4DCNC

Crystal structure analysis of the arfaptin2 bar domain in complex with arl1
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
193
structure length
193
Chain Sequence
SRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLLFHNAVSAYFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for membrane binding specificity of the Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin-2 determined by Arl1 GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
molecule keywords ADP-ribosylation factor-like protein 1
total genus 90
structure length 193
sequence length 193
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 4dcnC00
1Y2OA 2YKTA 3QWEA 3SYVA 2V0OA 4ATMA 3CAZA 4DYLA 5C5BB 3HAJA 3QE6A 1I4DA 1ZWWA 2Z0OA 3ACOA 3SOGA 3ABHA 2ELBA 2Z0NA 2RAKA 4BNEA 3Q84A 3QNIA 3I2WA 3PLTA 1I49A 3HAIA 1X03A 4I1QA 4NSWA 2D4CA 1I4TA 2Q12A 5C5BA 4AKVA 2Z0VA 2Q13A 4FZSA 4AVMA 3LLLA 1X04A 2EFKA 3HAHA 3Q0KA 4DCNC 4WPCA 4WPEA 2RAJA 3M3WA 4H8SA 2X3XA 1URUA 1I4LA 2FICA 4NQIA 2X3VA 2D1LA 3DYTA 2EFLA 3OK8A 2X3WA 1WDZA 2RAIA 3G9GA 2C08A
chains in the Genus database with same CATH superfamily
1JQKA 2YKTA 3DX2A 3F7WA 1SUFA 3QWEA 4B9QA 3D4YA 3CAZA 3DX4A 3QNJA 2Z0OA 3SOGA 1TQTA 4IM0A 3VEAA 3L3OM 2LXYA 4IWPA 3I01A 1OA0A 2GA9D 2RAKA 2Z0NA 3KAVA 4H6HA 1SU7A 4KIKB 4AZ6A 1QWNA 4BNEA 4EZTA 4R5LA 2YL5A 4JN4A 4IM3A 4EZXA 1I4TA 3EJTA 3T49A 3BUDA 1GNLA 2OBMA 2ALWA 2F7OA 2F18A 2Z0VA 4AZCB 4AVMA 3LLLA 2JNKA 1SU8A 2OO2A 3B52X 3LVTA 3Q0KA 4IW0A 2OW7A 4H8SA 3LMFA 3KAWA 4EZNA 2EWFA 4R5KA 2F7QA 4FZPA 2X3VA 1R5EA 2WYHA 4JNEA 4NPHA 1TQVA 3CV5A 2D1LA 1UPXA 3DX0A 2X3WA 3ER9B 1O7DC 4FM3A 2C08A 1ZYLA 4JNFA 4FZOA 4M0MA 3DDGA 4IM2A 2YI8A 3QE6A 2F7PA 1I4DA 3ACOA 3EJRA 4EZVA 1OA1A 1R33A 3BVTA 1E2UA 3O3OB 1U00A 3ABHA 2ND0A 4KIKA 4R5GA 4PO2A 3GI7A 3D4ZA 3Q84A 2OBLA 4AZBA 3A98A 1E1DA 1X03A 4I1QA 2D4CA 2Q12A 3EJSA 4G6QA 5C5BA 2PY6A 2YI9A 3EJUA 1W9MA 4JWEA 2F1BA 4UDYX 2O0I1 3VEBA 2YL9A 3D50A 4WPCA 4AZCA 1HTYA 3EJQA 2WYIA 3RV0A 2YIBA 3T4AG 3BVVA 3QA8A 3DDFA 2GF4A 4E3CA 2ZXQA 1HWWA 1DKXA 2X5CA 3DYTA 2QFFA 3BVXA 2MI7A 3B51X 4H6IA 4EZRA 2YLAA 2RAIA 4AZHA 3BUBA 2OW6A 4D8JA 3B53X 1Y2OA 1YWMA 3SYVA 4EZOA 2V0OA 4ATMA 3D52A 3ER8C 3O3MB 3T46A 2QXLA 2GAFD 3ERCC 2ELBA 3BUQA 3OWGA 4HR1B 5FLEX 3RPMA 3BUIA 4EZQA 3I2WA 4EZPA 3DPQA 3T47A 4NSWA 1DKYA 4EZYA 2QKWA 2RT6A 2YL6A 4AZIA 4IWQA 2NCZA 2N3KA 1GN9A 1TQWA 3DPPA 2PMRA 3HAHA 1HXKA 3L3PA 4FZSA 4JWIA 3EJPA 4DCNC 5KBPA 2RAJA 2F1AA 4HR1A 2ND1A 2X3XA 4F01A 1I4LA 2JNSA 2YL8A 2Z8YA 2LM0A 3CZNA 4EZSA 2FICA 3D2EA 1R34A 2F7RA 4F00A 4JWDA 4AZ7A 1WDZA 2OZNB 1E9VA 2FYVA 4UDXX 3T48A 3G9GA 1MJGA 2YIAA 1DKZA 4DYLA 4HYBA 