4DE5A

Pantothenate synthetase in complex with fragment 6
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
289
structure length
289
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated biophysical approach to fragment screening and validation for fragment-based lead discovery.
pubmed doi rcsb
molecule keywords Pantothenate synthetase
molecule tags Ligase/ligase inhibitor
source organism Mycobacterium tuberculosis
total genus 93
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4de5A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4de5A01
4S1OA 2E89A 3IMGA 2QUIA 3HV0A 4PBTA 3RBAA 3COZA 1QRSA 1COZA 4GRIA 4R0NA 2PZBA 3H9BA 1I6KA 1K92A 2O5RA 3H05A 2GM3A 3U1VA 4BWVA 3CLSC 4MW7A 3KT6A 2GKSA 4NX2A 1N77A 1A8HA 4PBSA 1MJHA 3KFLA 2D5BA 4ARCA 4ZCPA 4UZEA 5JBNA 5DASA 4MVYA 3FDXA 1ZUNA 1GAXA 1EJ2A 4WNYA 2DUMA 1MB2A 4DE5A 5EKDA 4RPIA 1KP3A 3X1JA 3LOQA 4K0RA 5HUJA 4MW6A 2V0CA 3H97A 3CVVA 1EFPA 5J58A 3AL0C 1TYAE 2O8VA 1MC1A 1M83A 4MUGA 2AZXA 4MUNA 1T6YA 3P52A 1S4MA 1KQPA 4Q93A 4YP6A 1I2DA 3IOCA 4ARIA 3SYTA 5K0SA 1QU2A 5KHAA 3QE4A 2A4MA 2QUKA 3HL4A 1YIAA 1PFWA 4DDHA 3COYA 2E0IA 1M8KA 1JGTA 4MUJA 3AFHA 1J21A 1QTQA 4ZT4A 1NSYA 1DNPA 1JIKA 1MBZA 1J70A 3SDBA 1EFPB 4UZFA 1O6BA 1TEZA 1V8FA 5K0TA 3N8HA 3F3MA 2CYCA 3G5AA 5LLTA 2BTEA 1WQ4A 4G5YA 1N2GA 3COWA 1H1TA 3AKZA 3PNBA 4HJRA 3VU8A 2CV1A 1O94D 2E21A 1YULA 1B6TA 5KWVA 4ZT5A 1YUNA 1O95C 1WOYA 4G6ZA 1VLHA 3CLSD 2YWCA 4JXXA 2DEUA 4MVCA 2XRYA 3H99A 2IELA 4ZCRA 1NI5A 4MUHA 3IDFA 1X6VA 2CFOA 4L2IB 2XRZA 2ZUEA 3CVYA 1U7DA 3RK0A 1OWPA 1OWNA 4I6GA 4ZT6A 1H3NA 1N2BA 3IOEA 2J09A 1D2RA 3RFFA 1GTRA 4U7JA 2QTNA 5J5AA 3PNYA 4MQ6A 1J20A 4OJMX 1KP2A 2X1MA 2JANA 3BL5A 2E18A 5TS2A 3P0IA 4MW1A 4KKVA 3GLVA 1GPMA 1WY5A 2CYBA 4EF6A 3KT8A 3CVXA 1MAWA 3SZ3A 3SEQA 1WXIA 4MW0A 1O97C 4MW4A 2A1UA 3L92A 2PZ8A 4EGAA 3SEZA 5IHXA 4A91A 2J4DA 1VBNA 3QTTA 1YI8A 3IMCA 4J75A 1G8GA 2CT8A 2H2AA 3IVGA 3KT0A 3IODA 1XNJA 3FIUA 1WJGA 2PG3A 3CLUD 1K4MA 2PZAA 4K03A 2R5WA 4G5FA 4MUIA 1O0CA 4GU5A 1J1UA 1O94C 4HPWA 1N2HA 2IJGX 1F9AA 2A1UB 2WB2A 3NV7A 4E1AA 3MLBA 3TZEA 1O95D 3LE8A 1Q15A 3N2YA 4AQ7A 1JIIA 1OD6A 1TFUA 1H3EA 4YBRA 5BNZA 4MUFA 1NZJA 3MMXA 1J1ZA 2J08A 3D6UA 4KR7A 4H3SA 3IOBA 1IH8A 4HJXA 2I1LA 4MUEA 3K32A 2A88A 1P7PA 1JHDA 3ND5A 3ND7A 1OWLA 4ZCQA 4DNXA 5HUHA 4NAHA 2AKEA 1OBCA 4MVWA 1OBHA 3MLAA 4TS1A 4OUDA 1NUQA 3FWKA 2TS1A 1QRUA 4MW9A 3UK2A 2V0GA 5FNZA 1U7XA 4MAFA 1KH1A 3K9WA 3CVUA 5TEWA 1XNGA 1U3CA 3RK1A 1N2JA 2A1TS 1O97D 2A84A 2QTRA 3PXUA 4MLPA 4ND6A 4XFJA 4XSVA 3G59A 3P0JA 1N75A 3ZJUA 1JEEA 1NUTA 1Q19A 3Q10A 2WQ7A 2PIDA 3DO8A 4YP7A 1TQ8A 4MWEA 3NBKA 1EXDA 1CT9A 1G8HA 1G8FA 4WSOA 5DB4A 1JZSA 2DXIA 2QJFA 1U0BB 1H3FA 3DV2A 3CLUC 1VBMA 4JFAA 2Z3VA 2DERA 1N2EA 2Z09A 1I6MA 4EG6A 3I05A 1EFVA 3GUZA 2QUHA 4XFDA 1KKUA 4KPUA 1F7UA 2RD2A 2QTMA 3UMVA 4DDMA 1F7VA 3COVA 3A4IA 1T9GS 1N2IA 3A05A 2DLCX 1IQ0A 3PRHA 1PFYA 4R2MA 4PBRA 2CV2A 2VTBA 4I6JA 1JMVA 1WZ2A 1PG2A 4CDNA 1M8FA 2GOYA 4EG4A 1IVSA 3Q12A 1ZJWA 1TYBE 1PFVA 3ZJTA 1WXEA 3IVXA 1EFVB 2CUZA 4ZT2A 1JIJA 4KPUB 4RUKA 3ZJVA 2D13A 2DPLA 3ILVA 4J76A 4NATA 1OWMA 1PG0A 4MWBA 1LW7A 4X0EA 1EUQA 1R6XA 1K4KA 1M8PA 3FG9A 5F23A 4YMIA 4CT0A 1MRZA 3OP1A 1N2OA 1JECA 3HFJA 3IUEA 3KT3A 1KR2A 5FO1A 2VTBB 2OV4A 4JYZA 4EG5A 5DK4A 1M8JA 4NDAA 3Q4GA 1HYBA 3TZLA 3ND6A 2EL7A 3RJZA 4U63A 3FETA 4P2BA 1IHOA 3INNA 1XNHA 3A2KA 3C8ZA 3VGJA 1O5TA 1Q77A 1KH3A 1WXHA 2YY5A 1KQNA 1T6XA 1BS2A 1N3LA 3FI0A 5KCMA 1YUMA 1TYCA 1TYDE 2HGZA 3FNRA 4KR9A 1ULHA 1NURA 5DEOA 4F4HA 2YWBA 4ZT3A 1VL2A 2ZUFA 3AG5A 4HK4A 3IMEA 1OWOA 4QREA 4QRDA 2ZP1A 3FH0A 2CV0A 1NUPA 3UC5A 1Y42X 4JZYA 1KH2A 5H16A 2CSXA 2X0KA 4MW2A 3FOCA 5FO0A 3S3TA 3VRHA 1N78A 1Q11A 1GZUA 3UOWA 3CLTC 1LI7A 2A86A 3AIIA 1EUYA 5TGTA 4FZJA 2C5SA 1O0BA 2QJOA 1WXGA 3CVWA 4MWCA 4EG3A 2OQ2A 3ELBA 3TS1A 4MUKA 2HZ7A 3H9CA 1ILEA 3MXTA 1R6TA 2PFSA 4EG1A 3ZGZA 5J59A 1MAUA 1MB9A 4I6EA 4MWDA 3X1MA 2HMAA 1VBKA 4JXZA 3ZUGA 4ZCTA 3G6KA 3P0HA 3IVCA 1IQRA 3UY4A 3CLRD 4OUDB 2CYAA 5LM3A 1I6LA 1QNFA 3ISJA 1T6ZA 1WQ3A 1QU3A 3OTWA 2H29A 1FFYA 2DETA 2G36A 2EJCA 2J07A 3ZIUA 4EG8A 3M5WA 4MW5A 3A04A 2JA2A 1KAQA 4DJAA 2A7XA 1JILA 2PXHA 4YP5A 3TQIA 4MULA 1XJQA 4CQNA 3HGMA 2QJTA 3FY4A 1YIDA 4L2IA 3SP1A 1NP7A 1O96A 3CA8A 4ZT7A 1R6UA 2X3FA 1GLNA 1GN8A 2A1TR 3CLTD 4NAUA 5AHWA 1QJCA 2WSIA 4U8HA 4ZCSA 5IJXA 1RQGA 2QUJA 3FHJA 2X1LA 3IH5A 1G59A 1LI5A 2BYTA 4F3RA 4PY2A 1GTSA 1JEDA 3NBAA 1M1ZA 2YXNA 1FYDA 3L93A 1V47A 5HG0A 2B7LA 1MOPA 2NSYA 2J5BA 4EG7A 1O96B 1PFUA 4QBTA 2DR2A 1K97A 1WKBA 1QRTA 3N05A 4KR6A 1UFVA 3D6VA 2D54A 3ZXIA 4MVXA 1KQOA 1F4LA 1QQTA 3MUEA 1T9GR 3CR8A 3TQOA 4DDKA 3GMIA 1NUSA 1U3DA 1M8GA 4DLPA 3CLRC 2IP1A 3SZGA 3PNVA 4CDMA 4Q16A 1ZH6A 2VXOA 1JZQA 2JAXA 3DLAA 3JXEA 3TNJA 1IFXA 1KAMA 2Z08A 5LFAA 4AS1A 1NUUA 3LCJA 2NZ2A 1KORA 5TEVA 2AG6A 1NYLA 3DPIA 2RE8A 5H7XA 3IUBA 3QTBA 1J09A 2WQ6A 1WXFA 3ZXSA 1ZH0A 3X1KA 3HMQA 4R2LA 1X8XA 1EE1A 3AG6A 3E27A 3N9IA 1N1DA 3HZRA 4NZPA 1IRXA 1IQUA 1SURA 4EFKA 4ND7A 3RHSA
chains in the Genus database with same CATH superfamily
