4DIPA

Crystal structure of human peptidyl-prolyl cis-trans isomerase fkbp14
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
MGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human Peptidyl-prolyl cis-trans isomerase FKBP14
rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP14
total genus 27
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dipA00
1NSGA 1Q6HA 3KAFA 3ODKA 2RURA 3O5QA 2XPBA 5HW7A 4ODKA 1A7XA 4W9OA 3LUOA 1P5QA 3NI6A 2MPHA 4LAYA 1EYMA 2VN1A 4J4OA 3OOBA 3UQAA 4IPXA 3UQBA 3EY6A 3PRBA 4NNRA 5HW6A 1FKFA 4IQCA 4W9QA 1PINA 4IQ2A 4QT3A 2RUCA 1L1PA 5HW8A 2ZR5A 3O5RA 1JNSA 2PPNA 4TW8A 4U84A 3KACA 3UF8A 1J4RA 1KT0A 2K8IA 2MLZA 3MDYB 5GPGA 5J6EA 4TNSA 2LGOA 2D9FA 3B7XA 3NRKA 4TW6A 5I98A 4DRPA 2AWGA 3PRDA 3KAHA 3JXVA 2RUQA 5D75A 5HWBA 2F21A 4DRIA 4ODLA 4DRQA 5HKGA 1T11A 4ODPA 4FN2A 4JFKA 5BXJA 1Y0OA 2FKEA 1FKGA 1ROTA 4DZ2A 1PBKA 2KI3A 3UQIA 2ITKA 3CGMA 3TCZA 1ROUA 1FKRA 4LAVA 2LPVA 1FKDA 4ODRA 1D7JA 3O5JA 4R0XA 5DIUA 4ODOA 2XP5A 5HWCA 2XP8A 4G2PA 1KT1A 1FKIA 2M1IA 4LAXA 3O5KA 4ODMA 4TYOA 4U85A 2DG3A 4DIPA 1FKSA 3UI6A 3O5DA 4G50A 4JYSA 3KAGA 3IK8A 2ZQSA 3KAIA 5DIVA 4DZ3A 1BL4A 1C9HA 3RFWA 1F8AB 4QT2A 4GIVA 1FKHA 3IHZA 3PA7A 2PV3A 3FAPA 2KE0A 3WH0A 2MLXA 3GPKA 4DRNA 1EQ3A 2XPAA 4J4NA 1FKTA 2FAPA 1B6CA 2PPOA 3KADA 3KZ7A 1NMWA 2PV1A 2MF9A 4C02B 2F4EA 3IKGA 3CGNA 3KABA 5B8IC 1FKKA 2MNTA 1ZCNA 4DH0A 1JVWA 1TCOC 3O5OA 1QPLA 4DT4A 4N19A 2ZR6A 1Q1CA 4JFLA 1YATA 2IF4A 2KGJA 2PBCA 2JZVA 3UI5A 1NMVA 2F2DA 2XP6A 2VCDA 2L2SA 5HT1A 3IKDA 4JFJA 5DITA 3UI4A 2RQSA 3JYMA 2M08A 3NTPA 4ODNA 4TX0A 4BF8A 4DRKA 3O5FA 4W9PA 2OFNA 3O5PA 3RGCA 1U79A 2XP4A 5HTGA 4ODQA 4LAWA 1M5YA 2ZQVA 4DRMA 1BKFA 1R9HA 4O2TA 1FKJA 2ZQTA 2RSEA 4TW7A 2MLYA 1JNTA 3JYJA 1J4HA 1FKBA 3O5GA 2DG9A 2ZQUA 4DROA 4U86A 2XP9A 3KCEA 1FJDA 1W26A 5HUAA 1Q6UA 1QZ2A 2ZR4A 4QIBA 2XP7A 4MSPA 1D7IA 3TDBA 1FAPA 1J4IA 4JFIA 2KFWA 2N87A 2Y78A 3H9RB 2PV2A 2KR7A 4FAPA 3O5IA 2M2AA 2DG4A 4DRHA 3I6CA 2LJ4A 3O5LA 2LKNA 1Q6IA 4GGQA 1D6OA 4JFMA 2KO7A 4ITZA 1ZK6A 2UZ5A 4MGVA 1J6YA 2Q5AA 1YW5A 1D7HA 2XP3A 1N1AA 1FKLA 1QPFA 3VAWA 1FD9A 3TC5A 4DRJA 2PPPA 1HXVA 3O5EA 2RUDA 3O5MA 1F40A
chains in the Genus database with same CATH superfamily
