4DDNA

Structure analysis of a wound-inducible lectin ipomoelin from sweet potato
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
154
structure length
154
Chain Sequence
MALQLAAHSDARSGPVGSNGGQFWSFRPVRPLNKIVLSFSGSPDQTLNLISITFSSNPTDIITVGGVGPEPLTYTETVNIDGDIIEISGMIANYKGYNVIRSIKFTTNKKEYGPYGANAGTPFNIKIPDGNKIVGFFGNSGWYVDAIGAYYTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ipomoelin, a jacalin-related lectin with a compact tetrameric association and versatile carbohydrate binding properties regulated by its N terminus.
pubmed doi rcsb
molecule keywords Ipomoelin
molecule tags Sugar binding protein
source organism Ipomoea batatas
total genus 26
structure length 154
sequence length 154
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 4ddnA00
4R6NA 2HYRA 3LL0A 1WS4C 1KUJA 1X1VA 3MIUA 1ZGRA 1WS4A 2GUDA 4WOGA 1JACA 4PITA 1XEZA 3P8SA 4AK4A 3VZEA 1PXDA 3O44A 3LL1A 5EXGA 2GTYA 3R51A 1VBPA 5BN6E 5J50A 1XXRA 2BMYA 4PIUA 3MIVA 4GX7A 2GUEA 5AV7A 4AKBA 1WS5C 3WOBA 1UGWC 3LKYA 5JM1A 1WS5A 2NUOA 5J51A 3LLYA 3VZFA 2BN0A 5J4XA 3WOCA 4MQ0A 1KU8A 2HYQA 3LM1A 4PIFA 2GUCA 3VY7A 1VBOA 1XXQA 2NU5A 3R50A 1ZGSA 1UGYC 4R6RA 1UGYA 4PIKA 2BMZA 5J4TA 3LL2A 1UGWA 1C3KA 3LLZA 3MITA 3R52A 4R6PA 1OUWA 1UGXA 3AQGA 4R6QA 2GUXA 1J4UA 4DDNA 1M26A 1TP8A 1UH1A 4R6OA 1J4SA 2JZ4A 1UH0A 3APAA 4AKDA 1JOTA 1J4TA 1TOQA 3VZGA 3VY6A 1C3MA 1C3NA 4AKCA
chains in the Genus database with same CATH superfamily
4R6NA 2HYRA 3LL0A 1WS4C 1KUJA 1X1VA 3MIUA 1ZGRA 1WS4A 2GUDA 4WOGA 1VMOA 1JACA 4PITA 1XEZA 3P8SA 4AK4A 3VZEA 1PXDA 3O44A 3LL1A 5EXGA 2GTYA 3R51A 1VBPA 4D8MA 5BN6E 5J50A 1XXRA 2BMYA 4PIUA 4QX1A 3MIVA 4GX7A 2GUEA 4QX0A 5AV7A 4AKBA 1WS5C 3WOBA 1UGWC 3LKYA 1JI6A 5JM1A 1WS5A 2NUOA 4QX2A 5J51A 3LLYA 3VZFA 2BN0A 2QP2A 5J4XA 3WOCA 4MQ0A 1KU8A 2HYQA 3LM1A 4PIFA 2GUCA 3VY7A 1VBOA 1XXQA 2NU5A 3R50A 1ZGSA 1UGYC 4R6RA 4QX3A 1UGYA 4PIKA 2BMZA 5J4TA 3LL2A 1UGWA 1C3KA 3LLZA 3MITA 3R52A 1CIYA 4R6PA 4ARXA 1OUWA 1UGXA 2C9KA 3AQGA 3TOWA 4R6QA 2GUXA 1J4UA 4DDNA 1M26A 1TP8A 4W8JA 1UH1A 4R6OA 4ARYA 1I5PA 1J4SA 4MOAA 2JZ4A 1W99A 1UH0A 3APAA 4AKDA 1JOTA 1J4TA 1TOQA 3VZGA 3EB7A 1DLCA 3VY6A 1C3MA 1C3NA 4AKCA
chains in the Genus database with same CATH topology
4R6NA 2HYRA 3LL0A 1WS4C 1KUJA 1X1VA 3MIUA 1ZGRA 1WS4A 2GUDA 4WOGA 1JACA 4PITA 1XEZA 3P8SA 4AK4A 3VZEA 1PXDA 3O44A 3LL1A 5EXGA 2GTYA 3R51A 1VBPA 5BN6E 5J50A 1XXRA 2BMYA 4PIUA 3MIVA 4GX7A 2GUEA 5AV7A 4AKBA 1WS5C 3WOBA 1UGWC 3LKYA 5JM1A 1WS5A 2NUOA 5J51A 3LLYA 3VZFA 2BN0A 5J4XA 3WOCA 4MQ0A 1KU8A 2HYQA 3LM1A 4PIFA 2GUCA 3VY7A 1VBOA 1XXQA 2NU5A 3R50A 1ZGSA 1UGYC 4R6RA 1UGYA 4PIKA 2BMZA 5J4TA 3LL2A 1UGWA 1C3KA 3LLZA 3MITA 3R52A 4R6PA 1OUWA 1UGXA 3AQGA 4R6QA 2GUXA 1J4UA 4DDNA 1M26A 1TP8A 1UH1A 4R6OA 1J4SA 2JZ4A 1UH0A 3APAA 4AKDA 1JOTA 1J4TA 1TOQA 3VZGA 3VY6A 1C3MA 1C3NA 4AKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R6N A;  2HYR A;  3LL0 A;  1WS4 C;  1KUJ A;  1X1V A;  3MIU A;  1ZGR A;  1WS4 A;  