5JS2A 1VGQA 1V7CA 4MO2A 3ZDEA 3HPQA 2BKVA 4NV3A 3CTMA 4K6OA 1WB4A 4UPVA 3HJAA 3QUAA 4GH5A 2FW0A 3DQZA 3KJXA 3V97A 1SCKA 4JVMA 5B3JA 1E9EA 1NV8A 1XC7A 2C07A 3DLCA 3DMNA 2I1WA 3K0KA 3K72B 4H0FA 1RFGE 1XK7A 1GSIA 2GFIA 4G63A 4MUXA 5KYUA 4EL0A 3U1VA 3MAJA 5LYJF 4ETMA 3R9KA 2ZRNA 4KNWA 3DZDA 1A1SA 3OKCA 4KE7A 1AS0A 2Q2OA 1PR4A 4GSKA 1DUVG 4EHLA 4LHYA 2NW6A 4GKBA 4KN5A 1J0EA 4XB6B 3GXBA 2C2YA 4JYPA 2CEAA 2CKMA 3ODGA 4WGGA 1WUTA 3KX2A 1GARA 2RMKA 3NJ4A 4MVJH 1DIOB 4NPAA 3UFBA 1KOJA 1W5TA 3WYCA 1XBTA 1Q3TA 4JUBA 2SICE 1GKIA 1EINA 4MS3A 2V97A 3ER6A 3ER8A 2Q29A 3WDSA 1FA9A 5BN4A 2ERXA 3QX8A 1FBTA 2DBVO 3IEVA 4F6RA 4RTQA 4FFBB 3HXQA 3ZDBA 3CVVA 3K5PA 3KAJA 3PGXA 1XAHA 2X14A 5DLQC 2Q49A 2QS9A 3ZV3A 3CC8A 4MUGA 1S1MA 3Q3IA 1LFAA 4Q12A 2J0UA 3U1BA 3OLXA 3PJDA 1J56A 2QRVB 5CIQA 3G8CA 5ALHA 4HQFA 2GETA 1QORA 2PE5A 1C81A 2LRHA 1A9TA 4H15A 5HKBA 3H6GA 2CHFA 4MPJA 3U26A 2IITA 4RV9A 5EVCA 1S1CA 3HSYA 3TVDA 3ZVKA 3DFZA 2ORVA 3PE6A 3SNHA 1NG1A 1RCTE 1YQEA 3TNLA 3GJ6A 2JDIA 3DMTC 2BMJA 4JLDA 1U2ZA 1ESMA 3INTA 3ISVA 1Z06A 2H9AA 4MV8A 4D97A 5G4KA 3OJFA 1N0WA 2JIZD 2ZS8A 3G0OA 4GNRA 4C3UA 4V3CA 1VDMA 3AW8A 4OXYA 3M6FA 2H0QA 1XVIA 3OJ0A 1L5OA 1O2DA 2F3UA 3O5AA 3R3XA 3A4TA 3R7WA 1F1JA 3B89A 4G5YA 3IPYA 1HTBA 1W34A 5LZ4A 3CB4A 1FFAA 2E5WA 1QB7A 4FK8A 3ZGXA 3K0FB 4EBBA 4EO9A 5IAAA 1ESZA 4ZVTA 3UGKA 1YRHA 3AKEA 4D6PA 1PYGA 4YJ3A 1DDOA 4C7KA 4QXAA 3CLSD 2GO7A 2XVXA 2QUBA 3H1PA 4KJZA 5EXPA 3SC6A 4JXXA 2Q50A 3JYOA 1KEPA 2PEZA 4D0SA 2IS2A 4ZCRA 1NI5A 2G9ZA 4QDZA 4TLLB 1X6VA 4IDAA 4BQQA 5LNK1 2I2AA 2ZUEA 1YZYA 4Z99A 5JQWA 5ED4A 1KY2A 5FHRA 3OWOA 1CUAA 3UGTA 4KG7A 3FM9A 1JEYA 1ZX1A 3E8MA 3F96A 3A28A 3GRCA 3HNOA 4I4TA 3SLRA 1VSVA 3DNFA 3FRHA 4EYQA 4NJMB 1V5EA 3A9SA 1DEOA 3K0CA 2OMKA 2XH8A 1AUQA 3PNYA 1HDIA 4FZ3A 2F3TA 2H4ZA 4J43A 5DXFA 2OBFA 3ZD8A 4DW8A 2DHCA 5GADl 1E92A 4YRAA 3HO8A 1Z0SA 3HKBA 4M98A 3UATA 3JQ7A 1PZXA 4LIPD 2J32A 1RM4A 2QN6A 5TS2A 2XGJA 1UT6A 1V0JA 4FYPA 2MJLA 2F1IA 3KTOA 4KKVA 1WY5A 2EQ5A 2QDKA 1E3IA 1Z0UA 1BVRA 2HLDD 3EUEA 3GZJA 3R1IA 1DS6A 3ZD6A 2X4GA 4Z0TA 3NHZA 1UKEA 3QVOA 3AFOA 1ZFNA 3KB6A 4DB2A 2F9MA 4GSLA 1XLUA 2E6UX 4UNPA 3SEZA 2DT8A 4MQFA 3DPUA 5D6NA 1KDYA 3IMCA 5KREA 4FPXA 4ZEOA 3CEAA 4H0CA 3FDJA 5EMLA 4L57A 3ZKWB 1B93A 4L5JA 1ADYA 2Z8XA 3OE4A 5JQGA 2ZSUA 4ZOQI 3HYTA 4JVSB 3U9LA 2G3DA 1DL5A 4JGIA 1R0BA 1KC1A 1MOQA 5CB4A 5FR1A 1Y8ZA 4N9QA 4S12A 5YASA 1KF0A 4HXGA 3BFJA 1U04A 5E0KB 2QEQA 2VHQA 2XNSA 1VE9A 1J1UA 4G0YA 3M6MD 2AJTA 2HRBA 4GU5A 2JCYA 4E7PA 1E9DA 3TLZA 1C30B 4JBIA 4GLJA 3PQ6A 1CUDA 4DYDA 1L9KA 4BRWA 1YBMA 2BM0A 4JUIA 6GPBA 4ZGWA 3IS3A 5IP5A 2XMSA 2ZPAA 3LE8A 4WUTA 5BO5A 1JIIA 4WK6A 3V8RA 3ABIA 5BQPA 2PH5A 4B32A 1QF9A 2QGZA 4KO4S 4ZXFA 5SY6A 4DY4A 1YR2A 1WB9A 3KTDA 1YBAA 2QTVA 4ND4A 2Y1DA 4NK5A 3ZX4A 3DMFA 1ZA2A 2ZRLA 1M74A 3OOWA 4DXDA 2VNIA 1T4DA 2OV8A 1RXEA 2Q4BA 4YUWA 5AM3A 3IIMA 4NARA 4F0JA 1KL7A 1KI7A 4NAHA 4QUEA 4ONEA 3GMTA 4OUDA 1E9FA 4DMKA 1NRIA 1JLLA 2PGNA 2W8BB 3IHWA 1KGDA 4L76A 3V3KA 5KNCH 4ERXA 4ETWA 2HIGA 4TMWA 2H8GA 3BJEA 4LYYA 4TLDA 1D2AA 2IHBA 4DGQA 3ACCA 3Q9UA 3GEHA 4LYFA 3CVUA 1WMBA 4M0EA 3G7NA 1I4LD 2X0IA 3L7LA 3BDIA 4HHEA 1X7GA 2FEMA 3B48A 421PA 2HK6A 3DP7A 1AX9A 1X94A 4QYIA 4XSVA 3FTNA 5TMPA 3GDOA 3PJFA 2FPGA 1IXZA 1SBTA 4PO3X 4TVOA 2X76A 1AMUA 3EA5A 1JEEA 4C14A 4EZIA 1C5KA 1YZGA 1K7XB 1HA3A 5CIWA 3LWNA 3R3JA 1M1XB 1XQ6A 5FUQA 3PUWA 5IXSA 3VYRB 3KR2A 1YZVA 3L1UA 1P81A 3FMVA 1FY2A 2VP5A 4C7XA 4WJZA 2GBPA 3ROMA 1U0BB 1KFBB 3DV2A 2DWCA 2JFXA 4KL8S 4X1KA 2NIPA 3CIFA 1QVAA 4NI5A 3ZCPA 3BIWA 4MS1A 5T41A 2WKQA 1ECLA 4G5QA 4DSAA 3IAM1 1KQFA 3HDQA 4KYIB 1KZ6A 1CRLA 1SHTX 2PT6A 1QANA 3CN7A 1KE1A 3V00A 2HUNA 4OQEA 4YP0A 4BVFA 3U7EB 2FUG1 1DAOA 5IH7A 1UBRS 4I50A 4XVRA 1AKNA 1TM1E 4ND8B 5FB3A 1C7JA 3NYIA 5AHOA 1TF7A 1TC2A 1QH8B 1HRKA 2IPOA 3JQDA 3PRHA 3VH4A 3OZVA 5CGQB 1CUHA 2ONZA 4MS4B 1LQUA 4K9LA 5A4MS 1W19A 3LC1O 3W7BA 1YS7A 2PBFA 2VXCA 1H5QA 1OVGA 2WT4A 4X94A 5COAA 5AM5A 1KI2A 2VZLA 4PF1A 4PZEA 4UBLA 1VE7A 3KAQA 3B2EA 3QWAA 1BEUB 2MSNA 2R8XA 2WHYA 2BZSA 2I2WA 3V7NA 1EYZA 3PUKA 4RQUA 1GITA 2GN1A 2VK4A 3V4SA 2WYHA 3L7JA 5E0OA 4CR7A 1B7GO 2OHIA 3A58B 2C3UA 4HNSA 3ZJVA 3D6HA 2ZCJA 1ORIA 1F5SA 4EQ6A 2I0FA 4HKTA 2FEPA 4IEEA 4MGZR 1Z3IX 3HUDA 2A9VA 1N5KA 1W0KA 2J48A 3DTTA 3K4PA 3N2NA 1MRZA 2X0RA 3HFJA 3IKTA 1W44A 1TFRA 1O54A 1NN3A 2FW9A 3RIXA 1GTJ1 3DVSX 5FO1A 4OHRA 3D6MA 3ZV4A 4P5DA 4PS1A 1H65A 3ELDA 1VHJA 3H19A 4NDAA 3KIPA 3MINA 4EJSA 3CW8X 2B4TO 2OSBA 9ATCA 1RRFA 3CX3A 5KSWB 1G38A 3F2VA 1PLJA 2Q4DA 4FGUA 3WWEA 2NTYC 3GHYA 4CV3A 3RE1A 5K20A 3I0MA 1PL8A 2QK4A 3FETA 2IYWA 1S2OA 3I30X 4TTSA 4DNQA 5K05A 1EESA 3ROXA 3EAGA 4QHTA 1VPEA 2IYAA 3LBAA 1ESEA 3USCS 4AJEA 4FCCA 3E3OA 3GAAA 3HK2A 2B4YA 1QO0D 3VR4A 2HSJA 3OZFA 1RYYA 3C43A 4KO2S 2OCXA 1KA9H 1M66A 1LJ8A 1VP3A 3QELB 1Q1GA 4EHNA 4OQMA 1B16A 2ZJFA 1I2MA 2ZI7A 1NZFA 1GT91 1MG0A 3E0QA 3IFSA 1BH6A 1E8MA 2WSMA 4HH0A 3RIYA 2JGMA 3GELA 3ZQJA 3HSSA 2JCVA 4R1PA 1ZIDA 3GT3A 1NNI1 3HEBA 4D81A 3UXEA 4DARA 3VRHA 2DMRA 3VNQA 4W9MC 1H8EA 3KV3O 3LP5A 1CS4C 1P5FA 3CRVA 3OLZA 1GZUA 5K09A 3Q2KA 4D42A 5C4IA 5BSWA 3T5DA 