1WB0A 4QZVB 3B9DA 1GUVA 2O92A 3RM8A 5HW8A 3O5RA 1LG1A 1GPFA 3ALGA 3GU0A 2ETNA 5GPGA 1SR0A 4TNSA 1WAWA 2D9FA 1LQ0A 4ML4A 2AWGA 3PRDA 3KAHA 1LG2A 3JXVA 3CHCA 4DRIA 3CH9A 1H0GA 4ODPA 1Y0OA 1ROTA 4DZ2A 1PBKA 3ARYA 1ROUA 1FKDA 1UR8A 4R0XA 4G2PA 1KT1A 2DSVA 1FKIA 4LAXA 4DIPA 1E9LA 4U85A 2DG3A 1FKSA 1TFVA 3O5DA 4G50A 4JYSA 4MAVA 2ZQSA 3KAIA 5DIVA 4DZ3A 1D2KA 1C9HA 3IHZA 2G8ZA 2MLXA 5JH8A 3PRAA 3KZ7A 2PPOA 3OA5A 2MF9A 2A3EA 5B8IC 1ZCNA 4DH0A 3O5OA 1TCOC 4DT4A 1HKIA 4N19A 4JFLA 1YATA 2F2DA 2L2SA 5DITA 3QOKA 3AS0A 3NTPA 4DRKA 2OFNA 3ARTA 5HTGA 1M5YA 4S3JA 3W4RA 3ARRA 1NWRA 1JNTA 2P4VA 3JYJA 4DROA 2ZQUA 4U86A 2XP9A 4WKHA 5HUAA 2ZR4A 2XP7A 4P8WA 1LJYA 1E6RA 3H9RB 2YBUA 2DG4A 4UDMA 2LKNA 4Z2HA 3RM4A 3CHDA 2Q5AA 1OGGA 2QF8A 3TC5A 1W1TA 2PPPA 4Q7NA 1E15A 2EULA 2RURA 1FFQA 3WD3A 2MPHA 4LAYA 4PTMA 1E6PA 1CTNA 2A3AA 2A3CA 3ARSA 3WL0A 1E6NA 1HJWA 4W9QA 3ARPA 1JNSA 2PPNA 4U84A 4MNJA 2LGOA 4R5EA 3B7XA 5I98A 4MPKA 5D75A 4JFKA 4WIWA 1W1YA 3G6MA 1FKRA 1GOIA 1EIBA 3WD4A 5DIUA 4ODOA 2XP5A 3WD0A 1ZBWA 5GQBA 4GIVA 2PV3A 1OGBA 2KE0A 3WH0A 3GPKA 4MNLA 1JNEA 4J4NA 4P8UA 1B6CA 1W9PA 3KADA 1NMWA 2F4EA 3IKGA 3KABA 1FKKA 4KR0B 1JVWA 2DSZA 2PBCA 1EHNA 2XP6A 1NWUA 3UI4A 1KFWA 4TX0A 1NH6A 3AROA 4BF8A 3O5FA 4DWSD 3RGCA 4LAWA 4L72B 3RM9A 2ZQVA 4O2TA 1FKJA 2ZQTA 2AOSA 4TW7A 1J4HA 2DG9A 1FJDA 3KCEA 1Q6UA 1QZ2A 4Z2IA 4MSPA 4W5UA 2KFWA 2PV2A 1X6LA 3WL1A 3WQWA 3O5IA 2M2AA 3B9EA 1Q6IA 4JFMA 4ITZA 5DF0A 4MGVA 1HKJA 4IT4A 2PI6A 2XP3A 1N1AA 4KQZA 3PR9A 2WM0A 4QIBA 5DEZA 2FDMA 1NSGA 1Q6HA 3ODKA 3ARZA 3O5QA 4WKFA 4S3KA 4ODKA 4W9OA 5HW7A 1P5QA 3NI6A 1EYMA 2VN1A 1LL7A 3OOBA 4J4OA 3EY6A 1VF8A 4NNRA 1H0IA 1FKFA 1X6NA 4QT3A 2RUCA 2DT2A 3BMBA 3KACA 3WD2A 1J4RA 2K8IA 5J6EA 3NRKA 4TW6A 4DRPA 5HWBA 2F21A 1EDQA 4ODLA 1T11A 5BXJA 4FN2A 2FKEA 1FKGA 2DT3A 3UQIA 3ARQA 2LPVA 3B9AA 4ODRA 1FFRA 3CHEA 3O5JA 3AQUA 3WD1A 5HWCA 2OLHA 2XP8A 4TYOA 3UI6A 1OWQA 3IK8A 3CHFA 4L3NA 1F8AB 3PA7A 3FAPA 1EQ3A 4DRNA 2DT0A 1XRVA 1NWSA 4Q22A 4C02B 2A3BA 3WKZA 1W1PA 1Q1CA 1ZBVA 2JZVA 1NMVA 2VCDA 1W1VA 4JFJA 2RQSA 3JYMA 4HBOA 4ODNA 4W9PA 3O5PA 1U79A 4ZPWR 4ODQA 4DRMA 1R9HA 4P8XA 2RSEA 4DWSA 1W26A 3FY1A 4WJXA 4DWSC 4AY1A 3TDBA 1FAPA 1J4IA 4IT6A 4Z2KA 4JFIA 2N87A 4ZS6A 4NZCA 2KR7A 3WIJA 1GRJA 2DSWA 4LGXA 4FAPA 3I6CA 3WQVA 2WLZA 3O5LA 4GGQA 3RMEA 1D6OA 2UZ5A 1ZL1A 1YW5A 1QPFA 2ESCA 1HJVA 4DRJA 1F40A 3KAFA 2PN0A 2XPBA 1A7XA 3LUOA 1WNOA 2F23A 3UQAA 1ZBKA 4IPXA 3UQBA 3PRBA 5HW6A 1LL6A 1E44A 5GPRA 4HARA 4ZPVR 4IQCA 1PINA 4IQ2A 1L1PA 2ZR5A 3AS2A 4TW8A 4P8VA 3UF8A 1KT0A 2MLZA 3MDYB 1UR9A 4XAKA 4URIA 1LL4A 2RUQA 1W9UA 4DRQA 1IX5A 5HKGA 3ALFA 4NSBA 3AS1A 2KI3A 2DPEA 2ITKA 3CGMA 2WK2A 3TCZA 4LAVA 4DWSB 3BXWA 1D7JA 1HJXA 4Z2GA 2M1IA 3ARXA 4MNKA 3O5KA 4ODMA 3ARWA 1JNDA 2DT1A 2B31A 2B5UB 3KAGA 2WLYA 1BL4A 1JCHB 1SYTA 3RFWA 4QT2A 4Z2JA 1FKHA 2DSUA 1RD6A 1K9TA 2XPAA 4MNMA 1FKTA 2FAPA 1ZBCA 1W9VA 3B8SA 2PV1A 1O6IA 3CGNA 2MNTA 3AS3A 1E6ZA 3GTYX 1ZB5A 1QPLA 2ZR6A 4WKAA 3UI5A 2IF4A 2KGJA 1HKKA 1ZU8A 5HT1A 1XHGA 3IKDA 3ARUA 2M08A 3CZ8A 4WK9A 2XP4A 3EIPA 1BKFA 1ITXA 2YBTA 2MLYA 1FKBA 4MTVA 3FXYA 3O5GA 4ZPTR 4HBEA 1D7IA 1NWTA 2Y78A 1HKMA 2G41A 5DO2A 2IUZA 4DRHA 4Z2LA 5HBFA 2LJ4A 2KO7A 1ZK6A 1J6YA 2O9OA 1D7HA 1FKLA 3VAWA 1FD9A 3ARVA 1HXVA 3O5EA 2RUDA 3O5MA 3G6LA
