4DDKA

Pantothenate synthetase in complex with 1,3-benzodioxole-5-carboxylic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
289
structure length
289
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated biophysical approach to fragment screening and validation for fragment-based lead discovery.
pubmed doi rcsb
molecule keywords Pantothenate synthetase
molecule tags Ligase/ligase inhibitor
source organism Mycobacterium tuberculosis
total genus 97
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4ddkA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4ddkA01
1YI8A 4JZYA 3ZUGA 1EFPB 4MW7A 3PRHA 2J08A 3JXEA 4ARCA 4EFKA 1A8HA 2QJTA 2YY5A 4JYZA 2JANA 5LM3A 3IOBA 3G59A 4EG6A 4S1OA 1O5TA 4I6GA 1I6LA 3OP1A 2X0KA 1JIKA 2DR2A 5FO1A 2QTRA 1FFYA 1MJHA 2GKSA 2DUMA 1GN8A 1M83A 4G6ZA 3COVA 2X3FA 1GTRA 5EKDA 3TZEA 1I6KA 4PBRA 1TYBE 4EG5A 4MW4A 2VXOA 3SEZA 4KPUA 3SDBA 1N2GA 1N2IA 1KP2A 3CLTD 1O94D 3SEQA 3UOWA 4MUHA 4MWEA 1VBMA 1GLNA 4MW0A 2DPLA 3FDXA 1NI5A 2E21A 1COZA 4ZCRA 3IMGA 4YP6A 2AZXA 4ZCPA 2V0CA 4NATA 4G5YA 1O96B 3H97A 1PG2A 2JA2A 4CT0A 1N78A 2OV4A 3LOQA 3FIUA 1QNFA 4MVCA 1J21A 3N9IA 4KR7A 1M8PA 2G36A 1P7PA 3SZGA 3DV2A 3ND7A 3D6VA 3LCJA 4KKVA 3ZJTA 1WXGA 4CDNA 3HZRA 1I6MA 1N2EA 4XFDA 2C5SA 2BYTA 4MUGA 4PY2A 1R6UA 1MAUA 1EUYA 3ND6A 1QU2A 2DEUA 3A05A 2Z3VA 3NBKA 4QREA 1OWLA 4DNXA 2WSIA 3PXUA 2J4DA 2HZ7A 1JZSA 1X6VA 1KH3A 2E0IA 4Q93A 2V0GA 1J20A 2CT8A 1BS2A 4EGAA 1XNGA 1J09A 1TYDE 1O95D 4MLPA 4YBRA 3SYTA 1F7UA 2ZUEA 1QRTA 2A1UB 4HJXA 3FI0A 4MQ6A 1EFPA 1JIIA 1H3FA 2XRYA 3AIIA 4BWVA 3Q10A 2CUZA 4MVWA 4ZT3A 1NUQA 3FOCA 4FZJA 1MC1A 1XJQA 1KR2A 4GRIA 4RUKA 1IQUA 2EL7A 4R2MA 4MWDA 2Z09A 5F23A 4CDMA 2QUKA 2HMAA 3H99A 2XRZA 5FNZA 1MAWA 2H29A 3CLUD 4MULA 1KORA 3H9BA 4MWCA 3K32A 2DXIA 4MAFA 3C8ZA 3MUEA 1YUMA 4NAHA 1NUTA 1TYAE 2H2AA 1ZH0A 1GZUA 1OWNA 1WXIA 4PBTA 4UZFA 4MUKA 2PZBA 4OUDB 1OWOA 1H3EA 4AQ7A 1G59A 4UZEA 1VL2A 3COYA 5IHXA 1U3CA 3HL4A 5J58A 4K03A 1TYCA 4ZT6A 1KAQA 3DPIA 3Q4GA 4R2LA 3X1MA 1ZJWA 1M8GA 2PZ8A 4JXXA 3LE8A 1HYBA 5H16A 4MW5A 1K92A 3TQIA 2Z08A 1OD6A 4MVXA 2PG3A 5HUHA 1O6BA 1J1UA 1Q15A 3H9CA 1K97A 3E27A 4A91A 1S4MA 1IH8A 2J09A 1O96A 3RHSA 3CVUA 2BTEA 2A7XA 1T9GR 4ND6A 2J07A 3FNRA 3Q12A 4YP5A 4XFJA 1WQ4A 2GOYA 4F4HA 1F7VA 3TNJA 1PG0A 5HG0A 3CVVA 3PNBA 1PFWA 1N2OA 1EE1A 4EF6A 4NAUA 4GU5A 2QUIA 4ZCTA 3A2KA 3UMVA 3ZXSA 2D13A 1LW7A 3HV0A 3P0JA 1J70A 3P0IA 4CQNA 4XSVA 1Q11A 2VTBB 3NV7A 2QJOA 3CLTC 1XNHA 1O94C 2DERA 2PXHA 4MW2A 5DK4A 1QTQA 3AFHA 5BNZA 4G5FA 1Q19A 2YXNA 2NSYA 4J75A 2E89A 1QU3A 3ZXIA 1I2DA 1NUSA 2QTMA 3CVYA 1GAXA 2RD2A 3MMXA 1DNPA 1ZH6A 1M8KA 1OWMA 3A4IA 4MUJA 3DLAA 2WQ7A 3TQOA 4ARIA 2A1UA 1V47A 5LLTA 1WKBA 1MB2A 5DB4A 5HUJA 3CLSD 4WNYA 1X8XA 3U1VA 4DDKA 3IOCA 3VU8A 1N77A 2OQ2A 4ZCSA 1NUPA 4NDAA 1WQ3A 1JILA 4EG1A 4H3SA 5H7XA 4JFAA 3VGJA 2JAXA 3AG6A 1QJCA 1QRUA 1UFVA 4X0EA 2NZ2A 1MBZA 3CLRD 1PFVA 1FYDA 3AL0C 1TEZA 1N1DA 1KAMA 1T9GS 1WJGA 3ND5A 4ZT2A 4I6JA 1EJ2A 1NUUA 5KCMA 3KT8A 5TEVA 1YIDA 1IVSA 3FG9A 3TZLA 3FETA 3QTBA 2E18A 1M8FA 1KH2A 1WXHA 1H1TA 2YWBA 3SP1A 2A86A 1KKUA 1GPMA 3G5AA 4OUDA 1JIJA 4EG3A 2RE8A 4EG4A 3ISJA 1Q77A 5K0SA 4DDHA 1JEEA 1PFYA 4MUEA 2A4MA 4HK4A 2YWCA 1O95C 3COWA 3M5WA 5TS2A 4MUNA 1MRZA 1LI7A 3RK1A 1IRXA 1Y42X 4TS1A 2IELA 4Q16A 4ZT7A 4ND7A 4QRDA 3P52A 1WXFA 1XNJA 2WB2A 1U3DA 1VBKA 2PZAA 5IJXA 3IMEA 2A88A 2R5WA 3RK0A 4DLPA 1QRSA 3PNVA 3TS1A 4QBTA 1ULHA 2AKEA 2PIDA 1O97D 3FY4A 4K0RA 1JMVA 1SURA 4WSOA 1VBNA 2WQ6A 2I1LA 4ZT4A 1B6TA 3FH0A 4ZT5A 2J5BA 3QE4A 1JECA 3G6KA 1JGTA 1NYLA 1KP3A 4RPIA 1PFUA 1EFVB 2VTBA 1G8FA 3L92A 4I6EA 4ZCQA 1WXEA 1H3NA 5FO0A 3COZA 2QTNA 5DASA 3ZIUA 5K0TA 3N8HA 4PBSA 1G8GA 2CYCA 4OJMX 1KQOA 3AG5A 1TQ8A 3SZ3A 3L93A 3IH5A 4U63A 3RBAA 3S3TA 1U0BB 3ZJUA 1V8FA 1KQPA 5TGTA 4L2IB 3KT3A 3IOEA 3IDFA 4KR6A 2CYAA 1IHOA 3I05A 1O0BA 3INNA 1N75A 5J59A 1U7XA 3DO8A 1EXDA 1VLHA 2A1TS 1ZUNA 3NBAA 3X1KA 4P2BA 4U7JA 4MUIA 1K4MA 3MLAA 4DJAA 3N05A 1GTSA 3F3MA 3QTTA 1YIAA 1M8JA 4U8HA 1YUNA 2A84A 4HJRA 4EG7A 3ILVA 1NURA 4MW1A 3UC5A 3ZGZA 1MOPA 1T6ZA 2X1MA 4R0NA 4J76A 3K9WA 1WOYA 1U7DA 2QUJA 5JBNA 2AG6A 4EG8A 3IODA 3ZJVA 2B7LA 1O0CA 3D6UA 1JHDA 1KH1A 4NZPA 2CFOA 1N2HA 1YULA 3FHJA 2O8VA 1LI5A 1TFUA 4MW9A 1N3LA 3BL5A 1OBHA 3H05A 2IJGX 3OTWA 3HMQA 2EJCA 3CR8A 3CLSC 2CSXA 1F9AA 3IVGA 1CT9A 2D5BA 4HPWA 1WZ2A 1D2RA 2IP1A 2ZUFA 2QUHA 4KPUB 2HGZA 3IVCA 3MXTA 3IUEA 1G8HA 1N2JA 1NSYA 1KQNA 1WY5A 2DLCX 2PFSA 3P0HA 2QJFA 1ILEA 2X1LA 3CLRC 3UK2A 1F4LA 1OBCA 5LFAA 5AHWA 4AS1A 1M1ZA 4NX2A 2GM3A 1N2BA 3N2YA 1T6XA 2ZP1A 3CVWA 3ELBA 1OWPA 1EFVA 5KHAA 2D54A 1R6TA 1JZQA 1J1ZA 2A1TR 4MW6A 3CA8A 1IQ0A 3HGMA 5KWVA 3KT6A 3FWKA 2CYBA 5DEOA 3IUBA 3KFLA 1R6XA 3X1JA 3RFFA 4YP7A 1K4KA 1MB9A 4MWBA 2CV0A 3RJZA 4DE5A 5TEWA 3HFJA 1IQRA 4YMIA 1NZJA 1RQGA 4L2IA 3AKZA 3MLBA 2CV1A 4MVYA 5J5AA 3CLUC 1QQTA 3IMCA 3A04A 3CVXA 4MUFA 4KR9A 3PNYA 4F3RA 4E1AA 3GLVA 1O97C 1T6YA 2O5RA 3UY4A 3GMIA 3IVXA 1NP7A 2CV2A 1JEDA 1IFXA 3VRHA 2DETA 4JXZA 3GUZA 4DDMA 3KT0A 1EUQA 2TS1A
chains in the Genus database with same CATH superfamily