2GUD A;  4WOG A;  1JAC A;  4PIT A;  1XEZ A;  3P8S A;  4AK4 A;  3VZE A;  1PXD A;  3O44 A;  3LL1 A;  5EXG A;  2GTY A;  3R51 A;  1VBP A;  5BN6 E;  5J50 A;  1XXR A;  2BMY A;  4PIU A;  3MIV A;  4GX7 A;  2GUE A;  5AV7 A;  4AKB A;  1WS5 C;  3WOB A;  1UGW C;  3LKY A;  5JM1 A;  1WS5 A;  2NUO A;  5J51 A;  3LLY A;  3VZF A;  2BN0 A;  5J4X A;  3WOC A;  4MQ0 A;  1KU8 A;  2HYQ A;  3LM1 A;  4PIF A;  2GUC A;  3VY7 A;  1VBO A;  1XXQ A;  2NU5 A;  3R50 A;  1ZGS A;  1UGY C;  4R6R A;  1UGY A;  4PIK A;  2BMZ A;  5J4T A;  3LL2 A;  1UGW A;  1C3K A;  3LLZ A;  3MIT A;  3R52 A;  4R6P A;  1OUW A;  1UGX A;  3AQG A;  4R6Q A;  2GUX A;  1J4U A;  4DDN A;  1M26 A;  1TP8 A;  1UH1 A;  4R6O A;  1J4S A;  2JZ4 A;  1UH0 A;  3APA A;  4AKD A;  1JOT A;  1J4T A;  1TOQ A;  3VZG A;  3VY6 A;  1C3M A;  1C3N A;  4AKC A; 
#chains in the Genus database with same CATH topology
 4R6N A;  2HYR A;  3LL0 A;  1WS4 C;  1KUJ A;  1X1V A;  3MIU A;  1ZGR A;  1WS4 A;  2GUD A;  4WOG A;  1VMO A;  1JAC A;  4PIT A;  1XEZ A;  3P8S A;  4AK4 A;  3VZE A;  1PXD A;  3O44 A;  3LL1 A;  5EXG A;  2GTY A;  3R51 A;  1VBP A;  4D8M A;  5BN6 E;  5J50 A;  1XXR A;  2BMY A;  4PIU A;  4QX1 A;  3MIV A;  4GX7 A;  2GUE A;  4QX0 A;  5AV7 A;  4AKB A;  1WS5 C;  3WOB A;  1UGW C;  3LKY A;  1JI6 A;  5JM1 A;  1WS5 A;  2NUO A;  4QX2 A;  5J51 A;  3LLY A;  3VZF A;  2BN0 A;  2QP2 A;  5J4X A;  3WOC A;  4MQ0 A;  1KU8 A;  2HYQ A;  3LM1 A;  4PIF A;  2GUC A;  3VY7 A;  1VBO A;  1XXQ A;  2NU5 A;  3R50 A;  1ZGS A;  1UGY C;  4R6R A;  4QX3 A;  1UGY A;  4PIK A;  2BMZ A;  5J4T A;  3LL2 A;  1UGW A;  1C3K A;  3LLZ A;  3MIT A;  3R52 A;  1CIY A;  4R6P A;  4ARX A;  1OUW A;  1UGX A;  2C9K A;  3AQG A;  3TOW A;  4R6Q A;  2GUX A;  1J4U A;  4DDN A;  1M26 A;  1TP8 A;  4W8J A;  1UH1 A;  4R6O A;  4ARY A;  1I5P A;  1J4S A;  4MOA A;  2JZ4 A;  1W99 A;  1UH0 A;  3APA A;  4AKD A;  1JOT A;  1J4T A;  1TOQ A;  3VZG A;  3EB7 A;  1DLC A;  3VY6 A;  1C3M A;  1C3N A;  4AKC A; 
#chains in the Genus database with same CATH homology
 4R6N A;  2HYR A;  3LL0 A;  1WS4 C;  1KUJ A;  1X1V A;  3MIU A;  1ZGR A;  1WS4 A;  2GUD A;  4WOG A;  1JAC A;  4PIT A;  1XEZ A;  3P8S A;  4AK4 A;  3VZE A;  1PXD A;  3O44 A;  3LL1 A;  5EXG A;  2GTY A;  3R51 A;  1VBP A;  5BN6 E;  5J50 A;  1XXR A;  2BMY A;  4PIU A;  3MIV A;  4GX7 A;  2GUE A;  5AV7 A;  4AKB A;  1WS5 C;  3WOB A;  1UGW C;  3LKY A;  5JM1 A;  1WS5 A;  2NUO A;  5J51 A;  3LLY A;  3VZF A;  2BN0 A;  5J4X A;  3WOC A;  4MQ0 A;  1KU8 A;  2HYQ A;  3LM1 A;  4PIF A;  2GUC A;  3VY7 A;  1VBO A;  1XXQ A;  2NU5 A;  3R50 A;  1ZGS A;  1UGY C;  4R6R A;  1UGY A;  4PIK A;  2BMZ A;  5J4T A;  3LL2 A;  1UGW A;  1C3K A;  3LLZ A;  3MIT A;  3R52 A;  4R6P A;  1OUW A;  1UGX A;  3AQG A;  4R6Q A;  2GUX A;  1J4U A;  4DDN A;  1M26 A;  1TP8 A;  1UH1 A;  4R6O A;  1J4S A;  2JZ4 A;  1UH0 A;  3APA A;  4AKD A;  1JOT A;  1J4T A;  1TOQ A;  3VZG A;  3VY6 A;  1C3M A;  1C3N A;  4AKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...