2F24A 3ALWA 2GVVA 1V04A 2FPCA 1IJQA 5GX2A 3LI3A 2VW1A 2FHRA 3INBA 2AGSA 2HT5A 4IFNX 3S8VA 1N1VA 1NCAN 3SOVA 1NSCA 4YZ1A 4HZXA 1NNCA 4GZWA 3NO0A 3H6JA 2HU4A 1C9UA 1IVBA 2GHSA 4FQ4A 4Q6KA 3SLIA 4B7NA 1NNAA 4HHOA 3II7A 5FNQA 4WA5A 5FZJA 4H53A 3V65B 4K1IA 1NMAN 1S1DA 3A9GA 1L7FA 4YW5A 3SANA 4XJRA 4R40A 4CHBA 1EUTA 1V3BA 5B2DA 2YDPA 5GTQA 1IVEA 3TI8A 2Z32A 1ZGKA 3ADEA 4FP2A 3O9KA 1F8EA 1SLLA 4QN3A 5FZNA 5GX3A 4MZEA 1DILA 3DR2A 5GX5A 5EX7A 2HTWA 2QWIA 1MWEA 4FPJA 1N1YA 3HLHA 2RKCA 2BERA 3Q6TA 1MS0A 4FPHA 4C1YB 4FJ6A 4SLIA 4QN6A 1IUBA 1NMBN 3OPZA 1BJIA 4GN7A 4D4UA 4WA4A 2W8BB 2IAOA 2VK6A 2QWGA 4GZQA 4XE9A 4FOYA 3HLIA 1V0EA 3E5ZA 4C1YA 4FOQA 4MWUA 1MS1A 4FPKA 1W21A 1N1SA 3O4PA 5H47A 2W8BA 3K38A 2VAQA 1MS8A 3NN9A 1CQ1A 6NN9A 2AEQA 2FP9A 3L6VA 4KS5A 2V91A 1F8BA 2GVUA 2F26A 4MWYA 4YW2A 4GEZA 1NN2A 3DASA 4MWXA 5NN9A 4X47A 4WA3A 1N7DA 2XZIA 4XJQA 3K36A 4K1HA 4QN7A 3TI4A 2ZWAA 4GZXA 1WCQA 3SALA 5CGJA 3H71A 4AGIA 1MZ6A 4MJVA 2QWHA 2F12A 1QLGA 4NN9A 5FWWA 2YA7A 5D9DA 4FPGA 4FOVA 2B8HA 4YZ5A 3HRPA 1IVFA 4K3YA 2F13A 3CL0A 2GVWA 4JF7A 2F25A 4L7DA 5HUNA 2YA6A 1N6DA 4XOGA 2ZB6A 4GZOA 4KS1A 3FW0A 4AH4A 3G4HA 4WEFA 1MR5A 1MS4A 4MWRA 2QWCA 3VNGA 1WP5A 5GX4A 1NSBA 1L7GA 3Q6PA 4ZY3A 2ZZKA 4MWLA 1NCCN 3K39A 2YA5A 3TIBA 1ZI0A 1CRZA 3NSSA 2DYHA 2CMLA 4XMBA 1XOGA 4CPZA 3GVLA 2C4LA 1NCDN 4FP3A 2DG1A 2SILA 3GVJA 2QWFA 3P5BL 3FVZA 1E8VA 2QWBA 4B7MA 1W0PA 2HTUA 2IVZA 5EO8A 2FLUX 1NNBA 1EUSA 4MWJA 4D8SA 4MJUA 4IN4A 4AGTA 1B9VA 3I1CA 2BZDA 4NCSA 4B7RA 1MZ5A 4Q1UA 4MWWA 4GN9A 4CPNA 4GZPA 2F10A 5F72C 1IVGA 3AMSA 4FPLA 4GZSA 5HUKA 3TC9A 4HZYA 4X49A 4QN4A 4YW1A 3CL2A 1VCUA 3D12A 2DG0A 4HZZA 1Z4YA 1F8CA 3V1SA 1U6DX 1IVCA 2IAUA 2QWJA 7NN9A 1F8DA 2W20A 2IAWA 2HTYA 2VVZA 3Q6KA 3SRGA 2W5OA 2G8SA 1B9SA 4IFJA 3S2KA 3U0SA 2HT8A 3S94A 1V3EA 4D52C 4IQKA 1OFZA 1INVA 4M4VA 4YZ4A 4ASCA 3B69A 3GVKA 2IASA 1E1AA 4CH9A 3VNHA 1S0JA 2VK5A 4GNAA 2C4AA 1C5KA 1USRA 5JYYA 2A75A 2GVXA 4CPOA 4XJ8A 