chains in the Genus database with same CATH topology
1WB0A 4QZVB 3B9DA 1GUVA 2O92A 3RM8A 5HW8A 3O5RA 1LG1A 1GPFA 3ALGA 5GPGA 1SR0A 4TNSA 1WAWA 2D9FA 1LQ0A 4ML4A 2AWGA 3PRDA 3KAHA 1LG2A 3JXVA 3CHCA 4DRIA 3CH9A 1H0GA 4ODPA 1Y0OA 1ROTA 4DZ2A 1PBKA 3ARYA 1ROUA 1FKDA 1UR8A 4R0XA 4G2PA 1KT1A 2DSVA 1FKIA 4LAXA 4DIPA 1E9LA 4U85A 2DG3A 1FKSA 1TFVA 3O5DA 4G50A 4JYSA 4MAVA 2ZQSA 3KAIA 5DIVA 4DZ3A 1D2KA 1C9HA 3IHZA 2G8ZA 2MLXA 5JH8A 3PRAA 3KZ7A 2PPOA 3OA5A 2MF9A 2A3EA 5B8IC 1ZCNA 4DH0A 3O5OA 1TCOC 4DT4A 1HKIA 4N19A 4JFLA 1YATA 2F2DA 2L2SA 5DITA 3QOKA 3AS0A 3NTPA 4DRKA 2OFNA 3ARTA 5HTGA 1M5YA 4S3JA 3W4RA 3ARRA 1NWRA 1JNTA 3JYJA 4DROA 2ZQUA 4U86A 2XP9A 4WKHA 5HUAA 2ZR4A 2XP7A 4P8WA 1LJYA 1E6RA 3H9RB 2YBUA 2DG4A 2LKNA 4Z2HA 3RM4A 3CHDA 2Q5AA 1OGGA 2QF8A 3TC5A 1W1TA 2PPPA 4Q7NA 1E15A 2RURA 1FFQA 3WD3A 2MPHA 4LAYA 4PTMA 1E6PA 1CTNA 2A3AA 2A3CA 3ARSA 3WL0A 1E6NA 1HJWA 4W9QA 3ARPA 1JNSA 2PPNA 4U84A 4MNJA 2LGOA 4R5EA 3B7XA 5I98A 4MPKA 5D75A 4JFKA 4WIWA 1W1YA 3G6MA 1FKRA 1GOIA 1EIBA 3WD4A 5DIUA 4ODOA 2XP5A 3WD0A 1ZBWA 5GQBA 4GIVA 2PV3A 1OGBA 2KE0A 3WH0A 3GPKA 4MNLA 1JNEA 4J4NA 4P8UA 1B6CA 1W9PA 3KADA 1NMWA 2F4EA 3IKGA 3KABA 1FKKA 4KR0B 1JVWA 2DSZA 2PBCA 1EHNA 2XP6A 1NWUA 3UI4A 1KFWA 4TX0A 1NH6A 3AROA 4BF8A 3O5FA 4DWSD 3RGCA 4LAWA 4L72B 3RM9A 2ZQVA 4O2TA 1FKJA 2ZQTA 2AOSA 4TW7A 1J4HA 2DG9A 1FJDA 3KCEA 1Q6UA 1QZ2A 4Z2IA 4MSPA 4W5UA 2KFWA 2PV2A 1X6LA 3WL1A 3WQWA 3O5IA 2M2AA 3B9EA 1Q6IA 4JFMA 4ITZA 5DF0A 4MGVA 1HKJA 4IT4A 2PI6A 2XP3A 1N1AA 4KQZA 3PR9A 2WM0A 4QIBA 5DEZA 2FDMA 1NSGA 1Q6HA 3ODKA 3ARZA 3O5QA 4WKFA 4S3KA 4ODKA 4W9OA 5HW7A 1P5QA 3NI6A 1EYMA 2VN1A 1LL7A 3OOBA 4J4OA 3EY6A 1VF8A 4NNRA 1H0IA 1FKFA 1X6NA 4QT3A 2RUCA 2DT2A 3KACA 3WD2A 1J4RA 2K8IA 5J6EA 3NRKA 4TW6A 4DRPA 5HWBA 2F21A 1EDQA 4ODLA 1T11A 5BXJA 4FN2A 2FKEA 1FKGA 2DT3A 3UQIA 3ARQA 2LPVA 3B9AA 4ODRA 1FFRA 3CHEA 3O5JA 3AQUA 3WD1A 5HWCA 2OLHA 2XP8A 4TYOA 3UI6A 1OWQA 3IK8A 3CHFA 4L3NA 1F8AB 3PA7A 3FAPA 1EQ3A 4DRNA 2DT0A 1XRVA 1NWSA 4Q22A 4C02B 2A3BA 3WKZA 1W1PA 1Q1CA 1ZBVA 2JZVA 1NMVA 2VCDA 1W1VA 4JFJA 2RQSA 3JYMA 4HBOA 4ODNA 4W9PA 3O5PA 1U79A 4ZPWR 4ODQA 4DRMA 1R9HA 4P8XA 2RSEA 4DWSA 1W26A 3FY1A 4WJXA 4DWSC 4AY1A 3TDBA 1FAPA 1J4IA 4IT6A 4Z2KA 4JFIA 2N87A 4ZS6A 4NZCA 2KR7A 3WIJA 