5C5BB 3HAJA 3ZEDA 4R5IA 1ZWWA 3C7NA 4JL9A 3DPOA 3FD9A 1SU6A 3D2FA 4JWCA 4AZGA 3CVRA 4EZWA 3I04A 3QNIA 3VKHA 3PLTA 4AZ5A 1I49A 3HAIA 3KDRA 1OAOA 1QWUA 5E84A 4AKVA 5TKYA 2Q13A 1GNTA 1X04A 2EFKA 2EX3B 2YLLA 3BVUA 2WINM 3DX3A 4IWOA 4EZZA 2YIVX 4EZUA 4WPEA 3M3WA 3OHXM 1URUA 3CZSA 3BLBA 3UITA 3CKDA 3RV1A 4NQIA 1PS3A 3DX1A 1QX1A 3BUPA 3O3NB 1O7DB 2EFLA 3OK8A 4HY9A 3BVWA 1TQSA 1TQUA 3I39X 2KHOA 1LQ7A 4JLCA 3D51A 4E81A 5FIGA 4R5JA
chains in the Genus database with same CATH topology
1Y2OA 2YKTA 3QWEA 3SYVA 2V0OA 4ATMA 3CAZA 4DYLA 5C5BB 3HAJA 3QE6A 1I4DA 1ZWWA 2Z0OA 3ACOA 3SOGA 3ABHA 2ELBA 2Z0NA 2RAKA 4BNEA 3Q84A 3QNIA 3I2WA 3PLTA 1I49A 3HAIA 1X03A 4I1QA 4NSWA 2D4CA 1I4TA 2Q12A 5C5BA 4AKVA 2Z0VA 2Q13A 4FZSA 4AVMA 3LLLA 1X04A 2EFKA 3HAHA 3Q0KA 4DCNC 4WPCA 4WPEA 2RAJA 3M3WA 4H8SA 2X3XA 1URUA 1I4LA 2FICA 4NQIA 2X3VA 2D1LA 3DYTA 2EFLA 3OK8A 2X3WA 1WDZA 2RAIA 3G9GA 2C08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y2O A;  2YKT A;  3QWE A;  3SYV A;  2V0O A;  4ATM A;  3CAZ A;  4DYL A;  5C5B B;  3HAJ A;  3QE6 A;  1I4D A;  1ZWW A;  2Z0O A;  3ACO A;  3SOG A;  3ABH A;  2ELB A;  2Z0N A;  2RAK A;  4BNE A;  3Q84 A;  3QNI A;  3I2W A;  3PLT A;  1I49 A;  3HAI A;  1X03 A;  4I1Q A;  4NSW A;  2D4C A;  1I4T A;  2Q12 A;  5C5B A;  4AKV A;  2Z0V A;  2Q13 A;  4FZS A;  4AVM A;  3LLL A;  1X04 A;  2EFK A;  3HAH A;  3Q0K A;  4DCN C;  4WPC A;  4WPE A;  2RAJ A;  3M3W A;  4H8S A;  2X3X A;  1URU A;  1I4L A;  2FIC A;  4NQI A;  2X3V A;  2D1L A;  3DYT A;  2EFL A;  3OK8 A;  2X3W A;  1WDZ A;  2RAI A;  3G9G A;  2C08 A; 
#chains in the Genus database with same CATH topology
 1JQK A;  2YKT A;  3DX2 A;  3F7W A;  1SUF A;  3QWE A;  4B9Q A;  3D4Y A;  3CAZ A;  3DX4 A;  3QNJ A;  2Z0O A;  3SOG A;  1TQT A;  4IM0 A;  3VEA A;  3L3O M;  2LXY A;  4IWP A;  3I01 A;  1OA0 A;  2GA9 D;  2RAK A;  2Z0N A;  3KAV A;  4H6H A;  1SU7 A;  4KIK B;  4AZ6 A;  1QWN A;  4BNE A;  4EZT A;  4R5L A;  2YL5 A;  4JN4 A;  4IM3 A;  4EZX A;  1I4T A;  3EJT A;  3T49 A;  3BUD A;  1GNL A;  2OBM A;  2ALW A;  2F7O A;  2F18 A;  2Z0V A;  4AZC B;  4AVM A;  3LLL A;  2JNK A;  1SU8 A;  2OO2 A;  3B52 X;  3LVT A;  3Q0K A;  4IW0 A;  2OW7 A;  4H8S A;  3LMF A;  3KAW A;  4EZN A;  2EWF A;  4R5K A;  2F7Q A;  4FZP A;  2X3V A;  1R5E A;  2WYH A;  4JNE A;  4NPH A;  1TQV A;  3CV5 A;  2D1L A;  1UPX A;  3DX0 A;  2X3W A;  3ER9 B;  1O7D C;  4FM3 A;  2C08 A;  1ZYL A;  4JNF A;  4FZO A;  4M0M A;  3DDG A;  4IM2 A;  2YI8 A;  3QE6 A;  2F7P A;  1I4D A;  3ACO A;  3EJR A;  4EZV A;  1OA1 A;  1R33 A;  3BVT A;  1E2U A;  3O3O B;  1U00 A;  3ABH A;  2ND0 A;  4KIK A;  4R5G A;  4PO2 A;  3GI7 A;  3D4Z A;  