1NQXA 2OZKA 3GJRA 1HDYA 3GRZA 4F9EA 1GQYA 4B6JA 1EFPB 2RC6A 4BNTA 2INGX 2ZJ8A 4TROA 4RH3A 2OHXA 5K3OA 3IELA 1RXVA 1SD2A 4N18A 1ZR4A 2OZLA 2X9QA 3PQDA 5AKZA 4IDOA 1BD4A 2EFYA 2HK8A 3M0EA 4LDJA 4P4GA 5LA6B 5KVQA 4MKZA 1SQ6A 5LM3A 1NP6A 2J9FA 4KE7A 4NZMA 4QFDA 3S0JA 4CM9A 2NQ8A 4LVCA 5BRJA 4MITA 3AERA 4TM7A 5JSZA 3M6UA 1NOIA 1N3BA 2FZVA 3TX6A 3USZA 2RBKA 1PQPA 2H5LA 3DFZA 4B6OA 1FFYA 2DFNA 2O4CA 2CLDX 2ZVJA 4IGAA 4CVNA 2O1WA 4RY9A 5J4HA 1YZYA 3I3SR 2WHPA 2ID9A 4HDCA 2D3WA 4QECA 5EAIA 1GTRA 1FMFA 1C7RA 4NFYA 2R66A 1MJ5A 4MWTA 1L4EA 1C7FA 5C8DA 4RPJA 3E0XA 1WKCA 4NBWA 4C88A 5B3JA 3R3ZA 2PBRA 3GUVA 1WP9A 4K0KB 1NY6A 2F43B 5PNTA 2PD3A 1WHTB 3GEEA 2RGAA 2PZKA 5JALA 3H3FA 4CEIB 3ZW7A 4XVUA 1T2CA 4F3YA 2VPYA 1MAHA 2UYOA 2BGIA 1TJ4A 1KPGA 3V2HA 5G0TA 4F97A 5C4MA 4B7AA 2X0NA 4RJKA 2OXCA 4KDCA 4UJ3A 4ZGGA 4JXKA 3ZZTA 2EBUA 2W98A 3OZCA 3ZNOA 2AI2A 4ZXFA 3V4PB 1SHLA 1XTVA 1U2DA 1M74A 3JSAA 4GYWA 1FE8A 1ZHHA 4TTPA 3U3ZA 4C29A 1WVMA 1AHPA 4DQUA 3K70D 3DH0A 2G1JA 4WECA 1QP0A 5CX1B 2DWUA 3PX7A 1RJGA 4L6IA 1QIHA 1ZWLA 4TV9B 1X3LA 2VF7A 3VKUA 3D8TA 3CMMA 3I6MA 3PTAA 2ZRJA 5A0VA 1PQWA 3SJ7A 1IEWA 1ZYUA 5C1PA 2ZM5A 4LZPA 1XXHE 4EA9A 3WQQA 2XMQA 3X1WA 3HVRA 1PQYA 1QZXA 1Q0UA 2VUIB 4RZHA 4QOGA 2YJ3A 1SEPA 3IDQA 4G4IA 1FYWA 3G5MA 2X76A 2B5OA 3PEYA 2D3TA 1Z2CA 3D6VA 3LCJA 3ZJTA 1CUDA 1C8LA 4W99A 3QBJA 1Q7EA 4NEHB 2HT1A 4C78A 4LRTB 1ZDMA 4FDLA 4KXWA 3OD1A 3F46A 2P9JA 4UEJA 3EDMA 4BKPA 4LZNA 4G0YA 4DMLA 1F1JA 1CVIA 4JVLA 4M1MA 1YL5A 4HNUA 1PD1A 2TECE 3J7TA 2GO7A 2ID4A 5DNWA 3Q1KA 2A52A 1PWEA 1VYHA 1Y82A 2ZS7A 2OHOA 3CY6A 4MPRA 3SDZA 3VHRA 3OOHA 2CMFA 4W1RA 4XRGA 2OK7A 1HF3A 2B8EA 2LMEA 1XMSA 3DTTA 5DHUA 1O95D 5FTMA 4YP1A 2ZIXB 5EERA 2HNBA 5DT9A 1JIIA 1F3LA 1AUOA 1R5OA 3DDZX 3R3JA 3AP1A 3IDAA 3VYWA 4AYTA 1UBOS 3Q10A 2HFJA 2ZWVA 3B1ZA 3D2AA 4DLAA 4NESA 4XASA 5GZ1A 1S01A 3CXUA 4M99A 4DEYA 2H1LA 4W9MC 3GQVA 2PKQP 1U28C 5CBKA 2OQVA 4M7PA 4QYIA 3W3ZB 1FLDA 2GXUA 2VPTA 2P65A 4H1TA 2I71A 3N8IA 4P98A 1JSLA 2VWPA 1CIPA 2E1RA 4KVGA 4L57A 4U1RA 4BEBA 5BV0A 2EZ4A 2Z8YM 2RHLA 2QNBA 1Z5WA 2AFRA 4LY0A 4PX5A 3SIRA 3BRSA 4KBGA 4R40A 2Q8NA 4JITA 4R3WA 1FVXA 3O9MA 4MWCA 4PZZA 4MULA 1X9GA 4RWZA 4XD7D 4YAUA 4J43A 1L5RA 5F9MA 1HTTA 4MAFA 1T34A 1Y3FE 1NLMA 5KWIA 3CXRA 3IPXA 4PQGA 2X8LA 4RXMA 1ZH0A 3B52X 1WXIA 4UTVA 4AY2A 4IZIA 5TT0A 4JIGA 4GPD1 2FF7A 2PZBA 2QRVB 3NTUA 1YCHA 3FYUB 1GNLA 4R1QA 1JTFA 1YBHA 1LY1A 1VLZA 1M2GA 3CF4A 4IGKA 4EZEA 4Q02A 4BBAA 4ZI3A 1VIMA 3L7IA 2I1WA 3BMNB 1KMHB 3C98A 2W0MA 1KAQA 3MWFA 4MNTA 5JLAA 1IEVA 1MXHA 1RR6A 2W2VA 5LSAA 4KQ1A 2HMSA 3IAUA 5DBFA 2GPAA 2N46A 1U0OC 3L40A 1NPTO 4RXTA 3W5IA 3DEFA 5G0VA 2UYCA 1TU4A 4EMSA 3LY7A 3HBJA 1GQRA 5BW0B 4Q24A 3ETJA 4ISBA 1K2VN 2EX1A 2H08A 3GLUA 3E03A 4I14A 1LXCA 2Z98A 5HUHA 1QCDA 4RK7A 2ZJ1A 3KJEA 3L8DA 4MRNA 4DAEA 4QDKA 2FPXA 5K20A 2FZKA 1JYSA 2GKGA 2AXEA 2BM8A 1H5UA 1O96A 2ODPA 3KQQA 1QKJA 3K9GA 3ZWBA 1ZSYA 5CBPB 1NZFA 2IUTA 5KDDA 4CM4A 1VE3A 1XDUA 3QE0A 4YP5A 1GKIA 3RJTA 5JNVA 4EENA 3A4VA 2D2EA 2FPRA 2CF5A 5FBLB 1BS1A 5BVGA 3C24A 4AXBA 4ZO8A 3GFPA 1JH8A 3VTZA 1UKAA 3NETA 4CG2A 2RHOA 4D3ZA 5J5VA 3CEAA 2IS4A 1ZS9A 4Z99A 1VBFA 3PE6A 5J63A 2WB4A 3MQFA 3DOOA 4QU0A 2A0WA 2P2LA 4ZOBA 3RUHA 5B2FA 2H92A 1CF4A 4PGFA 4IP0A 4FR2A 4UCFA 5C51B 1JHMA 1NM5A 1ATZA 4PS0A 5KYNA 2XVZA 1WUYA 5WRFA 2OYRA 1TX4B 3VGPA 1U8TA 1Y80A 3LKZA 2J9YB 4QL3A 1YGPA 3UCXA 4RVSA 4UDNA 4WBXC 1HNWB 3EQ2A 2QTMA 2PZGA 2D7DA 1NVAA 3KQSA 4DNPA 1CEYA 3COJA 5BSTA 3V4SA 1SD1A 4GI7A 1L5MA 3CZQA 3DT8A 2QSJA 3T3OA 3AIOA 4EDHA 3NYIA 4RZUA 3QKWA 4FBGA 1E2KA 3RWOA 5GY7A 3H9QA 3FOWA 3TQOA 5KKCA 2FPPB 1HE1C 3IP3A 1NQTA 3Q9UA 1W4ZA 5BSVA 1XEAA 1XNRB 1V47A 4LBWA 1YS7A 2PGLA 2BRUA 3NUGA 3G3EA 3GD5A 4C6SA 2Q9CA 4IIJF 4PHCA 1D2HA 1M0TA 1SVWA 1KK2A 1X8KA 4MO2A 3CURA 3QLEA 1L1RA 2OPHA 3FROA 5AVZA 3GGOA 3WJ2A 2O0KA 5LP6C 3ECSA 4E32A 2GFHA 4M0KA 3EOBI 2C9BA 3AG6A 3RLIA 2QRLA 4CCWA 1W4CA 4R7GA 2FB9A 2YWXA 2IZ0A 3T9DA 3MFYA 4HAWA 5LZ2A 1OPRA 4RESA 4BMOB 3AL0C 1GADO 2R68A 2RGYA 5EXTA 5ICSA 4D26A 4URHA 4MKFA 4NZ9A 2NVOA 5KCMA 2QTVB 2NW6A 3HY4A 3OCVA 1YJCA 4ND3A 1SXHA 3C6XA 1N4AA 1K89A 1B23P 2ACEA 3FETA 4OHYA 4N9WA 3NWEA 2YX1A 1WXHA 1H1TA 4R6WA 5G40A 2PUGA 1WCWA 2DOKA 1QIIA 2IUYA 2YWBA 4KI7A 3HP1A 5D86A 1OX6A 4IWNA 1RFLA 4RTSA 1KJ8A 5CYOA 2O4UX 3SC2A 5JXWA 3NEJA 3FNEA 3QENA 4CM9D 1GZSA 1WVGA 2FWJA 2ZIVB 1NN1A 3N2LA 3BJZA 4ZI7F 4PSKA 1TF2A 4MUEA 3AFMA 3I2GA 4TWJA 2C7OA 1W4BA 3H2SA 4E21A 1VOTA 2NPFA 3MINB 2BMWA 3KQPA 3OC6A 4HDNA 5DTEA 6REQA 2YV1A 5HKAA 1FX1A 1UC5B 3VISA 4F7DA 5FWNA 3VJRA 3O74A 1BJKA 5E6SA 4K87A 1WEKA 4Q3EA 2JFZA 4Y2JA 4CQJA 4JB8A 4DDWA 1U3DA 5LB4A 3IMEA 3DHNA 3RT1A 4L5CA 5DWDA 1JG7A 4KRYA 2PL9A 4HSGA 3DMNA 4PSAA 3GLFE 1E9CA 2CB9A 3GIDA 1EHYA 2IPOA 2P75A 3F90A 3NAZA 3WGUA 2FETA 1E3JA 4EA8A 1ZQ9A 5IAKA 2F3TA 5KQPA 5LQDA 3G8YA 5GGYA 1VBNA 3LUAA 2WQ6A 4OGFA 1L5OA 4ARBA 1OYWA 2YH2A 3JSXA 2IBTA 1RJ9A 3C6BA 5CDTA 3AYXB 3EMOA 1JEJA 4MYRA 2GYWA 2VOJA 5B6JA 5AKXA 4E5VA 4CM6A 3RWMB 2RJ3A 2JGAA 2FOXA 5DXJA 1E64A 1K7SN 4DB4A 1E6CA 2YZNA 1Q0TA 1RQRA 3PF9A 2BD0A 4ARAA 4HWPA 5A1JA 5LBTA 5IKOA 