4DBMA

Aplysia californica-achbp in complex with triazole 18
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
211
structure length
211
Chain Sequence
b'DDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Generation of candidate ligands for nicotinic acetylcholine receptors via in situ click chemistry with a soluble acetylcholine binding protein template.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Acetylcholine-binding protein
total genus 51
structure length 211
sequence length 211
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4dbmA00
2Y54A 4BQTA 3RIFA 2X00A 3SQ6A 5J5IA 3PMZA 2W8FA 4FRRA 3WTJA 2BR8A 5KE4A 4ZRUA 3UU5A 3SQ9A 3ZKRA 2XQ4A 5LG3A 4UM1A 3TLWA 5AFMB 3LSVA 4ILAA 2BYRA 2Y7YA 2XYTA 2PGZA 4BFQA 2PH9A 3SIOA 4Z91A 5HCMA 1I9BA 3C84A 3RHWA 3TLTA 4Z90A 4D01A 4ZK1A 3IGQA 5HEHA 5AFNA 4HQPA 4TNVA 4QACA 2WNLA 3RQWA 4UY2A 4TWDA 3RIAA 4LMLA 4A97A 3U8LA 5HCJA 4A98A 2WZYA 2W8GA 2XYSA 3C79A 5L4EA 4DBMA 5J5HA 4QABA 5BP0A 4ILCA 4HFBA 2WNJA 2XNUA 4QH1A 2YMEA 3U8KA 2XQ8A 4AFHA 2WN9A 3PEOA 5HEOA 2BG9B 5AINA 2BG9C 5LXBA 4UM3A 2WNCA 5J5FA 2Y58A 4LMJA 5J0ZA 2XQAA 5FJVA 5AFMA 5AFKA 3WTNA 3ZDHA 4B5DA 2BJ0A 5AFHA 2BYNA 3UU8A 4IREA 5L4HA 4UM3P 5HEUA 2YN6A 4XHEA 5J5GA 3EAMA 3UU6A 4NPPA 5AFJA 4QH5A 2BG9E 4ZZBA 4ZZCA 4QAAA 4LMKA 3SH1A 2XQ3A 3RI5A 4IL9A 4HFIA 3JAEA 3JADA 3U8NA 5TVCA 2UZ6A 4WV9A 3UUBA 2ZJUA 5SYOA 4F8HA 4ILBA 3RQUA 3TLSA 3WTHA 2XZ5A 3WIPA 3TLVA 4ZK4A 1UX2A 4AFTA 2Y56A 5IUXA 4ALXA 2C9TA 4XK9A 4HFDA 3U8MA 2QC1B 4HFCA 3U8JA 2Y57A 4IL4A 5JMEA 3UQ7A 3WTMA 3P50A 4ZR6A 3WTLA 5CO5A 2BG9A 3UU3A 2BYQA 2YOEA 2VL0A 3UU4A 2BYPA 2XQ9A 2BR7A 4TWHA 4COFA 3JAFA 3EI0A 2X00D 3P4WA 4ZJSA 3T4MA 5BRXA 3WTOA 2YMDA 5L47A 5KZUA 2BYSA 4AFGA 2XNTA 4HFHA 5AFLA 5BW2A 4QH4A 4NZBA 4HFEA 5HEJA 3EHZA 1UW6A 4EZ1A 4TWFA 4UXUA 3UQ4A 3WTIA 3ZDGA 5HEGA 4TNWA 5CFBA 4PIRA 2XQ5A 4ZJTA 2XZ6A 2XQ7A 4X5TA 1UV6A 3GUAA 3WTKA 4UM3S 2XQ6A 2ZJVA 3TLUA 2XNVA 2YKSA
chains in the Genus database with same CATH superfamily