2DSWA 4LGXA 4FAPA 3I6CA 3WQVA 2WLZA 3O5LA 4GGQA 3RMEA 1D6OA 2UZ5A 1ZL1A 1YW5A 1QPFA 2ESCA 1HJVA 4DRJA 1F40A 3KAFA 2XPBA 1A7XA 3LUOA 1WNOA 3UQAA 1ZBKA 4IPXA 3UQBA 3PRBA 5HW6A 1LL6A 5GPRA 4HARA 4ZPVR 4IQCA 1PINA 4IQ2A 1L1PA 2ZR5A 3AS2A 4TW8A 4P8VA 3UF8A 1KT0A 2MLZA 3MDYB 1UR9A 4XAKA 4URIA 1LL4A 2RUQA 1W9UA 4DRQA 1IX5A 5HKGA 3ALFA 4NSBA 3AS1A 2KI3A 2DPEA 2ITKA 3CGMA 2WK2A 3TCZA 4LAVA 4DWSB 3BXWA 1D7JA 1HJXA 4Z2GA 2M1IA 3ARXA 4MNKA 3O5KA 4ODMA 3ARWA 1JNDA 2DT1A 2B31A 3KAGA 2WLYA 1BL4A 1SYTA 3RFWA 4Z2JA 4QT2A 1FKHA 2DSUA 1RD6A 1K9TA 2XPAA 4MNMA 1FKTA 2FAPA 1ZBCA 1W9VA 3B8SA 2PV1A 1O6IA 3CGNA 2MNTA 3AS3A 1E6ZA 1ZB5A 1QPLA 2ZR6A 4WKAA 3UI5A 2IF4A 2KGJA 1HKKA 1ZU8A 5HT1A 1XHGA 3IKDA 3ARUA 2M08A 3CZ8A 4WK9A 2XP4A 1BKFA 1ITXA 2YBTA 2MLYA 1FKBA 4MTVA 3FXYA 3O5GA 4ZPTR 4HBEA 1D7IA 1NWTA 2Y78A 1HKMA 2G41A 5DO2A 2IUZA 4DRHA 4Z2LA 5HBFA 2LJ4A 2KO7A 1ZK6A 1J6YA 2O9OA 1D7HA 1FKLA 3VAWA 1FD9A 3ARVA 1HXVA 3O5EA 2RUDA 3O5MA 3G6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NSG A;  1Q6H A;  3KAF A;  3ODK A;  2RUR A;  3O5Q A;  2XPB A;  5HW7 A;  4ODK A;  1A7X A;  4W9O A;  3LUO A;  1P5Q A;  3NI6 A;  2MPH A;  4LAY A;  1EYM A;  2VN1 A;  4J4O A;  3OOB A;  3UQA A;  4IPX A;  3UQB A;  3EY6 A;  3PRB A;  4NNR A;  5HW6 A;  1FKF A;  4IQC A;  4W9Q A;  1PIN A;  4IQ2 A;  4QT3 A;  2RUC A;  1L1P A;  5HW8 A;  2ZR5 A;  3O5R A;  1JNS A;  2PPN A;  4TW8 A;  4U84 A;  3KAC A;  3UF8 A;  1J4R A;  1KT0 A;  2K8I A;  2MLZ A;  3MDY B;  5GPG A;  5J6E A;  4TNS A;  2LGO A;  2D9F A;  3B7X A;  3NRK A;  4TW6 A;  5I98 A;  4DRP A;  2AWG A;  3PRD A;  3KAH A;  3JXV A;  2RUQ A;  5D75 A;  5HWB A;  2F21 A;  4DRI A;  4ODL A;  4DRQ A;  5HKG A;  1T11 A;  4ODP A;  4FN2 A;  4JFK A;  5BXJ A;  1Y0O A;  2FKE A;  1FKG A;  1ROT A;  4DZ2 A;  1PBK A;  2KI3 A;  3UQI A;  2ITK A;  3CGM A;  3TCZ A;  1ROU A;  1FKR A;  4LAV A;  2LPV A;  1FKD A;  4ODR A;  1D7J A;  3O5J A;  4R0X A;  5DIU A;  4ODO A;  2XP5 A;  5HWC A;  2XP8 A;  4G2P A;  1KT1 A;  1FKI A;  2M1I A;  4LAX A;  3O5K A;  4ODM A;  4TYO A;  4U85 A;  2DG3 A;  4DIP A;  1FKS A;  3UI6 A;  3O5D A;  4G50 A;  4JYS A;  3KAG A;  3IK8 A;  2ZQS A;  3KAI A;  5DIV A;  4DZ3 A;  1BL4 A;  1C9H A;  3RFW A;  1F8A B;  4QT2 A;  4GIV A;  1FKH A;  3IHZ A;  3PA7 A;  2PV3 A;  3FAP A;  2KE0 A;  3WH0 A;  2MLX A;  3GPK A;  4DRN A;  1EQ3 A;  2XPA A;  4J4N A;  1FKT A;  2FAP A;  1B6C A;  2PPO A;  3KAD A;  3KZ7 A;  1NMW A;  2PV1 A;  2MF9 A;  4C02 B;  2F4E A;  3IKG A;  3CGN A;  3KAB A;  5B8I C;  1FKK A;  2MNT A;  1ZCN A;  4DH0 A;  1JVW A;  1TCO C;  3O5O A;  1QPL A;  