3P45A 2GBLC 2DUUA 3HHEA 4YN3A 3NHWA 1OLUA 2VRBA 3PTLA 1C3VA 5HK8A 2O8BB 2CLCX 3ZGOA 3WMFA 3PC7A 1HSZA 5LA6F 3DE1X 4HDRA 1E1RA 1XEXB 4L2IB 2OHVA 3C5WP 5CDFE 4QHSA 4EJSC 5KOJA 3LH5A 4TYNA 4E6PA 4DXAA 3GBPA 3O5AA 3QLVA 4KACA 1P5JA 4V2IA 1EG7A 3IIKA 4IVNA 3GFQA 5AK6A 3C16C 4M7RA 2WKRA 2CYAA 3L6CA 3DDHA 1DBWA 1JYEA 2GZSA 5JRJA 2EIHA 3Q9LA 2WJYA 3OF5A 5J4VA 2C03A 2SKCA 5HMLA 3FPFA 4MQFB 3HKBB 4FKZA 2FN9A 3ROMA 4Z4IA 1E2EA 4IWXA 1KFJB 1BSVA 3LPMA 3HCEA 5TT1A 5AVXA 1J9GA 4JKOA 5B1DA 1N7JA 3L0YA 4NOLA 2OYCA 1LVHA 2I87A 1CS0B 2ODTX 1NXWA 5J2UB 2IP2A 1CJSA 1H8HD 3ZE0B 5JSUA 3BFKA 1YUNA 3LQYA 3M1LA 3NPMA 5G4LA 4RMNA 3V1MA 2GGSA 4YCAA 3ER9A 3BH7A 4HJRA 2IZZA 1WA5A 3ILVA 3DMHA 4GXNA 4IS3A 3RC8A 1UDWA 3UC5A 3NYWA 1BX1A 3R44A 4JLWA 1UEXC 1N0IA 1MOPA 1ACLA 1XAGA 2JVIA 3DAPA 1P19A 3BJIC 3OUTA 5IC6A 3B2QA 2PKYX 2Q2VA 2ZW9A 3AZOA 3FWNA 4JDPA 1URPA 3ANTA 4OU5A 1A9RA 4KH0A 1ANKA 1QQ5A 4RPLA 2XHEA 4UVEA 4YQYA 1M67A 2P6OA 4PGMA 4N9QA 2QT1A 4TV9F 5KYYB 1RYMA 4L72A 4RFVA 5GIOE 4GG1A 2FZ5A 2O8VA 3RVKA 2E4ZA 3Q7PA 4G86A 4RGBA 1N8NA 3QFSA 1F48A 3ZI0A 2JF0A 2OENG 4LI3X 3NLLA 1EG2A 5IM4F 3F3KA 4PC3A 2M6SA 3LWNA 4MYCA 5AO9A 3HEAA 2HJGA 2RH5A 4L3WA 4LBZA 1QAMA 4LFCB 1JE0A 3WAKA 3IBCA 4RTMA 4FWTA 3ISVA 1TO2E 3G0GA 1EFTA 1YBAA 1ZKDA 2HEIA 2JGEA 2P2ZA 3BJMA 3IVCA 4PZEA 3I9V1 4ZQEA 3QKRB 5LWHA 3WV5A 2YFHA 3O3MB 3PC4A 3V32A 1OH8A 3ML1A 4INJA 3T0GA 5HS6A 1G9SA 1PSZA 5IZ4A 4PCUA 3UHFA 2IYSA 2QD1A 3LC2O 2MDTA 3UFXB 2YHIB 1L1FA 5EVJA 2QW1A 3ZVNA 4TQGA 2WYWA 4JJ6A 5HR5A 3ZLJA 2EKQA 3BH6A 5D1NA 5BSFA 3H18A 3I28A 3U2QA 1A4RA 1LRJA 3DKVA 4UNPA 5EJ4A 3AETA 1ZJ4A 1C1DB 2YRXA 4B79A 3Q9NA 2VYNA 1JIQA 3N75A 1K3FA 1JDTA 1YU9A 4RS4A 4KW7A 2WFLB 2G71A 2PJUA 3G82C 4XDHA 4Z1OA 2R44A 1EFLA 1FFXB 5FRDA 1M73E 2KX7A 2RMKA 2GZ3A 3OG9A 3B9QA 3PUJA 2RGBA 4DYVA 1DAIA 3MTBA 4IDAA 1TLTA 4OFBA 2LV8A 1NQVA 4G97A 1MGPA 2ONKA 4LRUA 4QOFA 4W8HA 1IN1A 1DRJA 2C4HA 4IV0A 3T5MA 2JFGA 1MPTA 1J0CA 2RBGA 5KOYA 5JD5A 3B89A 3H2GA 5E0OA 1I01A 5IN4A 1Z06A 2WUFA 1AKNA 2LKCA 4MRPA 5F52A 2IYTA 3K0FB 1BKDR 4YI5A 4TLDA 5AUNB 1VLMA 3FCSB 4M0LA 3GLSA 3RI3A 3DNPA 2ZBDA 5I7OA 3BDVA 1RWQA 4XYGA 3UJ9A 5L4SA 3FYSA 2ZANA 1P80A 4OOFA 4X7BA 4A36A 5ISMA 3JRWA 2O3SA 4J6FA 1Z74A 2V9CA 5CB6A 4KN6A 2YJNA 4UBKA 2YIJA 1Q92A 1IQPA 2LCIA 3CONA 4HRXA 2HA2A 3ZHYA 5TQ0B 1SBHA 1ZH4A 2YN4A 3ZGYA 5C4IA 2VHTA 3ZVKA 4U0KA 1YI8A 4JLMA 4QAJA 1TAUA 2JGIA 1WEHA 5EE9A 1EGVB 2UXDB 2ZJ5A 4DDUA 1MRSA 3N8KA 4KAFA 1HE4A 4KQCA 3PS9A 2E7ZA 4G65A 3UTCA 4AIIA 1PHPA 5JNUA 1GQSA 2FOLA 4LDZA 5LZ8A 2BEVB 3KE8A 3HMKA 3W2IA 2JANA 5KTYA 1SUAA 2BGNA 2B0JA 3BGIA 3ZHCA 2ZQZA 3ESYA 4JI1B 2VZLA 2WRZA 3LVQE 4F9TA 1MW8X 1Z38A 2JIRA 3RS2A 3RQIA 2P0YA 3Q3GE 1SBCA 4FE4A 5COAA 3TG8A 5KOIA 1KY2A 2P0EA 1E6EA 4OI2A 5CXSA 1SQ5A 4N3GA 3RG8A 3NIDB 2A9RA 2WK1A 5AVYA 1U0LA 3I0MA 4ZAVA 4IIJA 2IP4A 3IA7A 4G6ZA 3R77A 3H6HA 3DP7A 1BWRA 4C2AA 1JPJA 2IYVA 1PUXA 3MGBA 4I9GA 4KMMA 1U99A 4C2UA 1HXHA 1Z0JA 2FPOA 2P4EA 3PI6A 3DKKA 3S99A 3LT0A 3QUTA 2PMCA 5BWCA 4G0QA 4IJWA 1ZIOA 3F47A 1N2GA 1WSDA 1X7YA 3ZOZA 1VIAA 2KLHA 3HU3A 2W71A 1G20E 1YA6A 1BE0A 4FEAA 1NXTA 5FI5A 1YSCA 3NHAA 1UBHS 3KM0A 4KREA 1DKPA 2QJWA 1E2MA 4KFSA 1T5SA 1COZA 2LIVA 4CLHA 4W1SA 3AJEA 5I9LA 3CT4A 2P3SA 5H82A 3LRTA 5FADA 1XQ1A 3BH0A 4KYTA 3EQ8A 3LX4A 1Y4UA 4R8LA 5L7TA 4QM6A 2ATEA 1X39A 2G17A 5EWLA 4YP6A 5BOVA 1HTWA 3OOSA 5B1SA 4A03A 2JLXA 3DTVB 1FUKA 3TGPA 2W8BA 4PTZA 2V0CA 5U1PA 2BFEB 2D2XA 1JPNA 4JVMA 1TIKA 2AZDA 4JVOA 2GUGA 4ZV9A 2R8RA 3QPCA 4N3NA 4KXVA 1HYGA 2ZKIA 1G0OA 2P6UA 3Q3VA 5CTJA 3T3HA 3A6LA 5C34B 4GOJA 1M7HA 1XEWY 2QD2A 1ULSA 2IOYA 2WYUA 3EVTA 3KXIA 4X1KB 4YUXA 2G36A 3E8SA 4UJ5A 4EY3A 3PFWO 3SZGA 2DX7A 4A4DA 4LX0A 2OGFA 4G1BA 4ZOAA 1BQ4A 1YJ8A 1IU9A 1V2HE 1WXGA 4PINA 4BYMA 2WKPA 4U2DA 2G40A 2MCFA 4CM8B 1N2EA 1J8MF 1LDGA 2XLBA 5C1IA 4EYOA 2GESA 2DTDA 4JUFA 4C5AA 4DW8A 4IMIB 2PS3A 3BTVA 1CE8B 1SZDA 1J42A 4L5YA 2I1QA 2R97A 4K3UA 4HYYA 2B5VA 4B46A 4BQSA 2CXQA 2C42A 3A11A 3BIXA 4R01A 2AG5A 1E96A 3AVQA 1E6WA 1KARA 4MP8A 1W87A 3MTDA 4TWRA 1WL8A 1NZDA 4XTRA 5E3JA 3RJ9A 5K8LA 4MH0R 1GUAA 3HL0A 2JLZA 1E1RD 1CQXA 2NPOA 4MV9A 1KY5A 3ZWAA 1EVLA 3GJYA 4M0MA 5ARBA 3PD7A 5LC1A 5JZOA 2Y1OA 2CFTA 1EFPA 2XRYA 3FWPA 1P1BA 1KIAA 1H0KA 3ELYA 3QPBA 4LE2A 1DVRA 2HDOA 1SOUA 1YZHA 2GZAA 5GJVC 4FT4A 4FZRA 3GVXA 3F6EX 3HP4A 4CU5A 3GT4A 3OTHA 3Q6MA 3ETDA 1G2IA 4ZT3A 1GILA 3ESXA 2X2FA 5EI5A 5LA6A 3QLUA 1MC1A 2KWIA 2VJCA 4RA9B 3NT4A 1ESNA 1GT91 2GVZC 5DYWA 4AI6A 3N6XA 1ISHA 1JR3A 3GH1A 5ALIA 1WWKA 4KC0A 5CVUA 3RRNA 5SYAA 1DCMA 3SXPA 4E0BA 2PWBA 5I8PA 5CDHA 4DLSA 1P3DA 1ML4A 4I2NA 4LKRA 4UAUA 3WGYA 3L0IB 3V6LA 5EIBD 2BONA 2C0QA 4QJ4A 3WLPA 1YRQA 3M83A 1RJWA 2FWNA 1OXTA 2OO3A 4UDYX 3I5YA 3HCOA 4C0BA 3KOOA 3NAMA 3WBKA 1NUTA 2Y6UA 1I7SB 2ODNA 1TYAE 4GZLA 1SHTX 2GN4A 8AT1A 2FRDC 3X1ZA 2ZROA 1KDZA 2F43A 2XCTB 1WHTA 1DKOA 4AQ7A 2Z2XA 2H5IA 3DEYX 4K6KA 5BWBA 5J4YA 4CEIA 4UZEA 3HJUA 4JC8A 2XBMA 4K03A 1VSBA 4OQLA 1BDMA 2XEDA 2RONA 1SFRA 1V7ZA 3LKVA 4J0GA 3KQWA 4DSZA 1FXSA 3OX3A 2UZIR 4B3TB 1DI0A 3IC5A 2P77A 1VSUA 5AK4A 3IIIA 2DHRA 1GG2A 2FQWA 3EY4A 