2Y54A 4BQTA 3RIFA 2X00A 3SQ6A 5J5IA 3PMZA 2W8FA 4FRRA 3WTJA 2BR8A 5KE4A 4ZRUA 3UU5A 3SQ9A 3ZKRA 2XQ4A 5LG3A 4UM1A 3TLWA 5AFMB 3LSVA 4ILAA 2BYRA 2Y7YA 2XYTA 2PGZA 4BFQA 2PH9A 3SIOA 4Z91A 5HCMA 1I9BA 3C84A 3RHWA 3TLTA 4Z90A 4D01A 4ZK1A 3IGQA 5HEHA 5AFNA 4HQPA 4TNVA 4QACA 2WNLA 3RQWA 4UY2A 4TWDA 3RIAA 4LMLA 4A97A 3U8LA 5HCJA 4A98A 2WZYA 2W8GA 2XYSA 3C79A 5L4EA 4DBMA 5J5HA 4QABA 5BP0A 4ILCA 4HFBA 2WNJA 2XNUA 4QH1A 2YMEA 3U8KA 2XQ8A 4AFHA 2WN9A 3PEOA 5HEOA 2BG9B 5AINA 2BG9C 5LXBA 4UM3A 2WNCA 5J5FA 2Y58A 4LMJA 5J0ZA 2XQAA 5FJVA 5AFMA 5AFKA 3WTNA 3ZDHA 4B5DA 2BJ0A 5AFHA 2BYNA 3UU8A 4IREA 5L4HA 4UM3P 5HEUA 2YN6A 4XHEA 5J5GA 3EAMA 3UU6A 4NPPA 5AFJA 4QH5A 2BG9E 4ZZBA 4ZZCA 4QAAA 4LMKA 3SH1A 2XQ3A 3RI5A 4IL9A 4HFIA 3JAEA 3JADA 3U8NA 5TVCA 2UZ6A 4WV9A 3UUBA 2ZJUA 5SYOA 4F8HA 4ILBA 3RQUA 3TLSA 3WTHA 2XZ5A 3WIPA 3TLVA 4ZK4A 1UX2A 4AFTA 2Y56A 5IUXA 4ALXA 2C9TA 4XK9A 4HFDA 3U8MA 2QC1B 4HFCA 3U8JA 2Y57A 4IL4A 5JMEA 3UQ7A 3WTMA 3P50A 4ZR6A 3WTLA 5CO5A 2BG9A 3UU3A 2BYQA 2YOEA 2VL0A 3UU4A 2BYPA 2XQ9A 2BR7A 4TWHA 4COFA 3JAFA 3EI0A 2X00D 3P4WA 4ZJSA 3T4MA 5BRXA 3WTOA 2YMDA 5L47A 5KZUA 2BYSA 4AFGA 2XNTA 4HFHA 5AFLA 5BW2A 4QH4A 4NZBA 4HFEA 5HEJA 3EHZA 1UW6A 4EZ1A 4TWFA 4UXUA 3UQ4A 3WTIA 3ZDGA 5HEGA 4TNWA 5CFBA 4PIRA 2XQ5A 4ZJTA 2XZ6A 2XQ7A 4X5TA 1UV6A 3GUAA 3WTKA 4UM3S 2XQ6A 2ZJVA 3TLUA 2XNVA 2YKSA
chains in the Genus database with same CATH topology
2Y54A 4BQTA 3RIFA 2X00A 3SQ6A 5J5IA 3PMZA 2W8FA 4FRRA 3WTJA 2BR8A 5KE4A 4ZRUA 3UU5A 3SQ9A 3ZKRA 2XQ4A 5LG3A 4UM1A 3TLWA 5AFMB 3LSVA 4ILAA 2BYRA 2Y7YA 2XYTA 2PGZA 4BFQA 2PH9A 3SIOA 4Z91A 5HCMA 1I9BA 3C84A 3RHWA 3TLTA 4Z90A 4D01A 4ZK1A 3IGQA 5HEHA 5AFNA 4HQPA 4TNVA 4QACA 2WNLA 3RQWA 4UY2A 4TWDA 3RIAA 4LMLA 4A97A 3U8LA 5HCJA 4A98A 2WZYA 2W8GA 2XYSA 3C79A 5L4EA 4DBMA 5J5HA 4QABA 5BP0A 4ILCA 4HFBA 2WNJA 2XNUA 4QH1A 2YMEA 3U8KA 2XQ8A 4AFHA 2WN9A 3PEOA 5HEOA 2BG9B 5AINA 2BG9C 5LXBA 4UM3A 2WNCA 5J5FA 2Y58A 4LMJA 5J0ZA 2XQAA 5FJVA 5AFMA 5AFKA 3WTNA 3ZDHA 4B5DA 2BJ0A 5AFHA 2BYNA 3UU8A 4IREA 5L4HA 4UM3P 5HEUA 2YN6A 4XHEA 5J5GA 3EAMA 3UU6A 4NPPA 5AFJA 4QH5A 2BG9E 4ZZBA 4ZZCA 4QAAA 4LMKA 3SH1A 2XQ3A 3RI5A 4IL9A 4HFIA 3JAEA 3JADA 3U8NA 5TVCA 2UZ6A 4WV9A 3UUBA 2ZJUA 5SYOA 4F8HA 4ILBA 3RQUA 3TLSA 3WTHA 2XZ5A 3WIPA 3TLVA 4ZK4A 1UX2A 4AFTA 2Y56A 5IUXA 4ALXA 2C9TA 4XK9A 4HFDA 3U8MA 2QC1B 4HFCA 3U8JA 2Y57A 4IL4A 5JMEA 3UQ7A 3WTMA 3P50A 4ZR6A 3WTLA 5CO5A 2BG9A 3UU3A 2BYQA 2YOEA 2VL0A 