3IT1A 3NHSA 3VDNB 1PCXA 1UBJS 2Y1CA 3CCFA 2ZUCA 2BH9A 2CE7A 5K8TA 2GXQA 2WWWA 1JDBB 5JPIA 1XL1A 3G0HA 4LFBB 1KEWA 1KOLA 3RC1A 1P2VA 5JWOA 1ZHHA 2CFRA 1OYVA 3GLGB 4NULA 1CFJA 1QIDA 3U7QB 4CRWB 5C8YA 4II7A 4L51A 3I04M 4PPYA 1F0NA 1UPAA 1KK1A 3QLEA 3P1JA 1HQYE 4IIGA 4TX1A 3WB1A 3AXSA 1QFZA 4AS3A 3KETA 1XEAA 4EP1A 1O6ZA 3MWDB 4FE7A 2PFSA 4XWYA 3SGLA 2GXAA 1I8TA 1TCUA 1URPA 2J5RA 4GXRA 1DEAA 1F5NA 1DOHA 3REGA 1A2BA 3EJ6A 3RI3A 3PD1A 4Q3KA 4PYMA 1SU4A 3NW9A 3ZOKA 5FNVF 4JXZA 3VPBA 3K5HA 2KPOA 4G26A 4XOUA 4JQSA 5JE8A 3PE4A 1M5RA 3KELA 1MENA 2QRHA 5J9FA 7REQB 4DA9A 1KMMA 3P0HA 4FYVA 3F46A 2H7CA 5BOSB 3DC2A 3PLNA 2WU0A 4KHZA 5DGXA 4KITB 3ZE2B 3UHJA 4CIXA 1KDTA 4FB5A 3FCOA 3A1VA 4XJSA 2A78A 2V55B 5KNBD 1NG9A 3D7KA 1QNFA 1GPNA 1EUDA 2JJYA 2V4UA 3PE3A 2XA9A 1PUIA 1PWZA 3VHLB 3WJ7A 4ACAA 2WBLC 3L04A 1B6GA 3OBBA 4MW5A 1XCBA 2BPOA 3GFSA 3OY7A 3FOZA 2I65A 4DR7B 2Q3EA 4X91A 2C4NA 2XV1A 4CFYA 1NU6A 4WOBA 4B4DA 2IS4A 2JI9A 3LJKA 3TXAA 3WL3A 2RHMA 2R6CA 1B6RA 5B1IA 2WF9A 1GL3A 3ZHUA 2KX7A 1J5EB 3GLFB 3VR2D 2B5VA 3M6LA 4CFZA 4AM8A 2X5OA 4LNUA 3DE3X 4B3MB 4EY6A 3OFVA 2C54A 3PP8A 1E2NA 3NETA 3P9YA 4NAUA 2IYLD 1GNVA 1M2WA 3BGDA 4B47A 3AYXB 4E4RA 3T3NA 3KC2A 3PXXA 4E21A 5LN1A 1K06A 1CKEA 3QUCA 4YB8A 4AG3A 3QKTA 3WLLA 3FHJA 1NMSA 2WLSA 2W6MA 3BDAA 3IH5A 1LI5A 3KOOA 4YWJA 1G59A 4OHYA 4KXUA 3RU3A 4BO1A 1SCUB 4C6HA 4N03A 1EDOA 1AUOA 1DBPA 3OJWA 1MFZA 1V47A 2BDUA 1WUHS 4KR0A 3FUTA 5I9IA 5KYWB 4D9BA 1JSXA 2RGAA 1VJ5A 3OM1A 3STXA 4PHFA 3C6QA 3EXFB 1Z4QA 3DS8A 3L8GA 1P61B 3QMWA 5DGHA 1QYDA 3S55A 1AQLA 4YNBA 4CR6A 2ZITA 4XFKA 5KKNB 1Q16A 5B57C 2YY7A 2RH9B 4FT2A 2F90A 4KBGA 4RVNA 1VOTA 3UJPA 4D4KA 1WKBA 2VJPA 4LE1A 1FK8A 4IXWA 2C4WA 4KQ1A 3DTVD 2PZGA 3K6SA 2NQTA 2FP4A 5K3AA 3R7AA 4KUGA 2V7EA 3TGWA 2XEDA 9LDTA 3W4IA 2FE1A 2I2CA 4O4HF 4DDKA 1DAPA 1FTYA 3AVOA 1M2VA 1AC5A 1V35A 5EEHA 3K0EA 4HN2A 2P30A 4TMTA 5F78A 1CDEA 1E3QA 1PTJA 4KJXA 3NUGA 1YZKA 3P0EA 3L79A 4GPAA 4KWEA 4MVJD 5U1PA 3U4MA 2QRMA 1Z28A 4KXQA 1JSZA 3CSSA 4J0EA 2VDJA 2VOJA 5A7HA 2ZAGA 2ODQA 1BQEA 2ZJOA 2ZWIA 3I64A 3IKMB 4UHEA 1RJEA 3UT0A 5LFAA 1UJ5A 4G8BA 3LCCA 1E1YA 2NGRA 1DLIA 1AB5A 3N0XA 4C4SA 3BKWA 2IBTA 1H6AA 2DTXA 3DE1X 1YC2A 4RA9B 3ZXSA 1PU2A 1TJPB 2Q1XA 1P5RA 1A3CA 1I7QB 2XYHA 3LGSA 4MWOA 1DO8A 1SOVA 3IXQA 3I6ZA 3MRVA 5U9CA 3T1VA 2VPXA 4EJFA 3C3MA 3IOMA 1KPIA 3GG2A 3KRTA 1C3LA 4EUSA 1MO2A 5JARA 3GJSA 2C3PA 4UVIA 4ZQHA 4N76A 3S2UA 1IY0A 2UYGA 4HNRA 4EMBA 3K1JA 4FR5A 3SHOA 3V8NA 3KYDB 3QG5A 4JDUA 3RBAA 3HMKA 4CQLA 2IV3A 4YRIA 3UAXA 3UA4A 3IMFA 4J1NA 4NBKA 5DW3A 2HA0A 3VXKA 4DUGD 2FN7A 1K92A 3RYCB 4RH0A 1EDDA 1KZ1A 1YNOA 1C7IA 2PYDA 5I9SA 4ALJA 1A8UA 2D2VA 4ZXPA 1YR7A 1SHLA 4Z0NA 3VO9A 4FJ0A 4JY7A 1NHWA 2EP7A 4KAXA 3WKDA 3N86A 2C0QA 1JQBA 4ZDWA 2WM2A 4RJLA 1IXRC 3VZCA 1RWWA 1YQGA 4N9WA 1L2TA 2JLQA 2FSSA 4QTTB 4X3PA 3WV4A 1W1IA 3FMFA 4OKNA 4ZCPA 1XMQB 2O2ZA 3L4EA 4MVYA 1UEIA 1XKQA 4PRZA 4Y2UA 1APBA 1DT3A 3A6HA 4B40A 1V6CA 1P77A 3T7AA 3J7TA 4DLSA 2QPOA 4DE5A 3M49A 4LCEA 5C4MA 1B3BA 4RACA 5JVDB 2EFHB 4KIJA 1LBHA 5ALVA 1SNYA 2I7VA 3C6XA 2G80A 2HA4A 3F3YA 5HZHA 1HL7A 4P34A 1J4AA 3E03A 1RBQA 3PQ7A 1ODSA 3H8SA 3FTQA 2CLDX 1G5IA 3MJCA 2AOTA 4ZZ2A 3ULKA 2N42A 1T0PA 4G0XA 1NSFA 5ELLA 5H59A 3BD6A 1YBVA 4GVLA 4CWAA 3FAZA 2A4MA 3EXAA 2D5LA 2IXAA 3EGWA 4J8PA 4QO8A 3KD2A 3FNEA 4UQOA 3FTDA 4HFMA 1Y3DE 1YR1A 3L6UA 4UU0A 5EWJB 1GL6A 1PP4A 2FLVA 2Q5CA 2F3QA 1IZ0A 2HRCA 2P2SA 3REQB 4BMCA 1IZYA 3JWHA 2CXQA 3E4DA 3PVSA 2ZUTA 4DCPA 1PS0A 3J81k 1NJ2A 2A92A 1AD2A 1I13A 2IHKA 4O2BF 4WH0A 4J0IA 2EC5A 4F9TA 1Z6YA 1NR1A 5CCXA 4W8OA 1Z6XA 1XX6A 2AHRA 4IZ6A 3CGGA 5A71A 4DA7A 5HW0A 2Z6QA 3U62A 2OHFA 3THXB 4AMUA 2WD7A 2VJMA 2OD9A 4HNVA 1BJTA 1ECGA 4ZQGA 1WZUA 3GB9A 3DE0X 2IUFA 1XJCA 2RJ3A 1ZCJA 4ZREA 1MLDA 1WOYA 1EQUA 4WIAA 1VLHA 1W88B 1E7WA 1IG0A 3BQ9A 3G0DA 3QBDA 4Q4AA 5ERXA 1JYEA 5JAZA 1UK7A 3O8CA 3GXOA 4JC0A 2V8BA 2GBLA 1F6WA 3BE8A 5CK4A 4DNPA 1ZK1A 1KMHA 3KXIA 4N18A 2Q7DA 1Y4SA 4JLNA 4MYUA 3WIOA 5ULLA 4AKSA 3PX3A 1ABBA 3MILA 1FDTA 2PL1A 1RPNA 2QY9A 2BD0A 3IOEA 4BFLA 3Q8XB 1UQRA 2ZRQA 2BFAA 2HO4A 4WLOA 1RJDA 1P9LA 1ISJA 1Z5ZA 4PR3A 3DV0A 2B78A 2WSSA 2X7JA 1ZMXA 1UJBA 4KZKA 3O9ZA 1L7EA 1SUEA 3NUQA 3PZRA 1UBFA 3R0JA 2PKWA 1Z0IA 4B84A 1PL6A 4C2UA 1MX5A 3OCJA 4TYNA 4ZCLA 1P7WA 3BILA 3NYRA 2ZW9A 1VKOA 2BEKA 1S2LA 2PQ0A 4PIMA 5I4BA 4NZNA 1R4NB 1Z7BA 2BM1A 4PLTA 5CX1B 1NBHA 1EWYA 2H4FA 5TQJA 3TE7A 1G8YA 1D2EA 2NVBA 4FI3C 2J4DA 1YI8A 5JCPA 1KSJA 1AQIA 1JG1A 1ZGHA 3Q3VA 1V9CA 2GMWA 5EP2A 3S1AB 4DC1A 3NANA 3IT2A 2X42A 1ZD3A 3OOSA 1AGNA 3OTOB 4WNAA 3IVGA 4UHDA 4ZMBA 4QBKA 5H81A 2IZOA 3EPPA 5GONA 3VSBA 2HMVA 2IEGA 3EXG1 5HRUA 2VT6A 2WVHA 2OR3A 2G7MC 4WLVA 3TTWA 5JAOA 3WIUA 3HEAA 3DM5A 1NW6A 4YIHA 2BKAA 1G20B 4OIFA 2JIBA 4XH9B 1RWPA 3UWMA 1SKQA 4S35A 3P71T 3OMWA 3HJUA 4B87A 3COPA 4Q1EA 4D5EA 5P21A 4MKFA 4QU9A 2PRSA 4OYYA 5E8RA 5ENZA 3E8XA 4UPDA 5KYKA 1U2EA 2JFOA 4J7AA 1PDOA 5PGMA 2QVXX 4DMGA 3BMOA 2D3TA 2HMYB 2VSOA 2WG1A 5B1YA 1GUFA 2H85A 3EISA 2FW8A 4GZ3A 3T9EA 2FQWA 2PSSA 5AMXA 3UO8B 1GPAA 1T26A 3QU2A 4QUAA 5AVJA 1Q50A 2AN9A 2J08A 2A56A 