3T61A 3CEJA 1QGUB 1ZVVA 3U0VA 2F3PA 4K8RB 2FX2A 1XWFA 2QAGB 4FSDA 3NFYA 1AX9A 1FRZA 1ONSA 3REFA 3LHKA 2QOEA 4C3OB 3ZY6A 1Z47A 5K99A 5L40A 3AVVA 2QZZA 5CX1A 1KZYC 1LDMA 1YI0A 2P5SA 1JAZA 3BQMB 4TV9A 4YJGB 4FDAA 4G1UC 2B8TA 3SBOA 5IRCD 2BTEA 4B6SA 1XU9A 3SCZA 4OQEA 3WICA 5K3AA 1W75A 2PSJA 2ZRQA 5I3CA 1C2TA 2JA1A 5ALDA 5FWYB 3TTVA 2GN6A 3G0CA 3NR2A 4WFJA 1W5BA 1NJGA 1NN5A 1ZL2A 3RS7A 5HG0A 4JSRA 3DM9B 2PHZA 4D0RA 2Q1SA 4DWWA 5HIKA 2Y1GA 4FI3C 4H7JA 1N25A 3HYTA 3BB3A 3BWBA 4HCJA 2Q6VA 4IDBA 4KO1S 4CMIB 4GU5A 4MZDA 3P9SA 3L2OB 3FDJA 4HVAA 1VG9B 1O08A 1WM1A 4KXLA 2FPWA 4DLXA 2QL6A 1HE2A 2FLWA 1Z5GA 2HHAA 4L0QA 4MIOA 1MX9A 4QRIA 4Z3DA 5C31A 3RYCB 1PNOA 2B2CA 4BO5A 1JV2B 4OAOA 1CEQA 1K7YA 5CLLA 1GDTA 1KFKB 4D02A 4F3CA 1B93A 1QE3A 3HS3A 3IA2A 3Q6NA 2VYND 3FUXA 4WAUA 3VH1A 3QXXA 2R6R1 4AECA 3AESB 1JDJA 4ENSA 1YB2A 3SVLA 2G6BA 1GFZA 1I2DA 1KA9H 2GBCA 2I7CA 3BTUA 4FJ0A 1DT5A 3IT1A 3V6MA 3HG7A 5T64A 4GPAA 5JBQA 2CFSA 1MA3A 1COWA 1OWMA 1OPXA 1Y1LA 3PUHA 2C2GA 2FU5C 4XLTA 2VDOB 3EVFA 2ZIXA 4PANA 1Q7CA 1K98A 4DQXA 2IA5A 2CF6A 4ZYUA 3DYBA 4GFDA 3FCCA 2C31A 5CA1B 4KMOA 3CLSD 3RT7A 1Y9JA 1BFKA 1BRMA 2HEGA 1NW9B 3C97A 4KLAA 3BX1A 3KTFA 2YXPX 2H1SA 1NW3A 1FL9A 1LS1A 4C03A 3FYHA 9LDTA 3NKLA 1FTGA 1NVTA 4BNNA 2QD3A 3EDOA 5GTDA 3EZ6A 3A1VA 3TSZA 5FBKA 5I7UA 3PX2A 1EGAA 2R85A 1FQWA 3G13A 3LQFA 4G0WA 2D7CA 1Q91A 4JYCA 1CUWA 1T9GS 2XVAA 3HNPA 2Y92A 5GPBA 3OMWA 1W5FA 4X90A 2H2IA 3H8SA 4QASA 4Z4FA 2CCJA 2ZQYA 4RIHA 4RSHA 1CD5A 3UJ6A 1NJ1A 2AS0A 5EZYF 2ZWMA 1ODIA 2B0CA 3GDHA 3GEPA 4UHJA 4BJHB 1IZ9A 3OPNA 5CTAA 2V7UA 2QRVA 3C8MA 4RLQA 2X77A 4RTJA 3FYUA 1CX9B 5A4FS 3ANLA 1XV5A 4D5GA 2QVZX 3BMNA 1KMHA 2BSQA 3DHYA 6YASA 2FJPA 5IBQA 3KELA 2QN1A 4IXWA 1MD9A 5GIPE 3JVUA 2BOVA 2X5OA 3COWA 5EGNA 2O2JA 5FPQA 1MRZA 4RPKA 3SDSA 1P75A 2UVDA 3IBTA 3CLVA 2NSJA 1II0A 5EQFA 4JBWA 1OFTA 1TCUA 5FP0A 2PMBA 3UHOA 2PO7A 4J29A 4N49A 5AQ1A 1UUFA 2AI3A 3ET4A 1XWIA 4URUR 3R7LA 2BLLA 4M0EA 4U6QA 3PGMA 1J06A 2PZAA 5IJXA 3ZU3A 1N7HA 1VMAA 3DE3X 3OPYI 4IQ8A 4MRMB 4H4EA 3VH3A 5CBPA 1R18A 5HZGA 5K45A 4F4UA 1BVYF 1GQ2A 1LGYA 2QN7A 4TN5A 1EGHA 2B98A 2XYQA 1AF7A 2CHGA 5HJ7A 3KHTA 1JMVA 2W6QA 4BPRA 3IQFA 3GUUA 2QXTA 3AOGA 3KQUA 3ROTA 1DBQA 1JU3A 3PCTA 1BEEA 2D0DA 1YZLA 2BKEA 4RFLA 1MABB 4JENA 1U9YA 3PC6A 5AWFC 1NYLA 4BLVA 4KQ6A 3LPDA 3RU7A 3BJEA 2EKDA 2HK9A 3HB9A 4DCNA 2XB4A 4I6EA 3MM4A 2AYYA 1YJQA 2K7ZA 2VQ6A 3LJKA 1GGFA 4II7A 4P36A 4P7FA 2QZJA 3WLAA 3QKIA 1RKUA 4DA8A 5BPHA 4J1TA 3ASVA 3C45A 2QTCA 3FKJA 3GJ7A 5AOVA 1DV1A 4UOZA 1XD8A 2CYCA 3IT2A 4R31A 3DEHA 3QVXA 1DE0A 1ZHFA 2QKYA 3BSYA 3QVMA 1ZD1A 1SBQA 3LK6A 2B8WA 3JASB 5DCUA 3S3TA 2XYVA 3D6FA 3WMWA 1D4ZA 2W2PA 3MRVA 3U3XA 2IZ6A 1W36B 2V7BA 1ODSA 1ISSA 2VLIA 1ZG3A 4LE0A 3MF4A 5K51A 3SI7A 2FPPA 4H27A 4IH1A 3W79A 4EVSA 3N0WA 2Q5OA 1N1GA 1NLFA 2B20A 2OCPA 2WIAA 1W2GA 1G16A 1CV2A 2I7VA 3IT0A 3QWBA 2HMYB 1HSOA 4MMXB 4PLFA 5IM5A 4Y7CA 1HLGA 4F56A 4EPYA 3L8EA 3RHZA 2AN4A 2QPOA 5AW2A 1GGKA 2VT6A 4BNMA 1RKBA 2VSFA 4G63A 3ZDZB 5ER6A 2Y66A 4FDUA 5DCYA 2DFTA 5DMXA 5C3MA 1P91A 1GHTA 3WXBA 1RC8A 2QG9A 3CE9A 1PZFA 4OO3A 4C6TB 2NU6B 4LZLA 5KNLA 3MTQA 5KYVA 1XZGA 1A27A 2J0UB 3IL2A 2CLSA 3ZU5A 1JXMA 3D54D 3P9NA 4M21A 3QBDA 4ZO9A 1S2MA 2OECA 4M36A 1OFUX 1ZNXA 4HLCA 2W22A 2QTVA 3GEGA 5JMOA 3PDJA 4AU1A 4E51A 2QLTA 1E2DA 1U8UA 3DP9A 4FN5A 3T7EA 1TGVA 1ZMTA 3C1AA 1QIFA 2I6SA 3D8BA 4JP1A 4RJJA 4WOJA 3PYXA 1YK0A 3WADA 2YXBA 4NIMA 2R00C 3Q7RA 4NTZA 4PZUA 4UE3S 4TL6A 4LV5B 1OBVA 3R74A 2QTFA 2DWQA 3BREA 3VR6A 3PXBA 2RAVA 2CJXA 4QQRA 3GJSA 2FWBA 4BVLA 2QTHA 4M3NA 2C5HA 1JR3D 5B4VA 2JGRA 2QBYB 2OAEA 4ZC8A 3VNUA 3ZDEA 1RYZA 4Z9BA 2V9ZA 1TM2A 1G2PA 3MINA 3G1TA 3EWIA 4TKLA 4EJMA 1ESMA 4LHSA 3W8DA 2ASEA 2BFPA 3BL5A 2GK6A 4Y0AA 4ZANA 1JA0A 1KYVA 4G07A 4HX2A 5KNBH 4BO0A 1IBLB 2OHJA 4YASA 2POCA 3P2IA 4AF6A 1WZ2A 2BEWB 5E7MA 4WCVA 1ZA2A 4LHXA 4BZPA 1KRWA 4DCTA 3FRJA 3P19A 1UJBA 4XQ9A 1M1NB 3OHSX 4LHZA 4PXAA 4D4GA 2P91A 1CHNA 3P0HA 5B3KA 4ZYXA 1JFTA 2QJFA 1IY2A 1NVKA 3EXAA 4Q1FA 2VP0A 4RMIA 4S2UA 4BLWA 5AJXA 5C5DA 1SCUB 2H0QA 3H65A 4RKQA 3E5HA 1OBCA 2DH5A 3RF7A 1CEXA 1U4OA 4D80A 5LFAA 3A9WA 4WXPA 3WGMA 4BX0A 1YUBA 3LUCA 2VHEA 4M98A 2TMKA 5ESXA 2OVBA 3KOYA 1CZUA 4LDNA 4C4TA 4C30A 1JKJB 4CU2A 1SHKA 2Z57A 5CEEA 2WJ4A 4JB2A 5DIZA 2AN9A 2GZMA 5A9TA 4WJZA 4ZP1A 3CV3A 3EAFA 3GFFA 2XSZA 2PH7A 1N1MA 3G5UA 2OXIA 2DHEA 5BNIA 3ZG6A 4Q1CA 2FYTA 2G5ZA 2CVZA 2GLXA 4M1EA 5E4YA 2X22A 4I55F 4P58A 2GK3A 2IVFA 1SKBA 5DYTA 2AFVA 5AHRA 5I47A 1KEKA 1FSFA 3IUBA 5THQA 1HFWA 1SCQA 4JQOA 3CX8A 1Q1QA 5E1MA 4QHYA 1DB3A 5TQJA 4FIZA 1APBA 2O8BA 1R9MA 2EGUA 1TJ3A 3A6DA 121PA 1SC6A 4A8TA 3M6AA 1XEXA 1RKVA 4DLBA 2HQSA 3FBTA 3BF7A 4L2IA 1YL6A 4YBZA 1QO7A 1JJFA 3CUWA 4RZQA 3WHLA 3TMYA 3O8OB 3OZAA 3LECA 1Z12A 2EFEB 4NCXA 3CLUC 1YQ9A 1SUEA 4EL5A 3CX6A 3P32A 4MUFA 1T5HX 2HU8A 2V7TA 4AKTA 4ZZ0A 3PNYA 3A26A 2NSLA 1KYTA 5EFOA 3T34A 2FX3A 3AT1A 3EFBA 2MYNA 3PPYA 3FAZA 4KIGA 3OETA 3OICA 1GU7A 3C1UA 4NXNB 3H5OA 4MQFA 3HKBA 2WWFA 3GLVA 4IICA 1XAJA 4YDSA 3AKYA 3Q85A 3FMFA 1T8WA 4DV1B 1VLJA 1RQLA 1XZNA 4UFOA 1V5WA 2HV9A 