4XHXA 1INFA 5FNUA 1A4GA 1KITA 1Z4ZA 4IMBA 4FPCA 3TIAA 4CPLA 2SLIA 4AHAA 5F9TA 1RWLA 1N6FA 2IAVA 4M4NA 2XCYA 4FVKA 4YZ3A 5FNRA 3WN7A 2XN4A 3K3AA 5HUGA 5D9BA 4YW4A 4L7BA 4GN8A 2BF6A 2F28A 1CRUA 2HT7A 4FPEA 4CSDA 1E8TA 2AEPA 1EURA 4HHQA 2H2NA 2VSKA 3H72A 3A9HA 1NSDA 4K1JA 4NC5A 2DSOA 1SO7A 4XHBA 1WCSA 4O5SA 4FPOB 4XYXA 2BATA 3T1EA 1X2JA 3SILA 2OJHA 3W09A 5FNTA 2IARA 1SLIA 2VSMA 2QWKA 4H52A 1B9TA 3LI5A 1A4QA 3WDZA 1S0IA 4KS3A 5M1ZA 1NCBN 2VWDA 1W8NA 1Q7FA 3D11A 4HZVA 4X6KA 1S18A 2IATA 4QNPA 4ZGCA 4XIOA 4MWQA 2QWEA 3G4EA 3TICA 1W20A 4GNCA 3A72A 4XILA 1USXA 4WEGA 4X4AA 1L7HA 2HTVA 3BEQA 4CPMA 1CVMA 3H73A 3A71A 2F29A 2IAQA 4A0PA 2IAXA 4M3MA 4B7JA 4XIKA 4GZTA 2W5NA 3KGGA 5EO7A 1MS3A 3SREA 2YA8A 4GB1A 4CPYA 4XMIA 1V2IA 1DIMA 3BYCA 4XMAA 4GDIA 1SNTA 4HW6A 1VCJA 4ZLRA 2FP8A 3ZGCA 2HU0A 3WWAA 3TI5A 1IVDA 3AMRA 5FNSA 4O5TA 2W38A 3KYAA 4DG6A 4G3NA 5B2CA 2ZB5A 1Z4VA 4XJZA 3LI4A 4HIZA 4D52B 1W1XA 1K32A 1V0FA 1INYA 2YDTA 4B7QA 2SIMA 2AH2A 1V0ZA 4JMLA 2F0ZA 1Z4WA 1V3DA 4FZHA 1SUUA 3SOQA 1H6LA 1RWIA 1X2RA 4MWVA 2X9MA 4YY8A 4GNBA 4D52A 4IFLX 1N6EA 1NPEA 4K1KA 4BBWA 1Z50A 1W0OA 4HZWA 4FPYA 1INWA 1INGA 5D9CA 2VK7A 3IAXA 2WOZA 2F27A 2H2UA 3V64C 2VPJA 2ISMA 4GDJA 1NMCA 3JU4A 3ALXA 1A14N 1MS9A 3O9JA 1IUCA 1Z4XA 2QWDA 2HTQA 2VW0A 4GJTA 1N1TA 1XOEA 3B7EA 1PJXA 1V3CA 4XJUA 4UOUA 4XJ9A 2FPBA 3K37A 2XZJA 4FPFA 2P4OA 4KS2A 1EUUA 4IYGA 2QE8A 2POOA 4XJWA 2XZKA 2JKBA 4MX0A 5HUMA 1MS5A 4QN5A 3TI3A 1E8UA 2HQSA 2F11A 3CKZA 3UC1A 2QWAA 4J9TA 3PJQA 5HX0A 4N1BA 4UF7A 1POOA 4PWZA 2IAPA 4I00A 4YW3A 4KS4A 5GX1A 1QBIA 2VW2A 3WW9A 4L7CA 3ZGDA 3CYEA 4YZ2A 4MZAA
chains in the Genus database with same CATH topology
4AH4A 4CSDA 4D4UA 4C1YB 4D52C 5EO8A 5EO7A 1IUCA 4AHAA 4D52B 4C1YA 5H47A 1IUBA 1OFZA 4AGIA 4D52A 4AGTA 4UOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AH4 A;  4CSD A;  4D4U A;  4C1Y B;  4D52 C;  5EO8 A;  5EO7 A;  1IUC A;  4AHA A;  4D52 B;  4C1Y A;  5H47 A;  1IUB A;  1OFZ A;  4AGI A;  4D52 A;  4AGT A;  4UOU A; 