3UU4A 2BYPA 2XQ9A 2BR7A 4TWHA 4COFA 3JAFA 3EI0A 2X00D 3P4WA 4ZJSA 3T4MA 5BRXA 3WTOA 2YMDA 5L47A 5KZUA 2BYSA 4AFGA 2XNTA 4HFHA 5AFLA 5BW2A 4QH4A 4NZBA 4HFEA 5HEJA 3EHZA 1UW6A 4EZ1A 4TWFA 4UXUA 3UQ4A 3WTIA 3ZDGA 5HEGA 4TNWA 5CFBA 4PIRA 2XQ5A 4ZJTA 2XZ6A 2XQ7A 4X5TA 1UV6A 3GUAA 3WTKA 4UM3S 2XQ6A 2ZJVA 3TLUA 2XNVA 2YKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y54 A;  4BQT A;  3RIF A;  2X00 A;  3SQ6 A;  5J5I A;  3PMZ A;  2W8F A;  4FRR A;  3WTJ A;  2BR8 A;  5KE4 A;  4ZRU A;  3UU5 A;  3SQ9 A;  3ZKR A;  2XQ4 A;  5LG3 A;  4UM1 A;  3TLW A;  5AFM B;  3LSV A;  4ILA A;  2BYR A;  2Y7Y A;  2XYT A;  2PGZ A;  4BFQ A;  2PH9 A;  3SIO A;  4Z91 A;  5HCM A;  1I9B A;  3C84 A;  3RHW A;  3TLT A;  4Z90 A;  4D01 A;  4ZK1 A;  3IGQ A;  5HEH A;  5AFN A;  4HQP A;  4TNV A;  4QAC A;  2WNL A;  3RQW A;  4UY2 A;  4TWD A;  3RIA A;  4LML A;  4A97 A;  3U8L A;  5HCJ A;  4A98 A;  2WZY A;  2W8G A;  2XYS A;  3C79 A;  5L4E A;  4DBM A;  5J5H A;  4QAB A;  5BP0 A;  4ILC A;  4HFB A;  2WNJ A;  2XNU A;  4QH1 A;  2YME A;  3U8K A;  2XQ8 A;  4AFH A;  2WN9 A;  3PEO A;  5HEO A;  2BG9 B;  5AIN A;  2BG9 C;  5LXB A;  4UM3 A;  2WNC A;  5J5F A;  2Y58 A;  4LMJ A;  5J0Z A;  2XQA A;  5FJV A;  5AFM A;  5AFK A;  3WTN A;  3ZDH A;  4B5D A;  2BJ0 A;  5AFH A;  2BYN A;  3UU8 A;  4IRE A;  5L4H A;  4UM3 P;  5HEU A;  2YN6 A;  4XHE A;  5J5G A;  3EAM A;  3UU6 A;  4NPP A;  5AFJ A;  4QH5 A;  2BG9 E;  4ZZB A;  4ZZC A;  4QAA A;  4LMK A;  3SH1 A;  2XQ3 A;  3RI5 A;  4IL9 A;  4HFI A;  3JAE A;  3JAD A;  3U8N A;  5TVC A;  2UZ6 A;  4WV9 A;  3UUB A;  2ZJU A;  5SYO A;  4F8H A;  4ILB A;  3RQU A;  3TLS A;  3WTH A;  2XZ5 A;  3WIP A;  3TLV A;  4ZK4 A;  1UX2 A;  4AFT A;  2Y56 A;  5IUX A;  4ALX A;  2C9T A;  4XK9 A;  4HFD A;  3U8M A;  2QC1 B;  4HFC A;  3U8J A;  2Y57 A;  4IL4 A;  5JME A;  3UQ7 A;  3WTM A;  3P50 A;  4ZR6 A;  3WTL A;  5CO5 A;  2BG9 A;  3UU3 A;  2BYQ A;  2YOE A;  2VL0 A;  3UU4 A;  2BYP A;  2XQ9 A;  2BR7 A;  4TWH A;  4COF A;  3JAF A;  3EI0 A;  2X00 D;  3P4W A;  4ZJS A;  3T4M A;  5BRX A;  3WTO A;  2YMD A;  5L47 A;  5KZU A;  2BYS A;  4AFG A;  2XNT A;  4HFH A;  5AFL A;  5BW2 A;  4QH4 A;  4NZB A;  4HFE A;  5HEJ A;  3EHZ A;  1UW6 A;  4EZ1 A;  4TWF A;  4UXU A;  3UQ4 A;  3WTI A;  3ZDG A;  5HEG A;  4TNW A;  5CFB A;  4PIR A;  2XQ5 A;  4ZJT A;  2XZ6 A;  2XQ7 A;  4X5T A;  1UV6 A;  3GUA A;  3WTK A;  4UM3 S;  2XQ6 A;  2ZJV A;  3TLU A;  2XNV A;  2YKS A; 