4DT4 A;  4N19 A;  2ZR6 A;  1Q1C A;  4JFL A;  1YAT A;  2IF4 A;  2KGJ A;  2PBC A;  2JZV A;  3UI5 A;  1NMV A;  2F2D A;  2XP6 A;  2VCD A;  2L2S A;  5HT1 A;  3IKD A;  4JFJ A;  5DIT A;  3UI4 A;  2RQS A;  3JYM A;  2M08 A;  3NTP A;  4ODN A;  4TX0 A;  4BF8 A;  4DRK A;  3O5F A;  4W9P A;  2OFN A;  3O5P A;  3RGC A;  1U79 A;  2XP4 A;  5HTG A;  4ODQ A;  4LAW A;  1M5Y A;  2ZQV A;  4DRM A;  1BKF A;  1R9H A;  4O2T A;  1FKJ A;  2ZQT A;  2RSE A;  4TW7 A;  2MLY A;  1JNT A;  3JYJ A;  1J4H A;  1FKB A;  3O5G A;  2DG9 A;  2ZQU A;  4DRO A;  4U86 A;  2XP9 A;  3KCE A;  1FJD A;  1W26 A;  5HUA A;  1Q6U A;  1QZ2 A;  2ZR4 A;  4QIB A;  2XP7 A;  4MSP A;  1D7I A;  3TDB A;  1FAP A;  1J4I A;  4JFI A;  2KFW A;  2N87 A;  2Y78 A;  3H9R B;  2PV2 A;  2KR7 A;  4FAP A;  3O5I A;  2M2A A;  2DG4 A;  4DRH A;  3I6C A;  2LJ4 A;  3O5L A;  2LKN A;  1Q6I A;  4GGQ A;  1D6O A;  4JFM A;  2KO7 A;  4ITZ A;  1ZK6 A;  2UZ5 A;  4MGV A;  1J6Y A;  2Q5A A;  1YW5 A;  1D7H A;  2XP3 A;  1N1A A;  1FKL A;  1QPF A;  3VAW A;  1FD9 A;  3TC5 A;  4DRJ A;  2PPP A;  1HXV A;  3O5E A;  2RUD A;  3O5M A;  1F40 A; 
#chains in the Genus database with same CATH topology
 1WB0 A;  4QZV B;  3B9D A;  1GUV A;  2O92 A;  3RM8 A;  5HW8 A;  3O5R A;  1LG1 A;  1GPF A;  3ALG A;  3GU0 A;  2ETN A;  5GPG A;  1SR0 A;  4TNS A;  1WAW A;  2D9F A;  1LQ0 A;  4ML4 A;  2AWG A;  3PRD A;  3KAH A;  1LG2 A;  3JXV A;  3CHC A;  4DRI A;  3CH9 A;  1H0G A;  4ODP A;  1Y0O A;  1ROT A;  4DZ2 A;  1PBK A;  3ARY A;  1ROU A;  1FKD A;  1UR8 A;  4R0X A;  4G2P A;  1KT1 A;  2DSV A;  1FKI A;  4LAX A;  4DIP A;  1E9L A;  4U85 A;  2DG3 A;  1FKS A;  1TFV A;  3O5D A;  4G50 A;  4JYS A;  4MAV A;  2ZQS A;  3KAI A;  5DIV A;  4DZ3 A;  1D2K A;  1C9H A;  3IHZ A;  2G8Z A;  2MLX A;  5JH8 A;  3PRA A;  3KZ7 A;  2PPO A;  3OA5 A;  2MF9 A;  2A3E A;  5B8I C;  1ZCN A;  4DH0 A;  3O5O A;  1TCO C;  4DT4 A;  1HKI A;  4N19 A;  4JFL A;  1YAT A;  2F2D A;  2L2S A;  5DIT A;  3QOK A;  3AS0 A;  3NTP A;  4DRK A;  2OFN A;  3ART A;  5HTG A;  1M5Y A;  4S3J A;  3W4R A;  3ARR A;  1NWR A;  1JNT A;  2P4V A;  3JYJ A;  4DRO A;  2ZQU A;  4U86 A;  2XP9 A;  4WKH A;  5HUA A;  2ZR4 A;  2XP7 A;  4P8W A;  1LJY A;  1E6R A;  3H9R B;  2YBU A;  2DG4 A;  4UDM A;  2LKN A;  4Z2H A;  3RM4 A;  3CHD A;  2Q5A A;  1OGG A;  2QF8 A;  3TC5 A;  1W1T A;  2PPP A;  4Q7N A;  1E15 A;  2EUL A;  2RUR A;  1FFQ A;  3WD3 A;  2MPH A;  4LAY A;  4PTM A;  1E6P A;  1CTN A;  2A3A A;  2A3C A;  3ARS A;  3WL0 A;  1E6N A;  1HJW A;  4W9Q A;  3ARP A;  1JNS A;  2PPN A;  4U84 A;  4MNJ A;  2LGO A;  4R5E A;  3B7X A;  5I98 A;  