1FYXA 4TTTS 5HCNA 4I08A 4L0CA 2CV2A 2VNKA 4DDMA 1RT9A 1COWD 2VAXA 4Q4LA 4O1IA 4L76A 1FP4B 4P8RA 2A5YB 5ENZA 2OXTA 1XUOA 2C2OA 2VK2A 1CS0A 3O75A 1AJEA 4QULA 4KMRA 1PDOA 2ZSEA 1TA0A 3ZLUA 3C3WA 4HN4B 4HWKA 2FDRA 3I23A 4KNVA 1EBBA 3GNLA 5J2UA 3ZDCA 1Z34A 1CZHA 4EB6B 1HYEA 3GLKA 3UGJA 4OP3A 1J4AA 2C4VA 2GO1A 5L3SB 5JZBA 3GYBA 5FV7A 2HLPA 3IEPA 1DUSA 3KE9A 4RQBA 5JXIA 2X7HA 3G59A 4J0EA 3N5KA 2J4CA 4JLPA 3SHVA 3DA8A 1CUSA 5IKPA 1RAGA 3AVXA 3OP1A 1UJNA 1KI4A 2X0KA 3AUFA 3GJ3A 3KKKA 4HDAA 2XKKA 1EM8B 4KSCA 4W4TA 5AOBA 3U7FB 3FDFA 2DR2A 2QMEA 5JISA 1KI2A 3LZDA 5KYYA 4U2BA 2HUNA 2QN3A 3IPRA 3PUIA 3A3PA 4X3OA 1GN8A 5HIJA 4X66B 1VPWA 1IHUA 5AI4A 1M83A 1VIYA 4HBGA 4G0UA 4V3CA 2WYIA 1YQDA 4QZVA 2FSSA 1V2GA 1VSTA 4UATA 1VXRA 3DMPA 1SHJA 4WT7A 1ISRA 1WW3A 1DIHA 1KO5A 3E05A 5IAGA 1IHDA 3SQLA 1WTCA 2RHDA 3T7JA 2ZE6A 3QH4A 2OGUA 3WNZA 5JARA 4R2JA 3WYGA 3L7CA 4NOKA 2ZTVA 4OMCA 3CLTD 4FU0A 4DVGA 3QKRA 3SBDA 3HZOA 3SEQA 2D59A 3JQGB 7ADHA 1ETHA 1G5FA 5AM1A 2VO1A 2Y1DA 4HADA 1YFLA 2CXNA 5DTIA 2Y1XA 4QQFA 3HVKA 2II6A 2EF1A 2P2CA 1M5UA 3FDXA 3UW1A 2E21A 1KXJA 5I7FA 3B6KA 4YRTA 1YRHA 2NSHA 1M75A 4OOEA 1KL7A 4OXRA 2YHIA 4GOOD 3UFXA 4ENVA 3EGXB 5LDHA 3ZN2A 4JI7B 3Q2KA 3THYA 1G3RA 1DTWB 4WL0A 3G6WA 5TR9A 5JV5A 2XMZA 2XD4A 4RE6A 2JC3A 3V7FA 4GLOA 2FZCA 4J0FA 4CIBA 3ZTWA 4JGIA 1I5RA 5IABA 1C1DA 3R3VA 1QR6A 3BA6A 1W88B 1Y1QA 2QUBA 4IJKA 5A2GA 3HLYA 3WLRA 1I9GA 4LWPA 2I54A 2ANCA 2WFLA 3F5DA 4WLFA 2A3NA 3RFVA 1E1CB 1FFXA 1IEXA 4NC9A 1R9NA 5THKA 2VS1A 3QHAA 4JJ4A 3C6MA 3OCCA 4LC0A 4N8DA 4WV3A 5AQEA 3ND7A 2IWRA 1G9TA 3WIEA 1BFUA 5HJ5A 4JBLA 3AFGA 2IFTA 1SXJE 1LJLA 2VF2A 2C82A 1TLLA 4MJXA 4K46A 4ECEA 1ECCA 4JFRA 5BUZA 4GLFA 4PLCA 1UT5A 4RF2A 4BMVA 2PM8A 1MX1A 2XDWA 3T3IA 3TM4A 1U2SA 2IYYA 4HO1X 3GGGA 2PN1A 2QYSA 3K0FA 2R62A 1D1PA 5CR9A 4BHTA 3IKVA 3W3AH 5LDDC 2EJWA 1B0PA 4Y2GA 5B2ZA 5KVSA 5FPPA 4IMPA 4DQKA 1R8YA 4L9WA 1JVSA 2QUZA 3TWOA 4IDPA 1FRFS 1VHDA 3VPBA 1R9JA 2Y4OA 2QLFA 4LXGA 3WS7A 3ZVMA 4LHYA 4N5IX 3OQPA 3TIIA 1J20A 1Q83A 2CDCA 4B87A 4AX8A 5K8VA 1K75A 5IPFA 2Q28A 2WFAA 4GNKA 4OQZA 1J2YA 5TQ0A 4DIDA 1SOAA 4Z6KA 4RETA 4MR9B 4E7OA 1KJYA 4MQ6A 2A7QA 3C39A 1JQLB 2C8KA 4GI3A 3AIIA 3GZNB 4GT1A 4GP9A 4TXNA 2PJRA 3NHJA 1Z62A 4QTXA 3UMRA 3QPDA 4RTQA 2BEVA 3MWDB 4JLJA 3A4TA 4LS3A 4QT0A 4HPJB 1XI2A 4LHWA 1R2QA 3WE7A 1KR2A 4CEJB 2XWQA 1PJQA 4FCCA 5EKSA 1DBSA 1N4DA 1CR2A 2NZUG 5E8JA 3RUEA 5ECWA 1I4TD 1ZNZA 1YZUA 4LV8B 2HMAA 4BQOA 2DH6A 1ODFA 4RQUA 1VCIA 3WGVA 1BC5A 2Q5JA 2VRWA 1G17A 4ITVA 2GPBA 4M87A 4Y67A 1KI9A 3K5HA 3GMSA 3DW1X 4PX3A 1U31A 2PSEA 3DBRB 3N5CA 2DXIA 3P9ZA 3INTA 3T3MB 3I92A 3IQEA 4JI4B 1TQ2A 3E8XA 4OMUA 3BULA 5JCOA 3T5AA 2WA2A 1XTUA 4L5BA 3S2SA 2XE4A 2IH2A 3QI7A 2VTDA 3DXZA 1XZKA 2ECQA 2I33A 2PZMA 3EB9A 3GWGA 4LE1A 3QU9A 3EC2A 3NTRA 4FQ8A 3WHKA 3TYXA 4ABTA 4U7PB 1RAFA 1W19A 1EJ6A 2BI4A 3R5SA 3VR6D 1K5HA 1TMGE 5LZ5A 2C98A 4REQB 3ESCA 3A7DA 5IDXA 2NZXA 3UAVA 3HYRA 1ZJWA 3TTSA 2QPLA 1YOBA 2NU7B 4A8JC 4JL5A 3LUHA 1MU0A 5DNDA 3FMOB 1W46A 2YWHA 2VHWA 4G0XA 1TQ4A 1PIWA 4C9BA 3WX0A 4COKA 3BS4A 2DZDA 3DM5A 1XF1A 3LDUA 3GG9A 4ETWA 2VPWA 3DTVA 5JYDA 4JELA 2BFEA 2QQ5A 4Z51A 3EGWA 2GK4A 3PHGA 3OJWA 2J09A 5ALWA 3ZGXA 2P4HX 3LT5A 3D2BA 1U9CA 2BGUA 4J07A 5EP3A 3L84A 1OXMA 4NKRA 2EV9A 3GRUA 2QIPA 1I0IA 1N5MA 1VKOA 2SECE 1T1EA 1NF2A 3KPVA 4PG6A 5ENVA 2XGJA 4Z3KA 2WJWA 3IALA 1BOOA 3CVVA 3FDIA 4X1KA 2JARA 3NAGA 1OOEA 4ZDKA 5HUQA 1A9OA 4QEZA 1TT7A 3HJNA 3UMVA 4QBIA 3WMRA 2I4MA 4W5WA 4W9RA 4CM8A 2Q49A 2XSZD 3WWCA 2QI9C 4TMVA 5K4AA 3NATA 4PU0A 4UEWA 3WB2A 5GJWC 4D8VA 3M6IA 1WCXA 2DERA 2PXHA 1CE8A 1T36B 1TZMA 2H59A 3CGWA 3WBFA 3ETHA 2C84A 3CTMA 4FKMA 5CW1A 4HQOA 4BNLA 7ABPA 4ER6A 4BATA 1DAPA 3UV7A 4JP2A 4ROSA 2IVZA 5TV2A 4C4ZA 4CF4A 2ZR0A 1QHSA 3TN7A 1TF5A 2P4SA 4IOMA 4IOLA 1U8CB 1YF3A 1M8KA 3A4IA 3LF1A 4BX2A 4H7FA 1Y5IA 4LSZA 3JTEA 1K63A 4NSNA 5L7YA 2UUAB 1XTIA 2CNBA 2OR3A 1F0KA 4EFNA 2O8EB 4WXEA 1U7WA 4B73A 4LOIA 5A5GA 2M1ZA 521PA 1CRWG 3B51X 4Q1BA 1PVOA 3NHZA 3B2NA 2EDAA 1AQLA 1KAOA 2J3LA 4PQFA 2XJ9A 5BYKA 1XK6A 4E2ZA 1GARA 1L8LA 1JX6A 5TVKA 5DLEA 3DGFC 1WXXA 2GJ8A 1Q1NA 3EQ9A 1V4VA 4NDAA 2JASA 4RA9A 5IUJC 5BRNA 1U9IC 5IYZB 1ZUIA 4PR0A 4XUGB 4X0EA 4CPDA 2GYUA 4EZIA 3CX4A 3T9BA 2A9FA 1PI3A 2AVDA 3JW8A 2IOFA 3NHUA 3LGSA 4JR1A 4XJTA 5B1IA 2WLSA 1BDIA 2O6LA 2GAFA 4RQAA 1KO4A 1N1DA 1SB9A 1UPUA 2GRAA 3GLFB 1PZHA 4LK2A 1KTIA 4YRAA 1B7GO 2ZIZA 3BD8A 3Q5GA 2O3QA 2ZE7A 3DCIA 2YJGA 1H6DA 3FCAA 3JRXA 2FPGB 5HQJA 2Q62A 1MTZA 5EMKA 3FTPA 2GPNA 3S2ZA 1G98A 2XADA 4IJ6A 5DI3B 4JQYA 1O8CA 2BN4A 1GDDA 5A4MS 4OJKA 5ALXA 4KYIB 1AKTA 1Q77A 2V6GA 3RTAA 2JGFA 4B9EA 2BBOA 3IQZA 3KR2A 2A35A 3OQHA 1H4VB 4IDHA 2IX3A 4KXXA 4ARZB 2HDHA 4HN2A 4HQ0A 4GC5A 5JWRA 4D0LB 1PS8A 1Y1KE 5DWQA 5CITA 2K87A 3RV4A 3L4KA 1NATA 3I9NA 3RV3A 1QGUA 3SS7X 3T1VA 2AOUB 1SKYB 1IRXA 2QAGA 2RGNC 2CDNA 1X2EA 1ECLA 4FS3A 4NBRA 3OD5A 1YKGA 2CSUA 2EX4A 4NH0A 1K9SA 5A4IS 3M3HA 2IELA 1U8XX 4ZAGA 4YT2A 1QF6A 5KQGA 1TTTA 1RQNA 4PXSA 4QDJA 4BMDA 3O21A 5L8VA 1XNJA 4N48A 2ZJ3A 3PBKA 4YJGA 3PJFA 4KIUA 2H06A 8GPBA 1GA4A 1OKKA 1EVZA 3RK0A 3EN0A 