#chains in the Genus database with same CATH topology
 2Y54 A;  4BQT A;  3RIF A;  2X00 A;  3SQ6 A;  5J5I A;  3PMZ A;  2W8F A;  4FRR A;  3WTJ A;  2BR8 A;  5KE4 A;  4ZRU A;  3UU5 A;  3SQ9 A;  3ZKR A;  2XQ4 A;  5LG3 A;  4UM1 A;  3TLW A;  5AFM B;  3LSV A;  4ILA A;  2BYR A;  2Y7Y A;  2XYT A;  2PGZ A;  4BFQ A;  2PH9 A;  3SIO A;  4Z91 A;  5HCM A;  1I9B A;  3C84 A;  3RHW A;  3TLT A;  4Z90 A;  4D01 A;  4ZK1 A;  3IGQ A;  5HEH A;  5AFN A;  4HQP A;  4TNV A;  4QAC A;  2WNL A;  3RQW A;  4UY2 A;  4TWD A;  3RIA A;  4LML A;  4A97 A;  3U8L A;  5HCJ A;  4A98 A;  2WZY A;  2W8G A;  2XYS A;  3C79 A;  5L4E A;  4DBM A;  5J5H A;  4QAB A;  5BP0 A;  4ILC A;  4HFB A;  2WNJ A;  2XNU A;  4QH1 A;  2YME A;  3U8K A;  2XQ8 A;  4AFH A;  2WN9 A;  3PEO A;  5HEO A;  2BG9 B;  5AIN A;  2BG9 C;  5LXB A;  4UM3 A;  2WNC A;  5J5F A;  2Y58 A;  4LMJ A;  5J0Z A;  2XQA A;  5FJV A;  5AFM A;  5AFK A;  3WTN A;  3ZDH A;  4B5D A;  2BJ0 A;  5AFH A;  2BYN A;  3UU8 A;  4IRE A;  5L4H A;  4UM3 P;  5HEU A;  2YN6 A;  4XHE A;  5J5G A;  3EAM A;  3UU6 A;  4NPP A;  5AFJ A;  4QH5 A;  2BG9 E;  4ZZB A;  4ZZC A;  4QAA A;  4LMK A;  3SH1 A;  2XQ3 A;  3RI5 A;  4IL9 A;  4HFI A;  3JAE A;  3JAD A;  3U8N A;  5TVC A;  2UZ6 A;  4WV9 A;  3UUB A;  2ZJU A;  5SYO A;  4F8H A;  4ILB A;  3RQU A;  3TLS A;  3WTH A;  2XZ5 A;  3WIP A;  3TLV A;  4ZK4 A;  1UX2 A;  4AFT A;  2Y56 A;  5IUX A;  4ALX A;  2C9T A;  4XK9 A;  4HFD A;  3U8M A;  2QC1 B;  4HFC A;  3U8J A;  2Y57 A;  4IL4 A;  5JME A;  3UQ7 A;  3WTM A;  3P50 A;  4ZR6 A;  3WTL A;  5CO5 A;  2BG9 A;  3UU3 A;  2BYQ A;  2YOE A;  2VL0 A;  3UU4 A;  2BYP A;  2XQ9 A;  2BR7 A;  4TWH A;  4COF A;  3JAF A;  3EI0 A;  2X00 D;  3P4W A;  4ZJS A;  3T4M A;  5BRX A;  3WTO A;  2YMD A;  5L47 A;  5KZU A;  2BYS A;  4AFG A;  2XNT A;  4HFH A;  5AFL A;  5BW2 A;  4QH4 A;  4NZB A;  4HFE A;  5HEJ A;  3EHZ A;  1UW6 A;  4EZ1 A;  4TWF A;  4UXU A;  3UQ4 A;  3WTI A;  3ZDG A;  5HEG A;  4TNW A;  5CFB A;  4PIR A;  2XQ5 A;  4ZJT A;  2XZ6 A;  2XQ7 A;  4X5T A;  1UV6 A;  3GUA A;  3WTK A;  4UM3 S;  2XQ6 A;  2ZJV A;  3TLU A;  2XNV A;  2YKS A; 