2WD8A 3B52X 3K94A 1C2TA 4BO0A 1E0KA 3KNZA 3R5JA 4G1EB 3IR5A 3DWFA 3IOBA 2OO5C 4O3MA 4HJXA 1SC6A 3T0IA 2QTLA 5AVTA 1W94A 3SYRA 5A3RA 1FMJA 1YDFA 2XTZA 3EARA 1NNSA 4AAYA 2XE7A 2HQRA 1QV9A 1S2DA 5K0FA 1EIZA 3HPRA 4H31A 4PW0A 4E33A 2O8CA 3N53A 3NHWA 4MYDA 1EU1A 3B85A 1XA3A 3DTVB 3A3NA 3KZXA 3CI0I 3UK2A 2FDXA 2HMTA 3GJRA 3KPJA 1P29A 1OXVA 1U8UA 1KJQA 2ZGVA 1K8RA 1HOXA 3I37X 3RTGA 2VJKA 5CBPA 1OAOC 4XR4A 2KBFA 4QUGA 2B9EA 5F3WB 5FIUA 4JNKA 1OREA 3LVBA 4TXNA 1C9JA 4CEIB 4K9QA 1ELOA 1QP4A 2FAXA 1XZBA 2FV8A 5EXEA 2ZAMA 3L0YA 4NCJA 2G6BA 5FTJA 2ENUA 3VUFA 4PGMA 5SYAA 2VP3A 1Y98A 4C7VA 4RTLA 3DO8A 4YP7A 4I1PA 3T3EA 4QLOA 4RVCA 4EFDA 3GEDA 5GIPE 5DYGA 1VJGA 1FQWA 1HG0A 2VZ9A 3IBCA 5DLDA 2JFGA 2YOGA 3GN2A 4OPMA 4LC9A 1QVWA 2PZKA 4H4DA 1OI3A 5H3HA 4DG8A 3ZDRA 5LKRA 4IO1A 3VH1A 1LVHA 4NMMA 4XQEA 2OORA 4MITA 2CB9A 2WJVA 3VTKA 1N2EA 3BD9A 2Z9CA 1BWQA 3I05A 1CJMA 3A3KA 2GJ8A 2IP4A 1M1YA 4B2YA 4RVUA 1NVMB 3QENA 1OXBB 2QRQA 4KX3A 5IT0A 3QQ5A 5HQTA 4BLQA 1MQSA 2ECOA 1T1RA 2IA5A 3AWIA 3W2GA 1Z2CA 3LX6A 2WIAA 4HS4A 3TEMA 2R68A 2XRFA 1Y3BE 3M82A 3PDIB 1UDCA 4ZQIA 5LOVB 2FSVC 2L18A 2JFHA 3FMGA 4Z9YA 3C8UA 2VJAA 4GGMX 3DOJA 2ZRGA 2RGDA 5C34B 3T3HA 5A6SA 1JUDA 4NU6A 1RKUA 2EBFX 2OT3B 2C9ZA 3GG9A 4JGGA 1RJGA 3LX5A 2JC3A 1XUOA 1ZY2A 2GKGA 1MAVA 5CYFA 5HKAA 3GLIA 3ONNA 2VYFA 1FOEB 2HU2A 3N8GA 1SVMA 1F60A 4H77A 4ZT2A 4WACA 4U0JA 1ORVA 1XU9A 3LO5A 3RJMA 3ZWCA 4Z3DA 1HDOA 4POAA 3RSHA 1QE5A 4HN4B 4RAOA 3CZ5A 3TXYA 2FDCA 3DZGA 1G8AA 1YIOA 2VSYA 1K4KA 1UFOA 1MKYA 2JFFA 2CD9A 1OA1A 1GGJA 2EWMA 2J4CA 1H2HA 2M2IA 2YV5A 1R27A 3QH4A 3JSAA 1KO8A 4W5JA 4CLRA 1N2OA 4BLVA 3Q7QA 2VJBA 4FSHA 4RGVA 1EGQA 1GA6A 2C2HA 1V2GA 1T0BA 2BGJA 4HDNA 4ARSA 3U6BA 4RD4A 4QOFA 7ADHA 2RI0A 4OB7A 1GTVA 2JFBA 3MUOA 4LSMA 2C97A 4I1RA 1E1CB 2B6HA 1Y4ZA 3K2QA 3PUXA 4DQDA 5CA1A 1PGPA 1UJ6A 1QHYA 1JDVA 3QLJA 5IVIA 4C9BA 4F5YA 4BGEA 4DQLA 2C1EA 4WKCA 2JI6A 2NU9B 5L51A 3E2MA 1I9CA 1ESDA 1XPJA 2GZHA 1BCRA 4F5EA 3A14A 1G18A 4QUDA 3B6ZA 4G24A 2WJGA 4PLHA 5E95A 3MTAA 4GX0A 2H00A 3G8AA 1EBUA 4DEYA 3W8EA 2V0NA 1NA5A 1SK9A 1RE0A 5ALLA 1BWSA 5G0VA 1USWA 5HF6A 4Z2YA 4EMUA 4Z9XA 4QECA 4G5RA 3VYWA 1CERA 2I62A 4A8JC 2HCFA 1GDDA 3G2KA 2HF8A 4MRNA 1LGYA 1ZNXA 3DHNA 3EVZA 2Y4OA 4UCXA 4ZDIA 5CFQA 3WRWA 4S1PA 3NTRA 4FU0A 1GGNA 1N5DA 4C4ZA 5BR1A 3TL2A 2P41A 5T64A 1UFRA 3CZRA 1ZW1A 3EF1A 1W5EA 3RAPR 4M8LA 4C3VA 3CNQS 3O4JA 3ORRA 2WAXA 5FRDA 1KZGB 1G3IA 1KSFX 3T4EA 1ZSNA 1EJ0A 2Y1XA 1SIOA 1XNQB 5BVGB 1FPQA 1RIIA 5G40A 4C0LA 2B4AA 2JDID 3TNYA 1TB4A 1OFUX 3BJRA 3IQWA 4GYWA 1Y3CE 4TTJA 3ZCSA 3ON5A 2P3OA 1BW9A 1X15A 1DEKA 3N8NA 4KTVE 5CNIA 3DAPA 3OF5A 5GY7A 2V7GA 1UMBB 3KEQA 1OZHA 4WZ6A 1ATZA 1R0WA 3QY9A 4AB1A 3JZDA 4UUOA 3GFQA 4YAIA 2Q28A 1UL1X 4UAGA 1I2BA 3U09A 1Q5PA 1WP9A 1T5BA 4HVAA 1L5YA 1LA2A 2XOKD 2A0WA 3AZOA 1CV2A 2W6CX 4ICIA 1JDTA 4ER3A 3C5WP 2EZUA 2HUPA 1ZO8A 4A1OA 4BWFB 3LDUA 5G53C 1O9GA 1FJHA 4JCOA 3NC0C 3HB0A 1X87A 3A4LA 1LDBA 5IHPA 3IT0A 1QX4A 4V0QA 8ATCA 1M0EA 1SN7A 1TEVA 1U7WA 3A8TA 4M1WA 4YPFA 1C14A 1TVEA 3SF8B 1M34E 4JU8A 4YRGA 1QU3A 3R41A 1O9BA 5CDSA 3LQ4A 2FMIA 2O7VA 4LRYA 3UV7A 1UKCA 2P9CA 2X0NA 2G4LA 1PSDA 5E3JA 3RKUA 2R8OA 4EA7A 2JLXA 1U65A 3STUA 2HYDA 1RLMA 2JGKA 1L7RA 3EUAA 4X20B 3U4HA 3PHJA 1OF1A 2GS9A 3IP1A 4Q6BA 1ZRMA 3I0ZA 4TWIA 2GF2A 3PIDA 4PZCA 1ZJ4A 4NABA 1WCYA 4BKRA 1B00A 4BLOA 5HWSA 3U4QB 1T4CB 3G0BA 3W79A 4YAKA 2EWWA 2J59A 3CA8A 3NWPA 1K88A 1FNCA 5DIFA 4D3YA 3O0DA 3KUUA 2A1TR 4BP3A 1D4ZA 3H87A 4LNHA 3I9JA 5DHPA 5LXTF 3DKKA 4PZ0A 2WA2A 2BTQB 4F2DA 2ONCA 2XYPA 3H1GA 3O82A 1NVKA 4IF4A 3EEQA 4O1IA 4C4RA 5LC1A 2G82A 4MGIR 2FFAA 1Z4MA 2D2XA 2FZCA 1NRWA 2H48A 1EB8A 3KQOA 2E3JA 3FFXA 4UREA 3RANA 1TZBA 2GLUA 1RNLA 4CMIB 2O06A 4FMBB 2XCUA 2MYPA 1RWVA 4HR7A 1JJFA 3D5TA 4U5XA 3RS8A 1QS0B 3EPJA 1JP7A 4QDUA 4F2WA 4G56A 2C92A 1YSCA 3OWXA 1MOPA 4FE4A 3GFBA 4YFYA 1BX3A 1O96B 1BDJA 2I4IA 2WOOA 4ENWA 2OENG 5C3MA 3V2UA 1HY3A 1E66A 2NYRA 4P36A 4DCOA 5AP9A 1R0XA 2EJWA 3V7UA 2YV2A 1P2FA 3QHPA 4C88A 1EGMB 2P6OA 1UWLA 3MMSA 4HEQA 1N6IA 1QLWA 1WSDA 3NHLA 4R1TA 1JWAB 3X1ZA 2M6SA 1E6CA 1QZTA 2IIVA 2SBTA 3I6QA 2UXDB 4Y6LA 1SVUA 3PI6A 4CKYA 4DY6A 1Z2PX 5FKJA 1Z29A 1F8YA 1J22A 3DEHA 3I8XA 4MAMA 3PLRA 1E9SA 3STWA 5ALQA 1U63A 2P2NA 3ZHZA 3DA8A 1NF9A 2R751 3DEYX 3OLWA 5JNRA 5FOQA 4Z0PA 1F2DA 4N5MA 1G64A 2WWGA 3W2FA 4H7DA 3ZKAA 1ORRA 3WGOA 1ZL2A 4DT1B 3G6WA 5CDFA 1E2IA 5CUQA 3MGBA 1MPXA 4HDKA 4LK3A 4JI5B 1G4HA 2QT9A 3AJDA 1YZHA 4QGBA 3UKJA 5ITZB 5L6MB 3THWB 1Y8QA 5IN5A 3BHNA 4HGZA 1AA9A 3DR5A 3FPHA 1QF6A 1WEKA 4FTWA 5AKZA 1AGXA 3HUFA 4PZYA 3L8EA 4FC6A 4IDDA 1VKHA 3VX4A 2ETXA 5CVVA 3WFJA 2JARA 3KJIA 4H27A 5A5GA 1U98A 1JFTA 2OY0A 1QIGA 3LIPA 2KM1A 3A70A 5B7GA 3C1UA 2QYTA 3PPWA 1QTRA 1E64A 3OCUA 3TX2A 4IVRA 3ETNA 5D01A 5DNWA 2OUKA 2X8JB 3MWJA 2NT3A 5ER9A 5F3RA 3JASA 2LXNA 3V1NA 1U0HC 2WIFA 1BU8A 3OPNA 4KUHA 3BGWA 1XAJA 1ZCZA 2ADMA 1UC8A 4C22A 5AIBA 1R8SA 1A9OA 4U7GA 3K05A 5CEEA 3UMGA 3H05A 2CXRA 3RIGA 3SR3A 1QH0A 2NYAA 3FJ1A 2D1YA 2AVNA 1JPJA 1LQTA 5GOZA 5JAIA 1RWBA 4N0DA 1GQSA 2NSHA 2DULA 5TX7A 1U9IC 2AN3A 2W0SA 3W90A 