4MPK A;  5D75 A;  4JFK A;  4WIW A;  1W1Y A;  3G6M A;  1FKR A;  1GOI A;  1EIB A;  3WD4 A;  5DIU A;  4ODO A;  2XP5 A;  3WD0 A;  1ZBW A;  5GQB A;  4GIV A;  2PV3 A;  1OGB A;  2KE0 A;  3WH0 A;  3GPK A;  4MNL A;  1JNE A;  4J4N A;  4P8U A;  1B6C A;  1W9P A;  3KAD A;  1NMW A;  2F4E A;  3IKG A;  3KAB A;  1FKK A;  4KR0 B;  1JVW A;  2DSZ A;  2PBC A;  1EHN A;  2XP6 A;  1NWU A;  3UI4 A;  1KFW A;  4TX0 A;  1NH6 A;  3ARO A;  4BF8 A;  3O5F A;  4DWS D;  3RGC A;  4LAW A;  4L72 B;  3RM9 A;  2ZQV A;  4O2T A;  1FKJ A;  2ZQT A;  2AOS A;  4TW7 A;  1J4H A;  2DG9 A;  1FJD A;  3KCE A;  1Q6U A;  1QZ2 A;  4Z2I A;  4MSP A;  4W5U A;  2KFW A;  2PV2 A;  1X6L A;  3WL1 A;  3WQW A;  3O5I A;  2M2A A;  3B9E A;  1Q6I A;  4JFM A;  4ITZ A;  5DF0 A;  4MGV A;  1HKJ A;  4IT4 A;  2PI6 A;  2XP3 A;  1N1A A;  4KQZ A;  3PR9 A;  2WM0 A;  4QIB A;  5DEZ A;  2FDM A;  1NSG A;  1Q6H A;  3ODK A;  3ARZ A;  3O5Q A;  4WKF A;  4S3K A;  4ODK A;  4W9O A;  5HW7 A;  1P5Q A;  3NI6 A;  1EYM A;  2VN1 A;  1LL7 A;  3OOB A;  4J4O A;  3EY6 A;  1VF8 A;  4NNR A;  1H0I A;  1FKF A;  1X6N A;  4QT3 A;  2RUC A;  2DT2 A;  3BMB A;  3KAC A;  3WD2 A;  1J4R A;  2K8I A;  5J6E A;  3NRK A;  4TW6 A;  4DRP A;  5HWB A;  2F21 A;  1EDQ A;  4ODL A;  1T11 A;  5BXJ A;  4FN2 A;  2FKE A;  1FKG A;  2DT3 A;  3UQI A;  3ARQ A;  2LPV A;  3B9A A;  4ODR A;  1FFR A;  3CHE A;  3O5J A;  3AQU A;  3WD1 A;  5HWC A;  2OLH A;  2XP8 A;  4TYO A;  3UI6 A;  1OWQ A;  3IK8 A;  3CHF A;  4L3N A;  1F8A B;  3PA7 A;  3FAP A;  1EQ3 A;  4DRN A;  2DT0 A;  1XRV A;  1NWS A;  4Q22 A;  4C02 B;  2A3B A;  3WKZ A;  1W1P A;  1Q1C A;  1ZBV A;  2JZV A;  1NMV A;  2VCD A;  1W1V A;  4JFJ A;  2RQS A;  3JYM A;  4HBO A;  4ODN A;  4W9P A;  3O5P A;  1U79 A;  4ZPW R;  4ODQ A;  4DRM A;  1R9H A;  4P8X A;  2RSE A;  4DWS A;  1W26 A;  3FY1 A;  4WJX A;  4DWS C;  4AY1 A;  3TDB A;  1FAP A;  1J4I A;  4IT6 A;  4Z2K A;  4JFI A;  2N87 A;  4ZS6 A;  4NZC A;  2KR7 A;  3WIJ A;  1GRJ A;  2DSW A;  4LGX A;  4FAP A;  3I6C A;  3WQV A;  2WLZ A;  3O5L A;  4GGQ A;  3RME A;  1D6O A;  2UZ5 A;  1ZL1 A;  1YW5 A;  1QPF A;  2ESC A;  1HJV A;  4DRJ A;  1F40 A;  3KAF A;  2PN0 A;  2XPB A;  1A7X A;  3LUO A;  1WNO A;  2F23 A;  3UQA A;  1ZBK A;  4IPX A;  3UQB A;  3PRB A;  5HW6 A;  1LL6 A;  1E44 A;  5GPR A;  4HAR A;  4ZPV R;  4IQC A;  1PIN A;  4IQ2 A;  1L1P A;  2ZR5 A;  3AS2 A;  4TW8 A;  4P8V A;  3UF8 A;  1KT0 A;  2MLZ A;  3MDY B;  1UR9 A;  4XAK A;  4URI A;  1LL4 A;  2RUQ A;  1W9U A;  4DRQ A;  1IX5 A;  5HKG A;  3ALF A;  4NSB A;  3AS1 A;  2KI3 A;  2DPE A;  2ITK A;  3CGM A;  2WK2 A;  3TCZ A;  