3Q84 A;  2OBL A;  4AZB A;  3A98 A;  1E1D A;  1X03 A;  4I1Q A;  2D4C A;  2Q12 A;  3EJS A;  4G6Q A;  5C5B A;  2PY6 A;  2YI9 A;  3EJU A;  1W9M A;  4JWE A;  2F1B A;  4UDY X;  2O0I 1;  3VEB A;  2YL9 A;  3D50 A;  4WPC A;  4AZC A;  1HTY A;  3EJQ A;  2WYI A;  3RV0 A;  2YIB A;  3T4A G;  3BVV A;  3QA8 A;  3DDF A;  2GF4 A;  4E3C A;  2ZXQ A;  1HWW A;  1DKX A;  2X5C A;  3DYT A;  2QFF A;  3BVX A;  2MI7 A;  3B51 X;  4H6I A;  4EZR A;  2YLA A;  2RAI A;  4AZH A;  3BUB A;  2OW6 A;  4D8J A;  3B53 X;  1Y2O A;  1YWM A;  3SYV A;  4EZO A;  2V0O A;  4ATM A;  3D52 A;  3ER8 C;  3O3M B;  3T46 A;  2QXL A;  2GAF D;  3ERC C;  2ELB A;  3BUQ A;  3OWG A;  4HR1 B;  5FLE X;  3RPM A;  3BUI A;  4EZQ A;  3I2W A;  4EZP A;  3DPQ A;  3T47 A;  4NSW A;  1DKY A;  4EZY A;  2QKW A;  2RT6 A;  2YL6 A;  4AZI A;  4IWQ A;  2NCZ A;  2N3K A;  1GN9 A;  1TQW A;  3DPP A;  2PMR A;  3HAH A;  1HXK A;  3L3P A;  4FZS A;  4JWI A;  3EJP A;  4DCN C;  5KBP A;  2RAJ A;  2F1A A;  4HR1 A;  2ND1 A;  2X3X A;  4F01 A;  1I4L A;  2JNS A;  2YL8 A;  2Z8Y A;  2LM0 A;  3CZN A;  4EZS A;  2FIC A;  3D2E A;  1R34 A;  2F7R A;  4F00 A;  4JWD A;  4AZ7 A;  1WDZ A;  2OZN B;  1E9V A;  2FYV A;  4UDX X;  3T48 A;  3G9G A;  1MJG A;  2YIA A;  1DKZ A;  4DYL A;  4HYB A;  5C5B B;  3HAJ A;  3ZED A;  4R5I A;  1ZWW A;  3C7N A;  4JL9 A;  3DPO A;  3FD9 A;  1SU6 A;  3D2F A;  4JWC A;  4AZG A;  3CVR A;  4EZW A;  3I04 A;  3QNI A;  3VKH A;  3PLT A;  4AZ5 A;  1I49 A;  3HAI A;  3KDR A;  1OAO A;  1QWU A;  5E84 A;  4AKV A;  5TKY A;  2Q13 A;  1GNT A;  1X04 A;  2EFK A;  2EX3 B;  2YLL A;  3BVU A;  2WIN M;  3DX3 A;  4IWO A;  4EZZ A;  2YIV X;  4EZU A;  4WPE A;  3M3W A;  3OHX M;  1URU A;  3CZS A;  3BLB A;  3UIT A;  3CKD A;  3RV1 A;  4NQI A;  1PS3 A;  3DX1 A;  1QX1 A;  3BUP A;  3O3N B;  1O7D B;  2EFL A;  3OK8 A;  4HY9 A;  3BVW A;  1TQS A;  1TQU A;  3I39 X;  2KHO A;  1LQ7 A;  4JLC A;  3D51 A;  4E81 A;  5FIG A;  4R5J A; 
#chains in the Genus database with same CATH homology
 1Y2O A;  2YKT A;  3QWE A;  3SYV A;  2V0O A;  4ATM A;  3CAZ A;  4DYL A;  5C5B B;  3HAJ A;  3QE6 A;  1I4D A;  1ZWW A;  2Z0O A;  3ACO A;  3SOG A;  3ABH A;  2ELB A;  2Z0N A;  2RAK A;  4BNE A;  3Q84 A;  3QNI A;  3I2W A;  3PLT A;  1I49 A;  3HAI A;  1X03 A;  4I1Q A;  4NSW A;  2D4C A;  1I4T A;  2Q12 A;  5C5B A;  4AKV A;  2Z0V A;  2Q13 A;  4FZS A;  4AVM A;  3LLL A;  1X04 A;  2EFK A;  3HAH A;  3Q0K A;  4DCN C;  4WPC A;  4WPE A;  2RAJ A;  3M3W A;  4H8S A;  2X3X A;  1URU A;  1I4L A;  2FIC A;  4NQI A;  2X3V A;  2D1L A;  3DYT A;  2EFL A;  3OK8 A;  2X3W A;  1WDZ A;  2RAI A;  3G9G A;  2C08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...