1K68A 2A5JA 4Q3DA 4MKRA 3AKCA 3UK1A 1FPMA 1QIEA 2WG0A 1I9GA 2P6NA 1RTTA 4MVJM 1P8AA 2DT5A 4KKXB 3ZVRA 4I9NA 1QYVA 2ZE7A 4YDHB 2FKAA 1VI2A 4KK4A 4HVCA 4RPIA 1W48A 2EBHX 5E1BA 3Q7SA 3TUJC 3NIWA 1C29B 3QKWA 2R6AA 5ESXA 1T1SA 1QRRA 3F7NA 3ANSA 2GJ9A 2JF0A 1EFPA 3NPAA 1TX4B 2W6ZA 3OZBA 5KYUB 3OCVA 3AL0C 1NKVA 3GJTA 3H8VA 1DX6A 1GQRA 3Q1LA 1NUHA 4O4LF 2FDRA 4NHOA 3PK0A 4UBOA 4B5LA 3IIEA 1T6YA 2FX5A 1ML4A 3H3JA 2HMWA 5AD1A 1ITZA 2ANCA 3S5JA 5LPNA 2AR9A 4D9FA 2PRIA 4I1UA 1JR2A 5C52B 1FTSA 4MI1A 4B7ZA 2YNMA 4INOA 3BT7A 2UUBB 2JIRA 3GA5A 1J99A 2X3UA 1Z5GA 3ROPA 1QK3A 3P2MA 4KQXA 1W0KD 4LQLA 1P60A 2WPDA 3BJMA 4F6RB 1DV2A 3ZLBA 9GPBA 1ACJA 1BYUA 4YHHB 5CDYA 1SZCA 2RK3A 3M2TA 1YS4A 2RGNC 4JLVA 4NE9A 5TJ9A 2V8OA 4BUZA 2VR1A 4S0XA 5AHRA 3E9QA 4CIBA 1VHDA 5EPUA 1H93A 1HTWA 1WQ4A 2J0UB 3L8HA 1W581 3COWA 3O6VA 5LUBA 5AT1A 2FKNA 3W5SA 4CU5A 2CV1A 2R1TB 4LZAA 4UMVA 3GHHA 4BGUA 4XZ3A 3GGGA 1H85A 2D62A 1TLFA 2JGLA 2D5CA 2QMUA 2XMCA 2XMGA 3KKNA 3NG1A 5JROA 1VI6A 2VUIB 2YWHA 3AO0B 3LYAA 4WECA 2OAP1 5KIAA 2ZT8A 2E4AA 3VR4D 2EEZA 3TLGA 1KAGA 1R66A 4RD2A 4EB0A 1XEWY 2MINA 1W6UA 3ZDZB 1MR3F 3ANMA 3IEPA 5HXAA 2JKZA 5IANA 3L1IA 2MWMA 3D7MA 1A8IA 1FFEA 1YRWA 4G9BA 4M9SA 1DWPA 1S9HA 2OV1A 3OOJA 4LQ4A 3UA3A 3Q8LA 2Z8ZA 2CMFA 3I4FA 3R7WB 5BQ3A 2UXBB 3HKCA 1UH5A 4U7JA 5DI3B 4CLDA 5H8WA 4AJHA 2AJ8A 4DNFA 2O3QA 3CNLA 4NV0A 1GFSA 4MQ6A 5BXYA 2YHIB 2HKIA 3P9PA 3M8KA 4P22A 3WXMA 3ZYCA 1H8ED 2F7SA 4BBAA 1KS9A 2Z3ZA 1LSJA 2G28A 4YJ3B 3BL5A 3R0XA 5BSHA 5CCEA 1EFTA 1H2WA 3A7EA 2F64A 1DARA 3ZWKA 4QVGA 4LOJA 3G2QA 1EAYA 1A9PA 4WY5A 4UBKA 3RUCA 3HN6A 1R10A 2ZSBA 3EEBA 3QJYA 2GNPA 3I9V6 4WLEA 3T5PA 1Z63A 1TAUA 1VIMA 2AXQA 2AV6A 1XOIA 2A1UA 1CWUA 4QG3A 5AJYA 3LQ2A 2X58A 2WAOA 3OESA 1VA4A 3PFIA 1L3BA 4HLCA 2NXJA 1ZP6A 3RYIA 3E5MA 2AMFA 1JEYB 2HQBA 1X8LA 3OE1A 4I4TB 4ZVQA 4AXBA 2PLRA 4NLLA 4HWKA 5UKDA 1TVKB 4D74A 3KOUA 1JG3A 1F3LA 4CM7A 4AWBA 2VF7A 3JWIA 2YFQA 3NHYA 4RVSA 5HILA 3TZQA 2QYSA 2I6FA 5ALOA 1T0HB 6REQA 3J80A 4U2DA 3IP6A 3PX7A 1BAPA 1NY5A 3LGAA 1SQ6A 3TLMA 2ZIEA 4MK4A 4Y6OA 1U9IA 1XU4A 4K03A 3S8YA 1G2QA 2CDNA 1ZN2A 3E82A 4O2AA 3VH2A 2PSHA 1F9AA 2VSQA 3GVPA 4Q3CA 2O8FA 1U8YA 3U61B 1X8KA 1BE0A 4GI3A 3VO1A 5FLKA 3TZEA 3WADA 3C3WA 4FKBA 2NU8A 5EJ2A 3AHIA 1RLJA 3QYJA 4MQFB 4G0OA 2PTHA 5F1PA 4ZAGA 4A6EA 3UWDA 4AKEA 4B4VA 2PUHA 1JT9A 2WFMA 2EJUA 1Q20A 3MGKA 1NTOA 1T9BA 4CVNA 4F8YA 5JQGB 4JHXA 3P45A 4BX9A 5HR5A 1NMYA 4QXOA 5F2EA 5CYPA 5JMTA 4ZMRA 2CLHB 4PYKA 1JF8A 3OOHA 5EEGA 3VMMA 3EGVA 1FSZA 3K32A 2A88A 1E6MA 3QFRA 4FFPA 1OWLA 3U2QA 3BERA 1WSBA 3ZWBA 4O4IB 4BU0A 3BCRA 1ZH8A 2CFIA 2QTAA 2BMEA 4YX9A 4WOPA 3KYBA 4TS9A 1RFLA 2HF7A 1N7IA 2X6RA 1KDPA 1VG9B 2TS1A 3BRWA 3IB3A 3QX7A 4EY7A 2GAJA 1OJ7A 1ZUWA 2OUIA 1D2HA 1N0HA 1FJGB 1QCDA 1HM5A 1JA1A 2VN8A 3IA7A 1MXHA 4RFVA 1X1EA 1A77A 2GF0A 2CCJA 1QX3A 3LUJA 1CB0A 4QQNA 4RD3A 2P5TB 4W9RA 4MWGA 4LJRA 5JS1A 2V4MA 1TJ3A 2QTRA 1W5AA 3OC6A 4MLPA 4KI0A 4IG9A 3TZKA 5B1EA 2CNNA 4DJJA 2CL0X 4MIEA 2ZS9A 4F4UA 3ZJUA 1UPBA 4KVZA 6LDHA 5I4IA 1N32B 2P6UA 4GT1A 3D6JA 2M1XA 3Q10A 4MQ5A 4PNPA 1X2BA 1ZXBA 2DLNA 5AOAA 2G5GX 5EGNA 2CVPA 3B78A 4LOHA 4MWEA 1LU9A 1TK2A 2XGSA 1HLDA 3C70A 3W5IA 2PXAA 1ECPA 1ZVKA 1JLLB 3GJ7A 3NBYC 4PVDA 4ARUA 4MIOA 5KTRA 2HR1A 4P4NA 5JJKA 1VSTA 1EE9A 1H3FA 2PXXA 2JAHA 1VMKA 1ZC3A 3GI1A 3G85A 4FGKA 2DERA 1W35A 4GOMD 4WZAE 5D5QA 2I2XB 4BCCA 4YQFA 3C3YA 3AINA 2P8SA 2FMKA 2QUHA 2AG5A 4TUYA 2VTEA 1D04A 4XFDA 1ZZEA 3G7SA 5DJ5A 2BC9A 4HWRA 1AKTA 1BE6A 2INGX 4QYIB 2Y93A 4TL6A 4CDRA 3KQYA 5JHGB 3LQFA 2FPGB 4EJ0A 4BFYA 3B7PA 3FYUA 1AIPA 4LI0A 3GPBA 2UYQA 3ILXA 1SXQA 3U7FB 1RWXA 1XJWA 3ZU4A 3WMFA 5CDGA 1PFYA 1GZ6A 3E05A 4IH4A 5ARBA 1LFDB 1P1JA 2CGEA 4CQMB 4YCCA 5A3JA 5EJ7A 3L06A 3W2EA 5HZMA 2VNSA 4FFOA 1K89A 4I4NA 1NQUA 3IKJA 4PZDA 5IF9A 2NAPA 4YY3B 3PR3A 3AUUA 4X1KB 2YJNA 2IHUA 2X2OA 2WU3A 3QY0A 4MARA 1ZVMA 4MS1B 4Z5XA 3CHYA 2RK4A 5LZ2A 2OGUA 2VRBA 4GXTA 1KMNA 3REOA 1KYYA 1QYXA 2R6GA 5L4LA 3BA1A 1Q0PA 4KQEA 1M0WA 4RLFA 4XLZA 3ROQA 3U3MA 3V46A 4R98A 4A0SA 5ARDA 1U0NA 3ESQA 1PJTA 1KNQA 3B6KA 5TVKA 4KVAA 1ZD9A 4I50B 3WYBA 4BFUA 5DRTA 1GTMA 3WS7A 5G3ZA 2HQSA 2XDYA 3L7BA 1XMPA 1UXJA 1Q1NA 3F9IA 4AUEA 3BTOA 4QRHA 3RS3A 2FOLA 3LMKA 2G4VA 3HVUA 4G37A 3A6DA 4RMNA 3CX8A 1F2UA 1UR5A 1TGYA 4QDTA 2YFKA 3ITEA 4NVRA 4UE2A 3PQ4A 3AV3A 1XHEA 3OJLA 1MABA 4JJEA 4XUEA 3WIEA 3EPHA 1E2HA 2OBMA 3IVMA 3PIRA 4IUBS 4M0LA 4XWWA 2ZTUA 1NMXA 3FZEA 3PLAE 3R75A 4E1VA 2HU5A 2GH1A 4BUCA 3P26A 1PWHA 2VTVA 4RKRA 1F8XA 3NBFA 1YI0A 3EDOA 4PS0A 2VF8A 2RFLA 3QOXA 5FORA 4ALLA 4DRXA 4LWOA 2ASVA 3DP9A 4EQ6B 2A52A 3L6RA 2HJGA 4QFBA 5EXCA 3GP8A 1JMKC 4PRKA 1L4BA 4U7FA 4MB6A 1NURA 4IFIA 1D07A 4DIBA 1V5IA 3A3OA 2WKSA 1QYIA 3GRRA 2VG8A 2GA8A 3AU9A 1SCNE 4MRAA 3ZY6A 1NQWA 2P2CA 4FI3F 4F5ZA 5C51B 1S7GA 3MQFA 4DIEA 4EJSB 1X70A 2EKDA 3N7TA 4K05A 1W5BA 4D9MA 3LCRA 2ZUUA 4A0FA 1EA7A 1Y7HA 2IPNA 2IQ5A 3OLVA 1FFBA 2X0KA 3PICA 4LXYA 4RK1A 2XUGA 1XDBA 5HF8A 2A9JA 1DRWA 2AFHB 4BO8A 4BTEA 5CCDA 1OB2A 1V1RA 2K2QB 2BGIA 2WB4A 5ANRB 1TMOA 3FCYA 4ZJZA 4OYHA 4EPRA 4X8OA 3MOIA 1UT8A 1V8PA 4MRSA 3GNLA 