#chains in the Genus database with same CATH topology
 3SOB B;  4FOW A;  3TI6 A;  4XJA A;  4MC7 A;  2HTR A;  1W8O A;  4M4U A;  1INX A;  2ZW9 A;  3S8Z A;  4DGR A;  2YA4 A;  1INH A;  2F24 A;  3ALW A;  2GVV A;  1V04 A;  2FPC A;  1IJQ A;  5GX2 A;  3LI3 A;  2VW1 A;  2FHR A;  3INB A;  2AGS A;  2HT5 A;  4IFN X;  3S8V A;  1N1V A;  1NCA N;  3SOV A;  1NSC A;  4YZ1 A;  4HZX A;  1NNC A;  4GZW A;  3NO0 A;  3H6J A;  2HU4 A;  1C9U A;  1IVB A;  2GHS A;  4FQ4 A;  4Q6K A;  3SLI A;  4B7N A;  1NNA A;  4HHO A;  3II7 A;  5FNQ A;  4WA5 A;  5FZJ A;  4H53 A;  3V65 B;  4K1I A;  1NMA N;  1S1D A;  3A9G A;  1L7F A;  4YW5 A;  3SAN A;  4XJR A;  4R40 A;  4CHB A;  1EUT A;  1V3B A;  5B2D A;  2YDP A;  5GTQ A;  1IVE A;  3TI8 A;  2Z32 A;  1ZGK A;  3ADE A;  4FP2 A;  3O9K A;  1F8E A;  1SLL A;  4QN3 A;  5FZN A;  5GX3 A;  4MZE A;  1DIL A;  3DR2 A;  5GX5 A;  5EX7 A;  2HTW A;  2QWI A;  1MWE A;  4FPJ A;  1N1Y A;  3HLH A;  2RKC A;  2BER A;  3Q6T A;  1MS0 A;  4FPH A;  4C1Y B;  4FJ6 A;  4SLI A;  4QN6 A;  1IUB A;  1NMB N;  3OPZ A;  1BJI A;  4GN7 A;  4D4U A;  4WA4 A;  2W8B B;  2IAO A;  2VK6 A;  2QWG A;  4GZQ A;  4XE9 A;  4FOY A;  3HLI A;  1V0E A;  3E5Z A;  4C1Y A;  4FOQ A;  4MWU A;  1MS1 A;  4FPK A;  1W21 A;  1N1S A;  3O4P A;  5H47 A;  2W8B A;  3K38 A;  2VAQ A;  1MS8 A;  3NN9 A;  1CQ1 A;  6NN9 A;  2AEQ A;  2FP9 A;  3L6V A;  4KS5 A;  2V91 A;  1F8B A;  2GVU A;  2F26 A;  4MWY A;  4YW2 A;  4GEZ A;  1NN2 A;  3DAS A;  4MWX A;  5NN9 A;  4X47 A;  4WA3 A;  1N7D A;  2XZI A;  4XJQ A;  3K36 A;  4K1H A;  4QN7 A;  3TI4 A;  2ZWA A;  4GZX A;  1WCQ A;  3SAL A;  5CGJ A;  3H71 A;  4AGI A;  1MZ6 A;  4MJV A;  2QWH A;  2F12 A;  1QLG A;  4NN9 A;  5FWW A;  2YA7 A;  5D9D A;  4FPG A;  4FOV A;  2B8H A;  4YZ5 A;  3HRP A;  1IVF A;  4K3Y A;  2F13 A;  3CL0 A;  2GVW A;  4JF7 A;  2F25 A;  4L7D A;  5HUN A;  2YA6 A;  1N6D A;  4XOG A;  2ZB6 A;  4GZO A;  4KS1 A;  3FW0 A;  4AH4 