3ZGNA 4Z0TA 3CUVA 4PHGA 1SHZA 2E49A 1L4FA 1YRAA 3K8YA 3O4IA 4NPAA 1E7QA 4PN3A 3TS1A 5FWYA 5JAOA 3S7ZA 2JIMA 3FY4A 1O89A 3INRA 3WK9A 1TM3E 1USKA 3N7UA 3ZJ5A 2CVOA 3HJHA 3EXEB 4JJAA 4L73A 5CH5A 1V26A 1A76A 4E94A 2PKQO 1P4GA 3BMQB 4CMIA 3LC7O 2AMLA 4EECA 3A0RB 2CNLA 4FEYA 1BMTA 5BSUA 5BQFA 4LSMA 4REMA 5IANA 1HZZA 1NT2A 3A7EA 3GLQA 2WDZA 3ERCA 5FPTA 3RYCA 2JIZA 1RXWA 1T8UA 5K6AA 4BNIA 3L05A 5J1SB 3QNWA 4BZQA 4E70A 1JF8A 1G8GA 1XMJA 1TM7E 3ZGVA 4L28A 1E60A 3AESA 3MJCA 4H59A 4UHCA 1PT6A 1V16B 4WKOA 4F5WA 1U7PA 2VXCA 3H1EA 2FN4A 4NU0A 1UKEA 4F6RB 4LIPD 3KEGA 4U63A 2HQRA 1DX9A 3GPBA 4QVGA 2OBMA 4P33A 1O8BA 2PTHA 2PXCA 4Y2HA 2WU1A 4PZDA 4RF4A 1C0EA 1G6KA 3OLYA 1V9SA 1WDKA 3H8VA 1D9ZA 3SSOA 4A0SA 5KQLA 3B38A 3AKEA 3CPJB 2CHEA 3FBWA 3A58B 3IHTA 4Q7MB 5AJVB 1P45A 5FBHA 3T99A 1LPSA 5DISB 4WXYB 3OCYA 5CH3A 4L75A 1J7KA 1BS9A 2IXBA 3PE3A 4P53A 2QTZA 3OPYB 5K8TA 2VJOA 2X14A 3MT0A 1RRVA 4JBIA 1XZ8A 3TLGB 1RAAA 3A9RA 3QY9A 3HADA 1JTEA 2AXNA 1XZDA 2NZ8A 2V7WA 3NBZC 3PEUA 4M46A 1ZJZA 1ECGA 2E4AA 4BNVA 3GGDA 4MUIA 1QMPA 3R5TA 4BBPA 1VL0A 1VZ3A 2P27A 4EY8A 2L69A 1QV7A 4JUBA 1O58A 2BGWA 3HQ4O 3ENWA 1DKLA 1EWRA 3HCDA 1XMPA 3N05A 2GW4A 4W5NA 2G9ZA 2JRCA 1OTYA 4YPFA 2Z4TA 2HSZA 2YMMA 3GEHA 3HYLA 1LFDB 1SK9A 2DE0X 1UWCA 3IJPA 3M5PA 5HIIA 3N07A 3CQ9A 3T1OA 1CRPA 1Y1TA 3L7YA 4ILKA 5I01A 5EMLA 1RU3A 2OFPA 4R8MA 3RK4A 1SOWA 3B6JA 2O2DA 3TFQA 3OCWA 3L7NA 3N2IA 2P2NA 4LZJA 1DFGA 4EW2A 1SRQA 5AXAA 4N5DA 1JS1X 2CW5A 3FYTA 3L1JA 2NO4A 4G5SA 2LWIA 1JHDA 3VPHA 3E4DA 4I4NA 4LSWA 2ODAA 1QX3A 5JY6A 3EW9A 1W2HA 1LZLA 3MN1A 1GTVA 4EM6A 2A0XA 4AZ3B 1TFRA 4AF7A 2OE2A 3AR2A 2IDZA 2ZOSA 4H7HA 4P3NA 1SVMA 1M9NA 1G5QA 3TQHA 3B6MA 2D5BA 1Y3IA 2G9VA 2QQEA 4INOA 4EDFA 2HU2A 1B43A 2WJ6A 4V1CI 1Z7EA 4LRYA 1BQ3A 5JNLA 4KPUB 4EHKA 3H2IA 1MT3A 1W8DA 5M2QA 1KQNA 1RIIA 1ZRHA 4MRMA 2DLCX 2HI0A 1TQ6A 2F00A 3Q7IA 3GELA 1WXWA 2W6MA 1CR6A 3IAM1 3RYHB 1F4LA 3QVKA 5A6SA 1AQ6A 1QB8A 1W581 3WGNA 1TXGA 1CRZA 1OBFO 2OHGA 4QDTA 3TLCA 1M1UA 1QUFA 3ECCA 3NASA 1UBJS 5IXYA 3E7XA 2YV2A 3DHVA 3FB4A 1NNEA 4L7VA 4RSRA 4FCVA 4RBNA 4BWYA 3PDUA 3N3BC 1DJLA 1ZIYA 3G88A 4M7WA 4UTNA 5JT1A 5JZVA 1MABA 5E7QA 4IX1A 3ZGLA 2H48A 3DTVD 4LC9A 3O8BA 4KQWA 5F98A 4QDOA 4CKBA 3DVSX 3EUFA 5KSOA 4PLWA 5C53B 4H0CA 4FONA 2B1IA 4IWYA 4ZRNA 4QJBA 2R11A 3TW0A 1Z4IA 4XM2A 1YMVA 3PUVA 3KT6A 3FWKA 3E2IA 1F8GA 1KNQA 3PDCA 1N9GB 5D5QA 1MB9A 4FHGA 4J91A 5TEWA 1CLUA 1BDBA 1SCDA 1PFKA 3JASA 3OLZA 3W7VA 2JJMA 3F97A 4UHEA 4XSHA 4CNBA 1KGDA 4Q3CA 5EUBA 3TNYA 4LUCA 1QLJA 1NMSA 2YL2A 2BGRA 2OV6A 3C43A 3DONA 4U39A 4FYVA 5I9BA 3LNTA 2L0XA 1TECE 1Z2DA 4PNZA 1NBWB 4KIWA 1YCFA 1B8VA 3VUEA 4AJOA 3HZHA 3NHYA 4G01B 4B82A 2IDJA 3RVDA 3U4CA 5KHLB 5KINB 3LLUA 2FN7A 3ZHQA 3AGPA 3A4MA 4OAPA 4FEEA 1JZTA 2EKLA 1AXRA 4C6TA 2NU6A 3AJRA 1OY1A 1N6HA 1PGOA 3E35A 1YQEA 3KZCA 5CB8A 4RGQA 2A57A 2GDZA 3T4UA 1B3RA 2ZIUB 2J0UA 4GMGA 4IJ5A 5ICEA 3KZNA 4B3IA 3RRMA 2O7QA 4NG4A 2WLTA 1SUCA 3KBOA 5JC1A 4UMFA 4IILA 2OBYA 4D81A 3R6LA 1KC3A 1XMVA 3LMKA 4G89A 4K2HA 2OKCA 1KI3A 3WK4A 3SR3A 1DV2A 1JEQB 1TVCA 2XHZA 4FC7A 4Y18A 1P31A 4G56A 4D9NA 1L8OA 4FT2A 2ZVQX 4HZIA 3RVMA 3ZJYA 3CEPB 3D3NA 2AW5A 1FU7A 2QBYA 3QU4A 3OVMA 4JEIA 5AMXA 2O59A 1TKBA 4MHSA 3OE5A 3WK6A 2WQZA 2AFHB 3BPSA 1OW3B 2VDRB 3EIUA 1VGVA 1GWNA 1Q7GA 4CF3A 4OXQA 2WSSA 5FBQB 3ZD6A 4KL8S 1L1EA 2ZBUA 1B0UA 3IVAA 5EKDA 2ZR9A 2YZ7A 3RGGA 3D31A 3UXHA 4Q7QA 3A9CA 4LTMA 1WV1A 2JLRA 2IUEA 2XQVA 2HSJA 1M66A 2BEWA 2PT6A 4IKOA 5B4UA 1RAHA 3NP7A 4QBKA 2CLMB 1M1NA 2ZIWB 3M9LA 3P9KA 2C7GA 2CLLB 4RGYA 2XUIA 2XCUA 1N5LA 3H42B 3IXMA 1YHNA 1SCUA 5DDIP 1N9KA 4BMCA 3D7NA 1DO0A 1YK1A 3DDCA 4KN8A 1I7PA 1PGJA 1QDEA 4JCOA 3AYZB 1E5TA 1JKJA 1KKMA 2AZXA 1GKUB 4UEQA 4D2IA 4A73A 3D3JA 2MSEB 1Q44A 3I6IA 4MR7B 3W9BA 5EVCA 3JWIA 1YB1A 4GZ6A 1NC1A 1YB6A 1PTJA 4F8YA 4EYEA 4CT0A 4G5RA 3BOSA 5TY0A 1EXVA 2H4YA 1WCIB 3GRKA 1OKKD 1MA0A 1XYGA 2JD1A 1J6UA 1U0GA 3WLOA 1ITZA 4BLSA 4CMBA 2HA7A 2WMYA 1P4JA 4LJAA 3SVZA 1DCTA 3RIGA 1NE7A 1ICEA 3NTQA 3I52A 2ZIFA 4H3HB 5D51S 1Z4PX 2ECOA 4EGQA 5JC8A 4EIWA 2W48A 2JRLA 2QPTA 3EARA 4RZIA 1U5CA 3ZR4B 4CDNA 3X43A 1EZ1A 2OYSA 1KEPA 1UBUS 1UT8A 1OAOA 5IYZF 3O8OA 2ZRNA 3QRWA 2HXGA 4E5PA 2IYNA 4K1XA 3FZEA 1JL3A 3PXXA 3T7CA 3EEOA 1RXUA 1M2WA 2QYHA 3DS8A 4L22A 4WXRA 3WK8A 4ZYYA 5BORA 3UMMA 1Z68A 1S8AA 5AKGA 5DTRA 1AXGA 4A2WA 2WSIA 1BRTA 3THWB 4B75A 5JIBA 2NO0A 3AJ8A 4JBYA 4RYLA 3NORA 1YOVB 4CLDA 1Y9EA 2LDXA 4F4FA 1O1YA 1YE5A 5LL6P 4FX5A 2GUWA 3F6SA 3IURA 3BDIA 1CY0A 2GYVA 1WPRA 1XNGA 2X15A 4RL4A 2AHRA 1FP4A 1E2HA 2FEKA 2ZSUA 5DIFA 3TRDA 3VSCA 1L4GA 2Y77A 3FNGA 1XU7A 4TYQA 3KYBA 1ZPDA 2BEUB 2YBDA 5K3BA 1S2NA 2YJTD 2FV8A 3IFSA 1JR4A 2H4ZA 4IOKA 2AJCA 3QA9A 3SLGA 4EB6A 4MVWA 5LVAA 2PVPA 2H07A 4ZARA 2CVHA 5L3SA 2J41A 3U44A 3KEMA 3O8QB 2AWNA 4LY6A 1L6IA 2C07A 3MEQA 4EUHA 1QYIA 4DWVA 4E5UA 1PU2A 4OHCA 1EM8A 4O4IB 3E3OA 4K86A 2QR3A 4OJYA 2JD2A 3ROFA 2I3BA 3I1JA 2NO6A 4MVJI 2O6HA 3O2QB 1A2QA 4S05A 1GYRA 1MAWA 1TK9A 1ZIDA 1EFAA 3R8XA 3SF0A 1KAGA 3K32A 2OV3A 2AZ4A 3QVUA 1W7AA 3FOBA 1H2FA 4RK4A 5A6SB 2IF2A 1QHHB 2VDPB 4E33A 1GZUA 5E38A 