5EG5A 2FMUA 2R11A 4D4HA 3QX9A 3V4PB 3IC5A 3GA7A 3RQIA 1NLYA 1WMSA 4YRRA 4UTNA 2C9YA 3EGEA 3USES 1N1EA 3KJHA 4EHHA 3K1TA 1J8DA 4KIFA 2D00A 2LCIA 2ST1A 4EUHA 2D6FA 3JYLA 1H66A 2CXTA 4JT8A 3MSCA 5J2TF 2I76A 1OTHA 5LQDA 4CQJA 1MAUA 2BFDA 2I8CA 5DTMA 5E4YA 1MX9A 4HLUA 4C89A 4GX2A 4ZO4A 2OAQ1 4RE6A 4IIJF 3QE2A 2RHWA 2AR7A 4AX4A 1YJQA 1YU9A 1P9RA 3DDZX 3VV3A 2DFNA 2JFZA 2W2PA 5CLHA 2AC7A 3F6PA 5JS6A 1E94E 2I71A 2X8LA 4JP1A 1O89A 4OHPA 4TTQA 4CHTA 4HVLA 1FNMA 3L9XA 2I2BA 4A8PA 2JLRA 3WOVA 2CYAA 4LJKA 1X1TA 2HF9A 4PLVA 4FKZA 1PZNA 4S24A 5IW8A 3FWHA 1HKHA 3OTWA 3DMHA 3DDCA 2F8SA 1X92A 4ID9A 5FAXA 1L5NA 2RGEA 1NPDA 2C31A 2Y1LA 1SUDA 3KUCA 4GICA 5A3VA 3KKKA 3B8HA 3DDSA 4BWGA 4Q00A 4DM4A 1YI1A 3GD7A 3T4PA 1U7TA 4YO8A 3I8OA 4GR4A 4Q7MB 2CCGA 2A9OA 3E7WA 3ST7A 2ZYSA 4K3VA 4KYVA 1NWCA 3QNUA 2WSSD 1JILA 1QHSA 2OYSA 3MJRA 5E1MA 2YXDA 3MB5A 3OZTA 9ABPA 3IP5A 4WE3A 1Z88A 3KR9A 4AZ3A 2Q99A 1CZHA 4QTUB 5LA6F 1FDIA 4YREA 1QG4A 2EGGA 3OZIA 2UZIR 2AQKA 2PD3A 3HLTA 1EAMA 1YIDA 4M49A 2H5LA 4TLBA 2J3JA 3WYEA 4NRDA 3B9QA 5ALNA 2JL1A 2G71A 3KSMA 2IPMA 4EJ6A 3GBVA 2CLFB 5HRAA 1EUDB 2EYUA 2AJDA 2FEAA 1X38A 2ISQA 4FBMA 4M9UA 1IUNA 3TX6A 3ETDA 3KTAA 4BP8A 1SXGA 3EY4A 2DCUA 1Y1LA 4BFVA 2WAMA 1MC8A 2WA1A 3GYGA 1Q7TA 1DIBA 5EIAA 5FPYA 3JZIA 2C3MA 2ZTSA 4CG2A 1PIWA 2GM5A 4L85A 3W5UA 4PY2A 2HA5A 2ZJ6A 5JHHB 3VV2A 1MEOA 4EI9A 3CM0A 1U1GA 4WCFA 5DBEX 4DWWA 5A4JA 3I34X 3BGSA 1HNNA 1PR2A 3L2OB 1SUBA 3QW2A 5AW8A 3AF2A 4ZZ0A 1FX0A 2R5NA 1W96A 3OQIA 4YACA 4A82A 4F9GA 4ZHSA 3BBPA 1FW6A 3A27A 4L8LA 1RRKA 4D02A 1SBNE 2IEIA 4UBNA 4LNUB 3W6ZA 5DM4A 2P9GA 1K97A 1U1DA 3FMPB 4XD7D 2C8JA 3BM5A 4E15A 2FB9A 2C99A 3IUYA 2BM9A 4QHYA 2GO1A 1I4WA 5KEIA 3ZVNA 5AR1A 4PAQA 4BPBA 4LY0A 1RRGA 1YL6A 3WWZA 2XTMA 2CWWA 3BD7A 1CUFA 1E79A 2XT6A 3OC0A 4EHDA 3UJ7A 3VNSA 4IX9A 1FDOA 1DC8A 1NOJA 4OJTA 1PX0A 2OHHA 1ZOSA 4AY3A 4NXMB 3KQSA 2FUKA 3OE5A 4TL9A 5HJ7A 2IP1A 1NI4A 4LOAA 2CK3A 5D1HA 2PL5A 1U6KA 1J1IA 3M1AA 2PUDA 5G0TA 1POWA 3BWVA 2KHZA 5A5VA 1M2FA 3H5VA 3LCJA 4EPYA 1FUEA 2WAYA 1TXGA 4HX2A 2VLIA 1J9ZA 3PGKA 2Y1WA 4Z3KA 1U8EA 5BRNA 4BMSA 4KDEA 2GT1A 2NTNA 3CURA 4R1LA 5AW3A 3ETCA 4A3SA 2HRRA 4PX2A 1NFQA 3A1FA 1N36B 2H1VA 3Q5EA 1PJBA 1NUAA 4IDEA 3ZWQA 2WUVA 3IA2A 2DOKA 2JLYA 4S1VA 1M2VB 1T8WA 1IXYA 3P97A 1UC5B 3PRJA 1H6CA 3ADBA 2W71A 3PT5A 4ITRC 2W2QA 2OGSA 3AOEC 1XB2A 4I0WB 3OG9A 4P7FA 3NOXA 1DWUA 2FFHA 5AVUA 1HRDA 4IJQA 2BLNA 1COZA 1V8DA 2EGUA 2QD5A 1NFFA 3AJAA 1VL6A 5KTTA 2I66A 3LWDA 1I0LA 3AMVA 4FD3A 1E61A 1T2VA 5CDTA 2GM3A 4OLHA 2JFNA 3EVEA 4UQPA 5AUPB 1ZOOA 3BMQA 3QW4B 5NULA 5ITVA 3NDJA 3UMFA 1PV1A 2X7HA 1YZQA 3I6MA 4LKOA 4W7IA 5FPPA 4A0RA 5JMPA 5IT9A 4XDHA 1XDWA 1Q17A 3SKYA 4CL3A 2WHPB 2GD2A 3DO5A 5KVAA 3L0DA 3C3AA 5DE3A 4ARCA 2DC1A 1UZMA 4OHUA 1ZC4A 3JWGA 4S05A 5D6OA 4L72A 3FDXA 2FE4A 3E1GA 1GVNB 5CW2A 4EFNA 1MU0A 3R5TA 4FN5A 3BSFA 1OA0A 3S5UA 3S29A 3SS7X 4QO7A 2NSJA 4B34A 4G4SO 2F9LA 3VU0A 4A6PA 3L7CA 5BWMA 3NVDA 4MYTA 3H97A 4RJKA 1W59A 2WSBA 3GLGE 1M10A 2H5IA 2OM6A 3B3GA 3FPKA 1LLUA 2WOJA 2PDAA 5ALXA 3U0BA 2OB2A 5JJBA 4UHCA 5F7XA 3SQDA 1MC1A 4JYBA 3OT4A 2WJHA 4Z86A 3ZS9A 1N1GA 2PJRA 3FCXA 3SJBA 1B0ZA 4LISA 2R86A 5FBHA 3WZLA 2AXPA 3CRW1 3WG9A 5BNIA 1KMQA 1WF3A 1FLVA 5CK5A 4EKIA 1V6SA 3FSRA 1Y1KE 2GJSA 1ULSA 1AK9A 2P1RA 2Z1MA 3HRKA 3I1FA 3L1KA 5KI6A 3I9FA 2QA5A 3O9VA 2FRDC 3AM3A 2H1LA 4KAAA 3T7DA 1NSYA 3AY6A 3N39C 2H9IA 4QPPA 1QUFA 3W5VA 4E5VA 4CXMA 3MJDA 2DH5A 5G0WA 1B1CA 4AMYA 4C76A 1QCCA 2R4QA 4RFSB 4IJ5A 4PO9A 1H4QA 4H0NA 5DX0A 3A2LA 4YJ2F 1C0PA 1KZHA 2A94A 2P9ZA 3G5AA 2AOTB 4UTOA 2G8LA 3AI7A 2GWHA 1ZI9A 1X86B 1N2GA 2FCAA 3QEAZ 1ULUA 1WPXA 2C94A 2JHGA 1SBQA 1ZG3A 3IUJA 4PYLA 3T5MA 3FUVA 1KI3A 3RC8A 3R4VA 1LDGA 1RJFA 2B92A 2QVZX 3ANTA 2C4KA 3EB9A 2I99A 3MHPA 4H59A 1XCLA 4LAFA 4HX9A 5IDXA 2IPXA 2PSFA 3FDIA 2K87A 2I6XA 5SZHB 5J2UF 2KJQA 3Q9NA 4JT4A 3LT1A 1MT0A 1SCJA 2PUVA 3F67A 2OCIA 1GPKA 2WR8A 4Q4HA 2H1HA 4TKVB 4GZ5A 3ZI0A 1KBQA 2G2SA 1KJJA 3I6BA 4L2IB 3FNGA 4C6TB 4BKUA 1I2AA 4X64B 3GLFE 1O8CA 1Y1RA 4E2WA 1BXRB 2EF0A 4CKCA 1CULC 4NCXA 4BNMA 4P4GA 3OHMA 2J09A 2H8KA 3AUAA 2WD7B 4TT8A 1BX0A 3V3TA 2VJMB 2FMXA 2JFPA 4BZQA 1GGVA 1E4OA 4HOYA 4KPGA 4TTIA 2ISSD 1DG9A 1KP2A 2XUFA 3VC3A 1LRLA 2E4XA 3L0PA 2QSZA 1H6DA 3ESAA 3OPXA 3FJOA 4Q4AB 4EX7A 3LFHA 2WSYB 1TUBA 4BAGA 1GPMA 3HP7A 4E14A 4MGHA 4RDXA 1GOTA 4IM7A 2PX8A 1FFSA 2C2ZA 1VJCA 3QSYA 2XNDA 2NUAA 3T9FA 4ECAA 1KMHB 3QWBA 3IKVA 3IEKA 1KY5A 3Q6MA 3EZYA 3L92A 5EZSA 2P5UA 1YA6A 1RHRA 6NULA 3GPIA 4UDNA 2OE2A 4BZPA 1N2CA 5A02A 4E6EA 3TQSA 1U2PA 2Y66A 4HEHA 4J0JA 4U2FA 4IW3B 4ZVVA 2A53A 1GDHA 5AI6A 4BO4A 3QU4A 5TXGA 4XLTA 4DCMA 4E12A 3JQGA 3K73O 3OEED 3DV0B 3OH8A 1PNTA 2GZ3A 2Z3WA 1GKLA 5P8WA 2PTGA 4JFRA 1J0DA 4BY9E 1K4MA 3QWHA 1A9SA 3P9XA 1C9YA 5FV4A 2ZSAA 1KP9A 2BKUA 1Q0LA 4G1MB 1PVOA 2BGWA 2BTOA 1O6CA 3DCNA 3KB1A 4RLSA 1N2HA 4EA8A 3OX3A 1GSOA 2Z2XA 2VKQA 4KGXA 5C0OE 3PVZA 4F85A 3C6ZA 3RVJA 1QZ3A 3PCTA 4INZA 4C78A 2QSYA 1XDGA 1S8NA 3GH3A 3M6UA 4O4JA 4Q9NA 3S27A 5ABPA 5F21A 2RKOA 3ASUA 2G6TA 4A8TA 2HM7A 5JDCC 4PFQA 4PFJA 3PQEA 3FYDA 5FD8A 4PEVA 1NZJA 