4LAV A;  4DWS B;  3BXW A;  1D7J A;  1HJX A;  4Z2G A;  2M1I A;  3ARX A;  4MNK A;  3O5K A;  4ODM A;  3ARW A;  1JND A;  2DT1 A;  2B31 A;  2B5U B;  3KAG A;  2WLY A;  1BL4 A;  1JCH B;  1SYT A;  3RFW A;  4QT2 A;  4Z2J A;  1FKH A;  2DSU A;  1RD6 A;  1K9T A;  2XPA A;  4MNM A;  1FKT A;  2FAP A;  1ZBC A;  1W9V A;  3B8S A;  2PV1 A;  1O6I A;  3CGN A;  2MNT A;  3AS3 A;  1E6Z A;  3GTY X;  1ZB5 A;  1QPL A;  2ZR6 A;  4WKA A;  3UI5 A;  2IF4 A;  2KGJ A;  1HKK A;  1ZU8 A;  5HT1 A;  1XHG A;  3IKD A;  3ARU A;  2M08 A;  3CZ8 A;  4WK9 A;  2XP4 A;  3EIP A;  1BKF A;  1ITX A;  2YBT A;  2MLY A;  1FKB A;  4MTV A;  3FXY A;  3O5G A;  4ZPT R;  4HBE A;  1D7I A;  1NWT A;  2Y78 A;  1HKM A;  2G41 A;  5DO2 A;  2IUZ A;  4DRH A;  4Z2L A;  5HBF A;  2LJ4 A;  2KO7 A;  1ZK6 A;  1J6Y A;  2O9O A;  1D7H A;  1FKL A;  3VAW A;  1FD9 A;  3ARV A;  1HXV A;  3O5E A;  2RUD A;  3O5M A;  3G6L A; 
#chains in the Genus database with same CATH homology
 1WB0 A;  4QZV B;  3B9D A;  1GUV A;  2O92 A;  3RM8 A;  5HW8 A;  3O5R A;  1LG1 A;  1GPF A;  3ALG A;  5GPG A;  1SR0 A;  4TNS A;  1WAW A;  2D9F A;  1LQ0 A;  4ML4 A;  2AWG A;  3PRD A;  3KAH A;  1LG2 A;  3JXV A;  3CHC A;  4DRI A;  3CH9 A;  1H0G A;  4ODP A;  1Y0O A;  1ROT A;  4DZ2 A;  1PBK A;  3ARY A;  1ROU A;  1FKD A;  1UR8 A;  4R0X A;  4G2P A;  1KT1 A;  2DSV A;  1FKI A;  4LAX A;  4DIP A;  1E9L A;  4U85 A;  2DG3 A;  1FKS A;  1TFV A;  3O5D A;  4G50 A;  4JYS A;  4MAV A;  2ZQS A;  3KAI A;  5DIV A;  4DZ3 A;  1D2K A;  1C9H A;  3IHZ A;  2G8Z A;  2MLX A;  5JH8 A;  3PRA A;  3KZ7 A;  2PPO A;  3OA5 A;  2MF9 A;  2A3E A;  5B8I C;  1ZCN A;  4DH0 A;  3O5O A;  1TCO C;  4DT4 A;  1HKI A;  4N19 A;  4JFL A;  1YAT A;  2F2D A;  2L2S A;  5DIT A;  3QOK A;  3AS0 A;  3NTP A;  4DRK A;  2OFN A;  3ART A;  5HTG A;  1M5Y A;  4S3J A;  3W4R A;  3ARR A;  1NWR A;  1JNT A;  3JYJ A;  4DRO A;  2ZQU A;  4U86 A;  2XP9 A;  4WKH A;  5HUA A;  2ZR4 A;  2XP7 A;  4P8W A;  1LJY A;  1E6R A;  3H9R B;  2YBU A;  2DG4 A;  2LKN A;  4Z2H A;  3RM4 A;  3CHD A;  2Q5A A;  1OGG A;  2QF8 A;  3TC5 A;  1W1T A;  2PPP A;  4Q7N A;  1E15 A;  2RUR A;  1FFQ A;  3WD3 A;  2MPH A;  4LAY A;  4PTM A;  1E6P A;  1CTN A;  2A3A A;  2A3C A;  3ARS A;  3WL0 A;  1E6N A;  1HJW A;  4W9Q A;  3ARP A;  1JNS A;  2PPN A;  4U84 A;  4MNJ A;  2LGO A;  4R5E A;  3B7X A;  5I98 A;  4MPK A;  5D75 A;  4JFK A;  4WIW A;  1W1Y A;  3G6M A;  1FKR A;  1GOI A;  1EIB A;  3WD4 A;  5DIU A;  4ODO A;  2XP5 A;  3WD0 A;  1ZBW A;  5GQB A;  4GIV A;  2PV3 A;  1OGB A;  2KE0 A;  3WH0 A;  3GPK A;  4MNL A;  1JNE A;  4J4N A;  4P8U A;  1B6C A;  