2C2YA 2CCGA 3Q3JB 3VR4A 1KSFX 2ASVA 3Q11A 4M1QA 5JAPA 4P38A 3HO1A 4PAOA 3MJHA 1RYFA 2OZPA 3DEAA 2X13A 4PYJA 3HL4A 1C9NA 2O48X 4Y1EA 1OFIA 1TYCA 3JQGA 4R2LA 1IJBA 2ZRAA 3UZUA 5I3ZA 3LUGA 4ZKEA 4EFLA 3KRTA 1XTBA 2I80A 1YO6A 4AW9A 2P8JA 3WC4A 4BKQA 4MYSA 2EU8A 2CEAA 1MX3A 3VJKA 5F5XA 1IUPA 3ZX5A 5K05A 2YJ6A 3EGXA 3LSTA 2R8ZA 3B5EA 2O14A 3IUNA 4C21A 1LDYA 5L53A 4BO8A 1T3SA 3ZKWB 4EJFA 1FLNA 2GJ9A 4JZKA 1DTWA 2ODEA 4J0KA 3B7WA 3KJHA 1IH8A 3RU3A 3WJAA 2W90A 4A6XA 4DR6B 1OFUA 2Q8QA 1N6NA 3AEZA 3P1JA 2AQ8A 1E2IA 1W88A 4M9XA 3KOZA 5KX5B 2ZCUA 1CQPA 5HKLA 1F6BA 2ST1A 2HIGA 3NJ8A 4F84A 4ZK2A 3SZUA 3TI7A 1E1CA 1PGNA 5JROA 5LP6B 5KC9A 2C7PA 2C20A 5LQAA 3N74A 4GBED 1HURA 1XKQA 4KO2S 4P9NA 4Q9AA 5CEJA 4PFSA 3LVRE 5CFZA 4D3FA 5IVHA 3ZDBA 4D4JA 3OTGA 3M1YA 2W8ZA 5IH3A 3DO6A 4KZPA 4EYSA 1RWNA 3BBLA 4EPVA 4I9HA 1H6AA 2I3AA 2J7PA 1PNRA 1HEIA 1JEAA 4EX7A 1J8FA 4Q01A 3RGWS 2CVQA 4GRDA 4YUAA 1FS4A 1HYHA 3V9AA 2YYZA 2D62A 1T0BA 1B16A 3LPNA 3AJAA 3QU7A 4INPA 5AR1A 4EK9A 4OLBA 4QEDA 1JHRA 3CH7A 2YXNA 3ZCTA 2QSZA 4IJMA 3H4VA 2EFDB 4QNMA 3J81k 3UKJA 2A0FA 1LLUA 1QU3A 4BASA 5JEEA 1TD9A 5IT4A 3CVYA 2H4HA 1GAXA 2J5RA 1T5IA 3DMTA 1DNPA 1E3DA 3H17A 3Q9SA 3KJIA 1ZH6A 3PUKA 4Q9HA 1JBEA 3FYDA 4CHTA 4TKUB 1DDOA 1W36D 3OM1A 4HWSA 1D4AA 1HV8A 3JCZA 4MR9A 5B7PA 1ECFA 1AQYA 1PZXA 3KHUA 1IOLA 2JS7A 5LLSA 2FPLA 1MJGM 3GZNA 3LIIA 4O1HA 1QG2A 2J6BA 1C4KA 1LFAA 2JHAA 2VSYA 4LQCA 4MB6A 5DB4A 1L5HB 4DSTA 4BFUA 3MWDA 1E9EA 2I6QA 4L3VA 4MYUA 1KMNA 1Z0DA 2OQRA 3M4XA 1X0XA 3UKDA 4BVAA 4DIUA 4H2DA 1CIJA 1Q7RA 4JOBA 2BJWA 2R6ZA 2YMPA 5FNVB 3TRIA 3UWOA 1LZKA 1VYTA 2JI7A 1VSQA 3CLRD 3E53A 5P8WA 4AMVA 3JPYA 2ZT6A 5LZ7A 3EZGA 1JHQA 2ICAA 2P0AA 1CU1A 4ZT2A 1MO5A 2CLEB 3DBRA 3KT8A 5FOVA 3HY3A 4MA4A 5HBRA 3CF4G 4YRBA 3A8TA 1NPYA 1XAIA 1PT8A 1ZW1A 2XT0A 2H1IA 1SVUA 3OFVA 2VJQA 2DBRA 3PEWA 5CVCA 3I83A 5JZSA 3DBVO 5ALTA 3G1UA 4M38A 4TQAA 1GPMA 2V9PA 4V03A 2FQXA 5L3VA 3FXAA 1MQAA 1Q3KA 2DCUA 4ZMBA 1N6PA 1QYDA 1B2LA 1G5PA 3DF7A 2FK8A 3KSMA 4JMPA 4PG7A 1UMCB 3AQIA 4Y8VA 4REQA 2NZJA 1ZM9A 3WG9A 4BS9A 2DMRA 1WB5A 2VP3A 1MRNA 1R4MB 1JQJC 1I7LA 3QMWA 1B1AA 2NU7A 4X93A 1OGJA 1Q3TA 4MUNA 2VDVE 4ZTBA 2HLNA 4Q66C 3VZPA 2ZYRA 3CKYA 3ZE6A 9ATCA 2QX4A 4EI2A 1DC3A 1HNNA 3BZBA 1HG1A 2WSSD 1OLXB 4D9BA 2COKA 3TSWA 2H18A 3OIFA 2QM3A 4RIFA 4XQEA 3VZQA 1CQZA 1CY6A 2REXB 4K05A 3FOZA 2Q4EA 4WW0A 2R65A 2HUPA 3CZMA 2WHEA 3H6GA 1TD1A 3T9CA 3ZDAA 3DULA 3ETNA 4W63A 3OQMA 3ZQJA 1K66A 3B1WA 3F6BX 1DUVG 3WK7A 3AVWA 1NW5A 3PCXA 5FWXB 2JI9A 3JQ7B 3UFBA 3SEFA 3AHCA 4GP7A 1V41E 3H1TA 5FBWB 3U3RA 4OQPA 4X97A 3EK2A 2YASA 1X15A 3FWZA 1CULC 5ESDA 5I9SA 2GEUA 2J5BA 3NP9A 3OMXA 1YA8A 3QITA 2BP7B 1OJ7A 2MR6A 3FGOA 3RHFA 1P73A 2AJBA 4BXOB 3BMOB 3CVOA 1QDUA 5D7BA 1SWWA 1PWXA 3LXXA 2R2GA 4RMGA 5C7YA 2D1RA 4UMEA 5J4KA 1QQAA 1G8FA 3EAQA 4UAGA 3VC3A 3IO3A 4FW9A 1NAIA 1NQUA 1T36A 3RTGA 1BHO1 4P3XA 4BJ5A 4LF9B 4YGXB 3GA5A 4M37A 1Q7TA 4QWWA 3TEJA 3AG5A 3GJ0A 4F92B 1CETA 1POXA 3HEBA 4HOYA 3UT6A 1E3EA 3NVDA 5A1TA 2ECFA 2VEOA 1A5SB 1RP7A 3JZMA 1U0BB 2TMGA 3DZFA 1TB4A 5DT2A 1I3CA 2C96A 3IIMA 3FUCA 1SD5A 2AKAB 4KQHA 3V7UA 1UEJA 3IOEA 4DLUA 4V0KA 4WH0A 4X8OA 1JDUA 2XX3A 3ST7A 1NLZA 5BSHA 2O8EA 3BEOA 3DOIA 2J6IA 4TYPA 3SG0A 5LMZA 3I6ZA 1LC0A 2R7AA 3INNA 4AO6A 5BV8A 4LFBB 3U4HA 2W2XA 4UDXX 4NY1A 4X6LA 2YMQA 3HI4A 3OZ7A 5DLQC 3OEEA 4MPTA 1MP0A 2OLEA 4A6PA 1BMFA 1D8TA 1T8PA 4FDMA 5G41A 3TIFA 4UBMA 4LNAA 5IYZA 1IXZA 2HDNB 1DZ3A 1KO7A 4KV9A 3WQHA 2FUG1 4GWLA 1KDVA 1KPIA 2I2CA 1VFNA 3RUCA 3GDFA 1U9ZA 4A1FA 5LIPA 3UWSA 5AYVA 1KY4A 3HXMA 3HL6A 1SO8A 4OHPA 3VNSA 1DDGA 1YBFA 3GLFA 1E3WB 5CVEA 4NWIA 4B4WA 5G0WA 3MJSA 5DLDA 4H7DA 2FPGA 1GGHA 1L7AA 1GZVA 4IVQA 4B5KA 2DPGA 5DYNA 2IEDA 3WFZA 1KDOA 4G1CA 3T06B 2P6RA 4NR0A 1NV8A 2C88A 1GUDA 3OJ0A 1LNQA 5DI3A 5DSZA 4C0QC 1V4NA 4RNDB 3ZK7A 2WEKA 4PGGA 5IW8A 1GNVA 5CRIA 4WK4B 2XMBA 1E66A 3AUSA 2DPHA 2ZTHA 5KYXB 2ZCVA 4WASA 4EO7A 3IQHX 5JFOA 3LY8A 3QV2A 5JJCA 1SXQA 1G55A 1JVBA 1SNYA 1T1SA 1ZSVA 3G85A 3GZTB 4R1SA 4U9IS 2D06A 2FMUA 1JJ7A 1FC0A 1ST3A 3L9WA 4ARZA 4Z53A 5BR4A 4N6NA 2PL5A 3K73O 1IE3A 4WLUA 1C7JA 3HBNA 2PGAA 4CTOA 1E20A 1SG0A 1X86B 2O0HA 3KB8A 4WADA 3W2HA 4B7CA 3OTWA 1RM5A 2IJGX 2AOUA 2VHJA 1PS9A 2I7XA 1ZIXA 3BYZA 4C7OB 5SV2A 3H9UA 5KCZA 5SZIA 4TXMA 3CWQA 5MF6A 3L04A 3PJGA 4LCBA 4NCKA 1DXQA 3VR4D 2QUHA 1F6DA 3K5PA 3GWZA 1LTKA 4YECA 4TS4A 5ALMA 2ET6A 3IUEA 2FUEA 3TFOA 4K9OA 2GM4A 5HWSA 2WINI 1NF8A 3VPDA 4XCVA 4JVNA 4YRRA 1YVEI 5JHHB 1CUEA 4EY7A 2A92A 1PP4A 1VG1A 2QG4A 2ZPAA 3QFTA 4EUNA 1T6NA 2C29D 1AUPA 3ESBA 4XTCS 4W1QA 3NCHA 3EXEA 2CZCA 1YDMA 2CNOA 1VJ5A 2P9HA 4U4AA 3RIHA 5K4GA 3BMQA 3HWWA 4QGFA 1O6CA 4A15A 2V1XA 1NJFA 2PXAA 3IP7A 3ZDFA 3U56A 1HX7A 1GPNA 4KGDA 2Q1UA 2Y93A 1FFHA 4PHHA 1HE8B 4TWBA 1MHTA 2YY6A 1YR3A 2AF4C 5L95A 1AK9A 4GI1A 5MN4A 1DSSG 2JGKA 1PNQA 3ILYA 1MB0A 2I4RA 2I2DA 2IH4A 1KJZA 5DEOA 2UYYA 1E5QA 1V16A 2BFMA 5EXEA 2LKDA 4HEQA 4F6RA 2V98A 5AVRA 4MI6A 4FNGA 1EEXB 1XZPA 4MHOA 4YMIA 4XYMA 1KIMA 3PUXA 1KO1A 3DQQA 2VR1A 1NU8A 3U19A 3RAPR 1WUTA 1S6YA 3FVRA 3HSKA 4GXQA 5HVNA 3HHPA 5C5EA 4Q6WA 3K35A 