#chains in the Genus database with same CATH homology
 2Y54 A;  4BQT A;  3RIF A;  2X00 A;  3SQ6 A;  5J5I A;  3PMZ A;  2W8F A;  4FRR A;  3WTJ A;  2BR8 A;  5KE4 A;  4ZRU A;  3UU5 A;  3SQ9 A;  3ZKR A;  2XQ4 A;  5LG3 A;  4UM1 A;  3TLW A;  5AFM B;  3LSV A;  4ILA A;  2BYR A;  2Y7Y A;  2XYT A;  2PGZ A;  4BFQ A;  2PH9 A;  3SIO A;  4Z91 A;  5HCM A;  1I9B A;  3C84 A;  3RHW A;  3TLT A;  4Z90 A;  4D01 A;  4ZK1 A;  3IGQ A;  5HEH A;  5AFN A;  4HQP A;  4TNV A;  4QAC A;  2WNL A;  3RQW A;  4UY2 A;  4TWD A;  3RIA A;  4LML A;  4A97 A;  3U8L A;  5HCJ A;  4A98 A;  2WZY A;  2W8G A;  2XYS A;  3C79 A;  5L4E A;  4DBM A;  5J5H A;  4QAB A;  5BP0 A;  4ILC A;  4HFB A;  2WNJ A;  2XNU A;  4QH1 A;  2YME A;  3U8K A;  2XQ8 A;  4AFH A;  2WN9 A;  3PEO A;  5HEO A;  2BG9 B;  5AIN A;  2BG9 C;  5LXB A;  4UM3 A;  2WNC A;  5J5F A;  2Y58 A;  4LMJ A;  5J0Z A;  2XQA A;  5FJV A;  5AFM A;  5AFK A;  3WTN A;  3ZDH A;  4B5D A;  2BJ0 A;  5AFH A;  2BYN A;  3UU8 A;  4IRE A;  5L4H A;  4UM3 P;  5HEU A;  2YN6 A;  4XHE A;  5J5G A;  3EAM A;  3UU6 A;  4NPP A;  5AFJ A;  4QH5 A;  2BG9 E;  4ZZB A;  4ZZC A;  4QAA A;  4LMK A;  3SH1 A;  2XQ3 A;  3RI5 A;  4IL9 A;  4HFI A;  3JAE A;  3JAD A;  3U8N A;  5TVC A;  2UZ6 A;  4WV9 A;  3UUB A;  2ZJU A;  5SYO A;  4F8H A;  4ILB A;  3RQU A;  3TLS A;  3WTH A;  2XZ5 A;  3WIP A;  3TLV A;  4ZK4 A;  1UX2 A;  4AFT A;  2Y56 A;  5IUX A;  4ALX A;  2C9T A;  4XK9 A;  4HFD A;  3U8M A;  2QC1 B;  4HFC A;  3U8J A;  2Y57 A;  4IL4 A;  5JME A;  3UQ7 A;  3WTM A;  3P50 A;  4ZR6 A;  3WTL A;  5CO5 A;  2BG9 A;  3UU3 A;  2BYQ A;  2YOE A;  2VL0 A;  3UU4 A;  2BYP A;  2XQ9 A;  2BR7 A;  4TWH A;  4COF A;  3JAF A;  3EI0 A;  2X00 D;  3P4W A;  4ZJS A;  3T4M A;  5BRX A;  3WTO A;  2YMD A;  5L47 A;  5KZU A;  2BYS A;  4AFG A;  2XNT A;  4HFH A;  5AFL A;  5BW2 A;  4QH4 A;  4NZB A;  4HFE A;  5HEJ A;  3EHZ A;  1UW6 A;  4EZ1 A;  4TWF A;  4UXU A;  3UQ4 A;  3WTI A;  3ZDG A;  5HEG A;  4TNW A;  5CFB A;  4PIR A;  2XQ5 A;  4ZJT A;  2XZ6 A;  2XQ7 A;  4X5T A;  1UV6 A;  3GUA A;  3WTK A;  4UM3 S;  2XQ6 A;  2ZJV A;  3TLU A;  2XNV A;  2YKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...