1QOQB 2EKLA 3HI4A 3A06A 1V5WA 4WNAB 3I5YA 4H3SA 5BT8A 5GONB 3KLMX 3RFXA 1M2HA 5DM70 2Z4TA 3MEQA 4KEAA 2Q3LA 2JEYA 4UHHA 2I1LA 1XHLA 2ZTVA 3ESZA 1G5PA 4GOXA 4RCVA 1T2NA 2ZJYA 3GRVA 1L1FA 4TTRA 1ZKMA 4ZAZA 3WBFA 1VJRA 4J6EA 2AKEA 3RVBA 4B3DA 3T95A 1NUQA 2PWZA 5FI1B 4B46A 4BX0A 4HAUA 2B4RO 2QAGC 3CUSA 5L3QA 4OP1A 2QSUA 4Z6KA 2C2KA 4DRYA 5FNZA 3BMOB 1TO1E 1U7XA 4B3CA 1CDDA 2XUHA 1KH1A 3K9WA 1UZLA 3GC6A 2Y1KA 3HYRA 3UOGA 4ZJYA 8MHTA 2O19A 2AUTA 3N70A 5FBLB 1F6DA 2EIHA 1DTWA 4AW9A 4IGEA 5A0VA 1FRQA 3KKQA 1X7XA 2VA9A 3ZGOA 1HT2E 2VRWA 3R5XA 4DCUA 2GN2A 1E6LA 4QNMA 1HNXB 2QP9X 1HO3A 2OAEA 2HFKA 4WFJA 2PRZA 1Q19A 3WQBA 3M34A 2ZJ8A 1GCOA 1IHYA 2VHXA 1JA0A 2G3YA 4RIEA 4WPGA 5FOUA 5AUOB 4UW9A 4DHWA 5EIXA 3BHIA 1THZA 1K9SA 1K5PA 3T7JA 4YAGA 1XZ8A 4BVLA 4J7UA 2ONKA 2O8CB 4Y2JA 3PV0A 2G83A 3T8YA 4C0AC 5CT6A 4RHEA 1NBWB 5L3ZA 2IZ5A 3NT5A 3V6MA 3H2IA 3FKQA 3ELWA 1SVIA 4NTZA 2MSDB 3LNTA 1EFVA 3JPYA 4L4XA 4N1AA 3KZ1E 2TYSB 4BFWA 2FGKA 2Q0XA 3SXJA 1FYVA 2AX4A 2KWIA 3DKPA 1ZGCA 2ZTHA 4HB0A 3COVA 3EBPA 4Y2TA 4GPZA 2PMBA 4CE6A 3DAHA 2I6UA 3LLUA 4KCGA 3CH6A 5CJJA 3AH8A 1GTZA 1J7JA 1I30A 3IURA 2JZNA 1E1KA 1E0SA 1MG5A 3D3NA 5LCXA 3C7KA 2OECA 3IHKA 2WC1A 3QMMA 3M6XA 2GTIA 2OZEA 5H3CA 2ODAA 3ZJTA 4MCAA 3LPMA 1WU8A 1GA1A 4KRGA 4E7OA 1E7SA 2RARA 1M1YB 4NNJA 5IN4A 3F78A 4TXJA 1VIYA 5BN5A 3CXRA 3EVCA 1NXVA 4H7JA 4KBFA 4MNTA 5ES3A 1A98A 2PLAA 3AC0A 3WTCA 2Z6AA 3KWFA 5I7WA 2NUBA 4TT3A 3LQYA 4X0EA 5EJMA 4EPXA 3W5DA 1ZUD1 4XDZA 1T9HA 2YUIA 1NP6A 3DOIA 1TO2E 3IE0A 4EBFA 1GRCA 1M75A 2IYQA 1CTQA 2SKCA 3I2YX 2N9UA 2C8KA 2AOVA 3MFQA 3KT3A 3QNWA 4TSKA 4UU1A 5MN5A 5A0TA 2JNWA 4IIFA 4P5EA 4ZVMA 1K3UB 2EFJA 5LQAA 4P3PA 3WP0A 4DSZA 2ZB2A 3FSEA 3GLIB 1MDFA 1P7CA 3H04A 1ECCA 4RA6A 3ZZ1A 4BKPA 1OH6A 1DCKA 1D6JA 3UANA 1CRPA 1DPGA 3T7SA 1Q1EA 1ZS9A 4RMHA 1O5TA 2R8YA 2F1OA 4RPHA 4UM5A 3IHLA 2LE0A 1E6EA 2HK9A 4MPRA 3SI7A 3OO1A 2WVGA 2IH2A 3IPLA 1LTKA 1QQAA 4IIVA 2R4TA 4RTSA 2EARA 3MNFA 4CLRB 2G8NA 3B82A 5BW0B 1YB2A 1XEFA 2Z1NA 2ZATA 2CXNA 2O1XA 5DEOA 1SZPA 1T2FA 1VIVA 3E48A 2QTTA 4L28A 4Z8XA 2YWBA 5K1ZA 2HZBA 2OFOA 3FPGA 4HDNB 1KEUA 1EM8A 2BSXA 3GDFA 1GXSB 3LTEA 4M9XA 4R01A 4PYJA 2CV0A 4TV9A 5HQJA 3UT5A 3K35A 4QULA 3H2ZA 3R0QA 5CA1B 4GC5A 1H42A 1VCHA 3FPJA 1IEQA 2ANBA 2NVOA 3FOCA 3WGHA 1US8A 2WUFA 3KJQA 1BJKA 1NXWA 4POOA 4ESOA 4LXTA 5AFSA 4GMGA 2NP7A 5EESA 3UHPA 4Z4FA 1BCRB 1RLIA 2YQ5A 2H57A 2PH7A 2YNMD 4I4IA 1PK8A 4MX8A 3GEBA 4WDQA 3U7IA 4BO6A 5CA0F 4LW8A 1MAAA 1TPZA 1NC1A 4ML3A 2JATA 1VCMA 3GDWA 2WPDD 4RKWA 4IQ4A 1UC9A 1X7WA 2X8BA 1OYOA 3H1EA 5KOYA 2NNWB 3IV6A 1G20E 4JL5A 5FI5A 1L5VA 5TVGA 3TTVA 4L4YA 2VT7A 5JXJA 1JG4A 1TCCA 5CM2Z 5T4BA 1FDRA 4OK5A 2IY7A 1BC5A 5BV7A 1A5TA 1RC0A 1NLFA 1FFHA 1UK9A 2VJDA 1RYNA 1QR6A 2OB1A 2PQ2A 3HHPA 3LFUA 2C29D 3P2OA 4OGKA 2I3DA 4R4JA 4Q4LA 2BRUA 1E6WA 3DXYA 4ZVKA 3RU9A 3AEUA 3NIGB 4BVAA 4AO6A 3UYKA 1OX5A 1TQ6A 1NJGA 1VLMA 2JJ1D 3BHJA 3KLBA 2PUBA 3I1YA 2L17A 5ALDA 2MMCA 3X1WA 4CM3A 4W5QA 2F1HA 4JL6A 4BE7B 1KGSA 1A96A 1NRXA 4LJ8A 4DYHA 2ZCVA 5AYVA 1HG1A 1VRVA 3V5NA 1OH8A 3U31A 1JHRA 2FR8C 3SX4A 1DJNA 3BXXA 5BVHA 5GWXA 2I9KA 4JWKA 2OMEA 1CIVA 1I3NA 2ZWAA 3DEIA 4Z51A 5KDOA 1RRPA 3AJ8A 2DPHA 3RC3A 4Y67A 4FZVA 2M32A 1SCBA 2GCOA 1ZH2A 2W2KA 1UK8A 4MYRA 3UKOA 1BN7A 2BY4A 2J4FA 1LBTA 2JFVA 1ZN9A 4CLXA 4QM7A 4CIDA 3EY9A 3ORYA 4MVJE 2PGOA 2ZIVB 1KJ9A 3GLFA 1ZEMA 1V7ZA 1KDVA 1RKVA 5K3FB 4JWTA 4EZEA 5I8WA 5LQCA 3WQHA 3AVYA 2R6R1 1BRTA 5GOTA 5SZJA 1I5RA 4DQ0A 4I9HA 2R97A 2FNAA 1FDVA 2QLTA 3H5NA 2ZBUA 4I7EA 2R8BA 5IS2A 3QEOA 3WL8A 3CLTD 5AHWA 4BMZA 2QRUA 4UCFA 2Z1DA 1Y82A 3GJZA 3RC7A 4E32A 5KTNA 5K8VA 3MYRA 1Z73A 5DN6A 5AXCA 4YRLA 3ENVA 1XZEA 3OAAA 2BYTA 5HQ3A 1XP8A 2A5FA 4YAOA 2YQZA 5FTLA 3RUDA 4Y6SA 3QKSA 1CX9B 3SZUA 4B4WA 3KQMA 4YJHA 5KTOA 1FYDA 1KXJA 4QICA 4ZQEA 3RC9A 3URMA 5K8IA 3UCEA 2HPVA 1PD1A 2IODA 1Q2XA 1V8BA 1VG8A 2HCJB 4UKDA 4CN9A 2FSHA 1L7MA 2XI4A 5JH7F 4ZTUB 3DL7A 2V54A 1LTQA 1V7PC 5DU2A 4GM1A 1Z3CA 4L5BA 1DC6A 1CJCA 3WHKA 2ZJ3A 3D7LA 3JQAB 3BQNB 5HIIA 2D54A 1ZD1A 3R44A 3WZ2A 5IF3A 3M5DA 1UJCA 2PZMA 1PAUA 2GN4A 4KXXA 4TOIA 5JXHA 2XQGA 2IE0A 3EG9A 3UHFA 3KDPA 2HSWA 3H5RA 1ZM4A 5BWCA 4DVGA 3PGLA 4YHBA 5GQSA 2DSNA 5KSZA 2C9OA 1IOVA 1FF9A 1XJ0A 1JKXA 2Q5QA 4OAQA 3SZGA 3RSOA 2J9GA 2X5XA 1I94B 4DG5A 2AUMA 1UP6A 1NXQA 3IKLA 4WDRA 1CXZA 2Z30A 5KVVA 1KAMA 3THYA 3GW8A 1E32A 4INAA 5IDVA 4F2GA 4AS1A 4EPTA 3ZEAA 3DPIA 3H86A 2H2IA 3FOBA 4DV0B 3HCPA 3QU5A 1Z56C 3D6TB 2HJWA 2B3DA 2ZBGA 3DFKA 3DKVA 4FMPA 5DHTA 5FBWB 3SKXA 4ZHQA 3HVRA 3L40A 4W8HA 4FS3A 2Q3HA 5H82A 4Q7QA 4ZDKA 4C0JA 2WQ6A 3CIOA 2MSCB 4R2LA 2NO4A 5G2FA 2SECE 5AI8A 4RGBA 3ZU3A 3AVTA 3L8ZA 3VNUA 2CLMB 4R54A 5BSGA 5EL0A 1GQ2A 3IEXA 1MA0A 1KBZA 1Q1BA 4RPJA 1GG2A 1TTPB 3DYVA 1PR3A 3FPSA 3L9WA 1YVEI 3MF4A 5JSKA 2WIGA 3M6AA 1NN5A 4AL4A 3NUZA 2RG7A 5ALZA 5L4SA 4WINA 3HV0A 3KJGA 3MTBA 1XRMA 4OBEA 4JK3A 1TKAA 3OT1B 1OGJA 3HGTA 5JCXA 4WOCA 1L7XA 3RV4A 3FF1A 4ZKDA 3I4LA 5LQKA 3UKDA 3WI7A 3PEEA 1TECE 5CLFA 1V3UA 1N1MA 4MW7A 4H4EA 1Y8QB 2HLHA 5BOVA 3KLPX 2OV6A 4D96A 1KHHA 1XZDA 3HNRA 2RHOA 2FR8A 2Q1UA 2LIVA 