5D01A 2J7PD 2P5YA 4O4IF 1VP3A 3U3JA 3UG7A 2ZT7A 1IHYA 3HKCB 2EW8A 4V1CB 3Q8LA 3AVYA 1OV4A 3V00A 1YD7A 1XRPA 1J23A 3CZ9A 3OPYA 1M6VB 5GGXA 3BVPA 2AXPA 3E9NA 3K31A 4DCMA 1TNDA 4L07A 3TLGA 3D0QA 3VM6A 4C0KA 2ZYTX 3HN6A 3PC3A 1T6YA 4OAQA 3WLMA 3EZ2A 4TGLA 3O8CA 5I7HA 2EOAA 2D2IA 5IN5A 4KIJA 4UM7A 4YFYA 2WF8A 3KU4A 3JQQA 1REQB 1E79A 1SUBA 5JPIA 3EMVA 4X65B 3NBXX 5KUTA 3WV4A 3L18A 1G8KA 2JLQA 1ZD4A 2X7XA 3VQTA 1AZLA 3TOXA 4QELA 4E46A 4JYZA 2V4MA 1OB2A 3M2PA 1QHIA 5EP2A 2BH2A 2O7VA 2BZ0A 1ACJA 4V0NA 5A3QA 3UAZA 1FEZA 1OMOA 3A2LA 2MOKA 3EXIB 1JIKA 4C0HA 3QUBA 5FO1A 4LMRA 5ALUA 4FNMA 4XB6B 3VU1A 4WOKA 5PGMA 3UICA 3CI0K 1F20A 2UVQA 4OQ4A 3IP6A 1I4DD 1B74A 1YHYA 3NJ4A 2X3FA 4AZ3A 4IMJB 3OQNA 4TYYA 1US8B 1USWA 4GNRA 2PS0A 4DG9A 3ZBPA 1VA4A 9ABPA 5LP6F 2OWDA 1O9GA 3FAKA 1XZJA 3ZS9A 2BLNA 2XNKA 2JGLA 2R6AA 2JHCA 4GOKA 1SBIA 2C4NA 3D4NA 3BRWD 2DQYA 4FWIB 2JIBA 3C5EA 4KPUA 3GK3A 3HRKA 4NULA 1KP2A 3L7MA 1GUBA 3EBOA 2BMAA 1RC0A 3T5PA 3TOCA 4OF4A 1TCVA 1UZNA 3A2NA 1SCJA 3RYHA 1GPDG 2VKTA 3G49A 5NULA 2ZRIA 1FPMA 3R5HA 4HGPA 5D7NA 4TQ9A 4BLRA 1E63A 4LV6A 1LRKA 3CNHA 1WUHS 3P2KA 2F1OA 4KV7A 2I4IA 1ZSNA 3EIQA 2AA3A 2WPNA 5AVSA 1P2DA 2C8JA 4UUQA 1PSDA 1GR0A 2NV0A 3VOTA 5JWOA 4G5YA 3ELDA 4TKMA 3K0SA 2ZSBA 4EG0A 2FZ4A 2BW0A 1J2TA 4O63O 2B8NA 3KJFA 3ORQA 1XJ5A 4HB2A 1E9FA 3DVQX 3N59A 4ARUA 1QHGA 3H6KA 3MS7A 2UDPA 3QU2A 1IB6A 4MVCA 4N0PA 4UTOA 3TL6A 3VU3A 1N9GA 3QLJA 3DCJA 2NUPB 4KLCA 5CFRA 5HS4A 1RM4A 3JQRA 4WJLA 4MB0A 1IYZA 3ICOA 3BE5A 1S3SA 2CMGA 2GMWA 1YT5A 2OHHA 4ED9A 2BDTA 4YDQA 1YBMA 2OG2A 1VIDA 5CDYA 5KTOA 4M54A 1CHDA 1GJRA 2WKWA 3WA7A 2PV0A 1UPTA 2ZJBA 5KAMA 1A2KC 3UJPA 3TBFA 4FFBB 2D00A 3WLTA 4HT3B 3IEMA 2YRWA 4WVFA 3MGAA 3T94A 2V7QA 1I2AA 3BXHA 3ZPXA 3HDVA 4CM5A 4OVKA 4ZGBA 4OMFG 1KVSA 3I37X 5ECYA 4BEVA 1XTPA 2G9UA 2J4DA 4RKRA 4XOIA 3DE6X 1EH5A 2F67A 3RARA 4R68A 4PIVA 4CKCB 2G83A 4KJXA 2BM9A 1BW9B 1AN0A 1Z29A 5KI6A 1WZEA 4EHFA 3FRIA 5ALJA 3EDCA 4P93A 2Y9MB 3W05A 1A8SA 3T3GA 1NU6A 3IB6A 4Y2RA 1GPYA 4QUAA 1I3MA 3NTLA 3F7NA 3N0XA 1R0XA 4HJXA 1SIUA 5JSFA 5LKAA 4JXJA 1HI9A 2CFCA 1R8JA 5DW3A 4GKBA 1Y7IA 4Q3NA 4JUAA 3S1SA 1YONA 2GZRA 5DTJA 1NVUQ 4NMWA 4DWJA 3JD0A 1CP2A 1JEQA 1RYYA 4R69A 1PBNA 4KQGA 1W48A 3ZV7A 2XZLA 1TL7C 1QZUA 3ZS8A 2G1KA 3TAXA 1WDLA 4GRIA 3RIMA 1RAEA 3HP7A 3SC3A 1SIOA 4KWIA 1BMFD 4HWTA 5FBVB 2OWEA 2XA2A 2VJDA 1JB1A 1U1GA 1KOLA 2HQOA 4L0DA 4BX9A 4YXFA 5HGXA 1XZQA 3QK7A 5BYBA 5FNZA 3GP5A 2AFHA 1VL5A 3G5LA 5LYYA 1E61A 3WSWA 5FTLA 4KDFA 1QANA 2XNSA 3DVRX 3V4RA 5DV9A 3BK7A 3GAFA 1U7UA 1EHCA 1Z6XA 5H4HA 4GE3A 3EF0A 3PKJA 4B4VA 5C1DA 3LHSA 2PXXA 1IMJA 2PRSA 5DHAA 4ZQGA 2ZYHA 3WWEA 5CLGA 3MFQA 3Q7QA 4ZDIA 2X1VA 2ZDHA 1XCLA 1AKRA 2GHQA 2WJIA 3CLKA 3GMDA 3HEMA 4K9NA 3AVTA 4DA9A 3GT3A 3CEMA 4FFMA 2DPXA 1DPGA 2BKLA 3I58A 5A03A 4OLAA 2B34A 3HA2A 2RGDA 3BAZA 3S28A 4BGEA 3DBOB 1ONPA 2WJJA 2XWJI 3HDYA 4GO1A 4TUYB 5SYNA 3V42A 4A8PA 4U2GA 1BVUA 3F7TA 3C74A 4R8RA 3D6AA 4MR7A 3RC9A 3RB8A 4IRUB 4KLRA 4Q19A 4GPZA 5IC5A 1PYDA 1EXNA 1BX3A 2AQKA 1RIFA 1W59A 2FW7A 2PTGA 2YZMA 3DKPA 3N53A 4QO8A 4WZZA 5JNSA 1WPQA 1G38A 1KVTA 3FNBA 3SYNA 1WCIA 2C2HA 1MHPA 3KTAB 4P3OA 1SXIA 3UUFA 2GOYA 2H51A 1AE1A 3ENVA 4AG6A 1U28A 3L01A 3BGVA 4ZYWA 5DX0A 1H6BA 1L3CA 3C3YA 1FRVA 1ES9A 4IZHA 1L5LA 3RC7A 3WLSA 1Q0QA 3C0KA 1THMA 3K0AB 3BZUA 3MK31 4Y6SA 4OLFA 5IBRA 3FJYA 3T0IA 4CN9A 1GZ5A 3ZV5A 2EJUA 1QBGA 4ZCTA 4ZAXA 1V1RB 2ZI6A 4JJFA 1GGVA 4O0MA 5TE9A 2NUTB 1IBKB 4LXYA 3VVMA 3P0IA 4KQKA 4DBLE 1OE0A 2ORVA 5CFLA 3D6NB 1JYFA 4QD3A 4DABA 4UNQA 2VTBB 1PG5A 2JG3A 1GSOA 5HJ2A 3O94A 4ZZIA 6PFKA 3BN3A 2I2AA 4HDSB 3OZXA 1XXLA 1XNQB 2VH5R 1JVNA 2C94A 4JROA 1FDIA 3C8DA 3GX1A 3THWA 1GZHB 2WF9A 1YNSA 1YOVA 2HHCA 1NUSA 3PLRA 3X2FA 4ZV7A 4FN4A 2OCKA 5AKHA 4B31A 4QBGB 3MMXA 4QUIA 3DZIA 4N7RA 3RVQA 1PFGA 3FPEA 3TNLA 3ZCSA 3ZX4A 3OFSA 3PZRA 1QKKA 3IDZA 2C4MA 3G17A 4F45A 4FJ2A 5GOZA 8ABPA 5CLJA 1AC5A 2QWXA 3AOEC 2PNFA 3JYPA 3O95A 2XT9A 2QLMA 4BO7A 4D9GA 1WKBA 2BEUA 2JAUA 1W1UA 4JHLA 1LCIA 2DT5A 2WU4A 1DC5A 2QX7A 4MKHA 5CK4A 5CYPA 4A1OA 2VHCA 4XUDA 4DDKA 5F3WB 3REOA 1HQDA 2ZYUX 3KKQA 3O8QA 3KALA 2GBIA 4TLCA 5BWMA 1NOJA 5KVCA 3VR5H 3KCQA 3KETA 4QA9A 2AK3A 4QU9A 1QOPB 3WKEA 4O4IA 5AXDA 1R88A 1SUDA 2AQIA 2GRUA 1GSHA 4M9CA 4HDQB 3RUAA 2G7MC 1A9ZA 2JBAB 3HE3A 3B78A 4TWAA 3OPQA 4I6JA 3UMJA 1DQYA 1E79D 2RH9B 4IDDA 3FSGA 4JIMA 1EJ0A 3IT3A 1N2SA 2Q3EA 2X9GA 2J30A 3WNCA 4AIRA 2GXQA 2X9NA 2CLIB 1QHHA 1OBOA 4L8FA 1G3MA 1SCIA 4RKFA 4GMKA 1XMIA 3SF8B 3V7WA 5FHRA 4NARA 1XZFA 3VPFA 1Y3HA 3OHMA 3VKVA 1KKUA 4I66A 2BI7A 2GCOB 4BFVA 4EG3A 3Q8MA 2H63A 5EHNA 2SICE 1G8MA 4ENQA 1BXZA 3KEOA 2A5FA 2QTLA 1E7SA 5BWNA 4YPOA 4OKNA 1GY8A 2YWCA 4J1NA 4ZJZA 1O5OA 1E2UA 1DRWA 3PEFA 4PCVA 7GPBA 1ZM4A 3ADBA 1XTJA 2IPNA 2VDUE 5ERXA 5D2CA 2X3UA 4Q7EA 2SCUB 5E1DA 1BEUB 1I14A 2FWPA 5KJCA 4BRZA 1WULS 1NGSA 1M1YB 2WIJA 3O03A 3ZKWA 4XR9A 3I9OA 4QRDA 2NO5A 3O3CA 4R1PA 4Z0NA 5KKNB 1Y6QA 4HF7A 1TQDA 2MIIA 5EKUA 4REOA 4OB8A 3QX9A 1Z7GA 4WE3A 1ZU4A 1QF9A 3B48A 1NN3A 1OCEA 5KX5A 2V6FA 3AH8A 2EG9A 1FZQA 3CRVA 4IJQA 4PC7A 2C8LA 4ANFA 1E2QA 5LP6A 2I4LA