A;  3G4H A;  4WEF A;  1MR5 A;  1MS4 A;  4MWR A;  2QWC A;  3VNG A;  1WP5 A;  5GX4 A;  1NSB A;  1L7G A;  3Q6P A;  4ZY3 A;  2ZZK A;  4MWL A;  1NCC N;  3K39 A;  2YA5 A;  3TIB A;  1ZI0 A;  1CRZ A;  3NSS A;  2DYH A;  2CML A;  4XMB A;  1XOG A;  4CPZ A;  3GVL A;  2C4L A;  1NCD N;  4FP3 A;  2DG1 A;  2SIL A;  3GVJ A;  2QWF A;  3P5B L;  3FVZ A;  1E8V A;  2QWB A;  4B7M A;  1W0P A;  2HTU A;  2IVZ A;  5EO8 A;  2FLU X;  1NNB A;  1EUS A;  4MWJ A;  4D8S A;  4MJU A;  4IN4 A;  4AGT A;  1B9V A;  3I1C A;  2BZD A;  4NCS A;  4B7R A;  1MZ5 A;  4Q1U A;  4MWW A;  4GN9 A;  4CPN A;  4GZP A;  2F10 A;  5F72 C;  1IVG A;  3AMS A;  4FPL A;  4GZS A;  5HUK A;  3TC9 A;  4HZY A;  4X49 A;  4QN4 A;  4YW1 A;  3CL2 A;  1VCU A;  3D12 A;  2DG0 A;  4HZZ A;  1Z4Y A;  1F8C A;  3V1S A;  1U6D X;  1IVC A;  2IAU A;  2QWJ A;  7NN9 A;  1F8D A;  2W20 A;  2IAW A;  2HTY A;  2VVZ A;  3Q6K A;  3SRG A;  2W5O A;  2G8S A;  1B9S A;  4IFJ A;  3S2K A;  3U0S A;  2HT8 A;  3S94 A;  1V3E A;  4D52 C;  4IQK A;  1OFZ A;  1INV A;  4M4V A;  4YZ4 A;  4ASC A;  3B69 A;  3GVK A;  2IAS A;  1E1A A;  4CH9 A;  3VNH A;  1S0J A;  2VK5 A;  4GNA A;  2C4A A;  1C5K A;  1USR A;  5JYY A;  2A75 A;  2GVX A;  4CPO A;  4XJ8 A;  4XHX A;  1INF A;  5FNU A;  1A4G A;  1KIT A;  1Z4Z A;  4IMB A;  4FPC A;  3TIA A;  4CPL A;  2SLI A;  4AHA A;  5F9T A;  1RWL A;  1N6F A;  2IAV A;  4M4N A;  2XCY A;  4FVK A;  4YZ3 A;  5FNR A;  3WN7 A;  2XN4 A;  3K3A A;  5HUG A;  5D9B A;  4YW4 A;  4L7B A;  4GN8 A;  2BF6 A;  2F28 A;  1CRU A;  2HT7 A;  4FPE A;  4CSD A;  1E8T A;  2AEP A;  1EUR A;  4HHQ A;  2H2N A;  2VSK A;  3H72 A;  3A9H A;  1NSD A;  4K1J A;  4NC5 A;  2DSO A;  1SO7 A;  4XHB A;  1WCS A;  4O5S A;  4FPO B;  4XYX A;  2BAT A;  3T1E A;  1X2J A;  3SIL A;  2OJH A;  3W09 A;  5FNT A;  2IAR A;  1SLI A;  2VSM A;  2QWK A;  4H52 A;  1B9T A;  3LI5 A;  1A4Q A;  3WDZ A;  1S0I A;  4KS3 A;  5M1Z A;  1NCB N;  2VWD A;  1W8N A;  1Q7F A;  3D11 A;  4HZV A;  4X6K A;  