3I2HA 4L50A 4BV9A 4UZEA 4JKIA 2BELA 3DBIA 1DE0A 4HMOA 1RYZA 2R7NA 3KEFA 5IUNC 2GF9A 4GDFA 1ZUNA 2IY8A 1D1SA 1Z7WA 5H3LA 1UDAA 4YMUA 4X62B 3GRFA 3O26A 5E1OA 2Z6UA 4GUDA 3HBNA 4KVGA 3JASB 4P7KA 2R00C 4NMXB 2J87A 3Q7IA 2K7FA 1Y7TA 2IXBA 3G23A 5EXDA 1DDGA 4ZVLA 3T38A 1U1FA 1ZU4A 3EF0A 3TD9A 5BURA 4BOYA 5B55A 5DCYA 1I1OA 2EBWA 3TEJA 4EK9A 2AN5A 1QLHA 2GPAA 3P7MA 4I4LA 5K0ZA 2O3UA 1OTYA 1FW8A 1Q0HA 4WN3A 1ZSVA 1V37A 3CUTA 3SK0A 1TU3A 3MIIA 3BGOS 3EXEA 1T3LA 5U4QA 1HT3A 1ZWLA 2A0KA 4KDFA 3E2PA 4FMCF 3UB2A 1QU2A 3JATA 3N0TA 1GPDG 3COJA 3A6ZA 5G3YA 1UPTA 3TSYA 1U28C 1M2JA 1K75A 2XYGA 1OAKA 4R3WA 3PD7A 4X7RA 1NJ1A 2B36A 1CZLA 1RP1A 4OP3A 3R20A 2PS3A 5KJCA 1WPRA 2EW8A 4NMLA 3D5EA 1FNNA 1T8TA 1OFTA 1HMPA 2G5TA 3DO6A 3UAYA 1PZHA 4TZ6A 1EFPB 1TYZA 4A2PA 1C4WA 3FPFA 2WFLA 4QSHA 3OSZA 3SIRA 1KYVA 1Y6RA 5C1PA 3C0KA 3OIUA 5HF5A 1OC4A 4BO9A 5K01A 1KVTA 4W7HA 5DTQA 2BSAA 1RCFA 2TMDA 3FW1A 2YICA 3OZ7A 3ICEA 4GE0A 3ZCRA 3V1MA 4YXWA 4MR8A 5AUNB 5I7VA 2BZGA 3KOYA 4UDXX 1T3SA 2I91A 1LBSA 4R0MA 2XQKA 1U2RA 1BHSA 1I14A 4C43A 4MR9A 5DDIP 5ED0A 5LNK6 2VHYA 2J31A 2IELA 3FUUA 5EZYF 5EKTA 3TIVA 2RGWA 5ALPA 3ZGNA 1V1JA 3E9ZA 3KHTA 5G0UA 3EHEA 2WF6A 4LMAA 1WW3A 2BF4A 3UTDA 5KYXB 3RK0A 1KHTA 1KI9A 3UA0A 2Y4NA 1JFSA 3ONVA 1N2BA 1U0FA 2XDQB 2IOYA 3OPYA 4CTJA 4B3JA 2YR0A 2CXHA 1QHNA 5JXIA 1SUCA 2OHXA 1GDTA 2A0UA 2PRKA 1W9HA 3B53X 2PX5A 4IIBA 1UBGA 2Q3FA 5JBQA 1ZMOA 2HDHA 3HFGA 2DAPA 5F7ZA 1YKGA 3TLGB 3ZWPA 2IYXA 1K1EA 4JZKA 2EYQA 2J7PA 1DQRA 1MAWA 3B70A 1NF3A 3ZDQA 4BBZA 3IE1A 1XRSB 3BOSA 3EH1A 3FWYA 1QWSA 2AUNA 5EHQA 2DQ4A 2VF5X 4JD5A 3GCDA 4N6NA 1YUBA 4JEMA 2VK8A 1CY6A 1Q22A 1OH7A 2W6OA 3PGMA 4LXUA 2R1VA 2RHCA 2Z5LA 2ZRHA 3N07A 4H9GA 1DIAA 3H9QA 3A7DA 4MMXB 4RORA 5FUXA 3LRTA 1DINA 3HKCB 4BZXA 2XXAB 2XZLA 3V4ZA 1ECBA 1Y6ZA 3ICWA 4OGGA 3T41A 2R7MA 4H7FA 4KQ6A 4Y3UA 5K51A 1C8BA 3IX7A 1EUZA 1SPXA 2XJ4A 4WFKA 4MUMA 2VBGA 3H2KA 4DR4B 4JBWA 2Q4RA 3IQEA 3PDHA 3EG5A 4L9AA 3H7AA 3VBCA 2KLHA 3N58A 4B3BA 1S0UA 1PLLA 4RK0A 2GRJA 4RXMA 5I5EA 3D59A 2V6JA 3U44A 3CRNA 1D7OA 5PNTA 1XTBA 2B7CA 4D43A 5CM8B 3NNSA 2W4QA 1FFWA 4BJ5A 3ZJ5A 4IDHA 3O47A 4OQFA 3FGZA 2A1UB 1XPOA 3JD2A 4QJ3A 1K66A 1XAIA 4ODIA 4DLVA 4QOJA 3RYIB 1OYYA 4Z4GA 4ENSA 4MQLA 1Q15A 3AUJB 3N2YA 4XB1A 2O9JA 2YVKA 4IHQA 4URFA 3S2EA 3ZEIA 4AJIA 4C5BA 4GWGA 4Y6GB 1R0YA 3QFCA 2SNIE 3F4KA 1XMVA 3A9CA 2ZE8A 2EGHA 4UM9D 4B4UA 3R8CA 4GVXA 4JBNA 1C2YA 1QGAA 2X77A 1NBMA 3AONB 4IKPA 4C0BA 1ZI6A 4EO4A 1B2LA 3EZNA 1N8NA 4RENA 3HO1A 1O5IA 3ZDAA 2YV4A 3ND7A 3FOFC 5I51A 2IYRA 2Q27A 4L4UA 4Y2QA 4H08A 4IRUB 1DKLA 3TBHA 4O2AB 3AI1A 3NC1C 2JHPA 2JIQA 3QKRA 5AVSA 2O8FB 3FKSD 5L6LB 3N2ZB 5FBRB 5BUSA 3LWBA 5FI3A 3LCUA 1PD0A 2BT4A 5TDHA 2NU8B 1CR4A 3VR6A 2PZFA 4Y7DA 1ZIXA 2IH4A 1HV8A 1RT9A 1S02A 1U3CA 1XNGA 1Z5WA 2J9RA 2UUOA 3EXIB 3F6EX 4MINA 3ILHA 1XZNA 1OV6A 2NG1A 4JBGA 1STOA 2H4YA 3PXUA 1JDPA 2PGDA 1XI2A 1NONA 3CE9A 3DHWC 1Z2DA 3PQ5A 5G4LA 3TOCA 4LYHA 1EK2A 2ES4A 4C05A 1R64A 3R6GA 1I51A 5TARA 3GO4A 2Q8QA 4B6OA 4I9UA 2EATA 3IHTA 1Q6YA 2VCEA 4S1WA 3ZV6A 1JQ3A 1DJMA 1N4AA 4J3NA 2V4ZA 5TGZA 5F5XA 1UBHS 5HBGA 4PINA 4I55F 2XMRA 3X1YA 1SEVA 2GEDA 1PK7A 4IKOA 3BICA 3GFPA 1UDBA 5IM5A 3HS3A 3GUCA 1MOZA 4IJVA 2LUOA 4ROSA 1T2EA 5E6SA 1NVAA 4LTDA 1M2EA 4IZOA 1IRIA 2FW6A 1UKAA 2HTEA 4INPA 4Q03A 4QSMA 3IVRA 1QMPA 2WFZA 4B3RB 3NTQA 4KRYA 1E79D 4BMYA 5AVKA 1JIQA 2WW8A 1FP7A 3JWPA 1KETA 1QSGA 1QZZA 5LDDC 2VWQA 1QGZA 5I5GA 3D4OA 4BXOA 3QPCA 2DJ5A 1P4SA 2CK3D 3UENA 4BLUA 1NT4A 1EX6A 2BFFA 2OV3A 5BQ5A 1E62A 4HRVA 4I3GA 4ER0A 3VJRA 4W8GA 2QM0A 5K6RA 3WV5A 2H2GA 4IUCS 1EDEA 4O4HB 5FPHA 5FV7A 4Y1RA 2WILA 4MI3A 3BSSA 4M1MA 2WU1A 2FXIA 3ZW7A 3M4JA 2UKDA 4LWPA 5JZSA 1FVOA 2HSEA 4P5PA 1Q21A 4GBGA 4R84A 3ZR4B 4IL5A 1WXEA 2P90A 4G97A 4M6WB 5LBIA 3CX4A 3DXFA 4MZDA 2BUBA 3ZGYA 1LNZA 3PC8A 2CMDA 4IHKA 4NU8X 5I4KA 4M89A 3FTEA 1QKIA 3FYUB 2D5AA 4MWBA 4K81B 2CMKA 3KPWA 4QLAA 4ZJPA 3B6JA 3UV3A 1L5ZA 1JLRA 3HXMA 2QE6A 1FMFA 1WABA 1KZ7B 4NS4A 2H1RA 5GINE 3R76A 2PD6A 5BWOA 1T5LA 2HBRA 2NT4A 3CUVA 5JZMA 5FTNA 1EEHA 1X1DA 1Q3HA 3Q87B 4OHBA 4IILA 4IDGA 1C7RA 1UUFA 3AY3A 3QLUC 4GOLD 4JEIA 1W0JA 1DZ3A 2N47A 2VZ8A 3M4NA 3OOEA 5IDYA 1JYSA 3IBFA 1XVVA 3WK6A 4MDHA 1GPUA 1I7PA 2UVPA 3VGJA 2BV3A 1FFXB 2OCLA 1BMTA 1RCUA 2XB9A 4UATA 1C9MA 3Q6IA 1UJ4A 3ASYA 5LWQA 3AF6A 1B23P 2VYNA 4M1OA 4Q9LA 1T8RA 1YUMA 3EDMA 4JT2A 4KR9A 1ULHA 2Y3IA 3ZZNA 1MCZA 2HBYA 2FETA 1FNBA 1F2UB 2VBFA 2GVNA 4G1FA 1NQ5A 1N3BA 3ZCQA 3TOXA 4CMHA 3ABSB 1KO7A 4DLYA 2BIFA 1ZBQA 2ZAYA 2HA3A 4Q47A 1N9GA 3W4KA 16PKA 1KVUA 1MABB 3EULA 4NHEA 4RF5A 3UC5A 3THSA 621PA 5F52A 5SYNA 3KQTA 1A4IA 1N6OA 1Z2AA 1N78A 1KYQA 3UHOA 2ODTX 5FF9A 4RHYA 5KYVA 4H35A 4DRXB 3JQ6A 3S2FA 1JQEA 3DVRX 2JCBA 3I58A 4KXFB 5AOVA 3NQ41 3AIIA 4QZVA 3DWGA 4UXIA 1A04A 2B98A 3ONWA 4HMPA 1DKRA 4X8MA 4GSYA 2ZIWB 4DA0A 3A4MA 3HWRA 1I36A 1KKMA 4TYQA 4IF6A 4TTPA 1T3ZA 2IVZA 3R5KA 1JSLA 3ASZA 4N8EA 4WZAA 3AEYA 1PKEA 3PQ3A 4KQFA 4OU5A 1USUA 3D2LA 4F6LA 2XB2A 1M0TA 1AKUA 2PN1A 2YJGA 5AW0A 4OKIA 1Q2UA 4AWXA 1BOFA 3ROFA 1D2CA 1S9DA 5JWHA 4CKEA 5GJBA 3KCNA 3SIPA 3D7NA 1HC7A