1S18 A;  2IAT A;  4QNP A;  4ZGC A;  4XIO A;  4MWQ A;  2QWE A;  3G4E A;  3TIC A;  1W20 A;  4GNC A;  3A72 A;  4XIL A;  1USX A;  4WEG A;  4X4A A;  1L7H A;  2HTV A;  3BEQ A;  4CPM A;  1CVM A;  3H73 A;  3A71 A;  2F29 A;  2IAQ A;  4A0P A;  2IAX A;  4M3M A;  4B7J A;  4XIK A;  4GZT A;  2W5N A;  3KGG A;  5EO7 A;  1MS3 A;  3SRE A;  2YA8 A;  4GB1 A;  4CPY A;  4XMI A;  1V2I A;  1DIM A;  3BYC A;  4XMA A;  4GDI A;  1SNT A;  4HW6 A;  1VCJ A;  4ZLR A;  2FP8 A;  3ZGC A;  2HU0 A;  3WWA A;  3TI5 A;  1IVD A;  3AMR A;  5FNS A;  4O5T A;  2W38 A;  3KYA A;  4DG6 A;  4G3N A;  5B2C A;  2ZB5 A;  1Z4V A;  4XJZ A;  3LI4 A;  4HIZ A;  4D52 B;  1W1X A;  1K32 A;  1V0F A;  1INY A;  2YDT A;  4B7Q A;  2SIM A;  2AH2 A;  1V0Z A;  4JML A;  2F0Z A;  1Z4W A;  1V3D A;  4FZH A;  1SUU A;  3SOQ A;  1H6L A;  1RWI A;  1X2R A;  4MWV A;  2X9M A;  4YY8 A;  4GNB A;  4D52 A;  4IFL X;  1N6E A;  1NPE A;  4K1K A;  4BBW A;  1Z50 A;  1W0O A;  4HZW A;  4FPY A;  1INW A;  1ING A;  5D9C A;  2VK7 A;  3IAX A;  2WOZ A;  2F27 A;  2H2U A;  3V64 C;  2VPJ A;  2ISM A;  4GDJ A;  1NMC A;  3JU4 A;  3ALX A;  1A14 N;  1MS9 A;  3O9J A;  1IUC A;  1Z4X A;  2QWD A;  2HTQ A;  2VW0 A;  4GJT A;  1N1T A;  1XOE A;  3B7E A;  1PJX A;  1V3C A;  4XJU A;  4UOU A;  4XJ9 A;  2FPB A;  3K37 A;  2XZJ A;  4FPF A;  2P4O A;  4KS2 A;  1EUU A;  4IYG A;  2QE8 A;  2POO A;  4XJW A;  2XZK A;  2JKB A;  4MX0 A;  5HUM A;  1MS5 A;  4QN5 A;  3TI3 A;  1E8U A;  2HQS A;  2F11 A;  3CKZ A;  3UC1 A;  2QWA A;  4J9T A;  3PJQ A;  5HX0 A;  4N1B A;  4UF7 A;  1POO A;  4PWZ A;  2IAP A;  4I00 A;  4YW3 A;  4KS4 A;  5GX1 A;  1QBI A;  2VW2 A;  3WW9 A;  4L7C A;  3ZGD A;  3CYE A;  4YZ2 A;  4MZA A; 
#chains in the Genus database with same CATH homology
 4AH4 A;  4CSD A;  4D4U A;  4C1Y B;  4D52 C;  5EO8 A;  5EO7 A;  1IUC A;  4AHA A;  4D52 B;  4C1Y A;  5H47 A;  1IUB A;  1OFZ A;  4AGI A;  4D52 A;  4AGT A;  4UOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...