1W9P A;  3KAD A;  1NMW A;  2F4E A;  3IKG A;  3KAB A;  1FKK A;  4KR0 B;  1JVW A;  2DSZ A;  2PBC A;  1EHN A;  2XP6 A;  1NWU A;  3UI4 A;  1KFW A;  4TX0 A;  1NH6 A;  3ARO A;  4BF8 A;  3O5F A;  4DWS D;  3RGC A;  4LAW A;  4L72 B;  3RM9 A;  2ZQV A;  4O2T A;  1FKJ A;  2ZQT A;  2AOS A;  4TW7 A;  1J4H A;  2DG9 A;  1FJD A;  3KCE A;  1Q6U A;  1QZ2 A;  4Z2I A;  4MSP A;  4W5U A;  2KFW A;  2PV2 A;  1X6L A;  3WL1 A;  3WQW A;  3O5I A;  2M2A A;  3B9E A;  1Q6I A;  4JFM A;  4ITZ A;  5DF0 A;  4MGV A;  1HKJ A;  4IT4 A;  2PI6 A;  2XP3 A;  1N1A A;  4KQZ A;  3PR9 A;  2WM0 A;  4QIB A;  5DEZ A;  2FDM A;  1NSG A;  1Q6H A;  3ODK A;  3ARZ A;  3O5Q A;  4WKF A;  4S3K A;  4ODK A;  4W9O A;  5HW7 A;  1P5Q A;  3NI6 A;  1EYM A;  2VN1 A;  1LL7 A;  3OOB A;  4J4O A;  3EY6 A;  1VF8 A;  4NNR A;  1H0I A;  1FKF A;  1X6N A;  4QT3 A;  2RUC A;  2DT2 A;  3KAC A;  3WD2 A;  1J4R A;  2K8I A;  5J6E A;  3NRK A;  4TW6 A;  4DRP A;  5HWB A;  2F21 A;  1EDQ A;  4ODL A;  1T11 A;  5BXJ A;  4FN2 A;  2FKE A;  1FKG A;  2DT3 A;  3UQI A;  3ARQ A;  2LPV A;  3B9A A;  4ODR A;  1FFR A;  3CHE A;  3O5J A;  3AQU A;  3WD1 A;  5HWC A;  2OLH A;  2XP8 A;  4TYO A;  3UI6 A;  1OWQ A;  3IK8 A;  3CHF A;  4L3N A;  1F8A B;  3PA7 A;  3FAP A;  1EQ3 A;  4DRN A;  2DT0 A;  1XRV A;  1NWS A;  4Q22 A;  4C02 B;  2A3B A;  3WKZ A;  1W1P A;  1Q1C A;  1ZBV A;  2JZV A;  1NMV A;  2VCD A;  1W1V A;  4JFJ A;  2RQS A;  3JYM A;  4HBO A;  4ODN A;  4W9P A;  3O5P A;  1U79 A;  4ZPW R;  4ODQ A;  4DRM A;  1R9H A;  4P8X A;  2RSE A;  4DWS A;  1W26 A;  3FY1 A;  4WJX A;  4DWS C;  4AY1 A;  3TDB A;  1FAP A;  1J4I A;  4IT6 A;  4Z2K A;  4JFI A;  2N87 A;  4ZS6 A;  4NZC A;  2KR7 A;  3WIJ A;  2DSW A;  4LGX A;  4FAP A;  3I6C A;  3WQV A;  2WLZ A;  3O5L A;  4GGQ A;  3RME A;  1D6O A;  2UZ5 A;  1ZL1 A;  1YW5 A;  1QPF A;  2ESC A;  1HJV A;  4DRJ A;  1F40 A;  3KAF A;  2XPB A;  1A7X A;  3LUO A;  1WNO A;  3UQA A;  1ZBK A;  4IPX A;  3UQB A;  3PRB A;  5HW6 A;  1LL6 A;  5GPR A;  4HAR A;  4ZPV R;  4IQC A;  1PIN A;  4IQ2 A;  1L1P A;  2ZR5 A;  3AS2 A;  4TW8 A;  4P8V A;  3UF8 A;  1KT0 A;  2MLZ A;  3MDY B;  1UR9 A;  4XAK A;  4URI A;  1LL4 A;  2RUQ A;  1W9U A;  4DRQ A;  1IX5 A;  5HKG A;  3ALF A;  4NSB A;  3AS1 A;  2KI3 A;  2DPE A;  2ITK A;  3CGM A;  2WK2 A;  3TCZ A;  4LAV A;  4DWS B;  3BXW A;  1D7J A;  1HJX A;  4Z2G A;  2M1I A;  3ARX A;  4MNK A;  3O5K A;  4ODM A;  3ARW A;  1JND A;  2DT1 A;  2B31 A;  3KAG A;  2WLY A;  1BL4 A;  1SYT A;  3RFW A;  4Z2J A;  4QT2 A;  1FKH A;  2DSU A;  1RD6 A;  1K9T A;  2XPA A;  4MNM A;  1FKT A;  2FAP A;  1ZBC A;  1W9V A;  3B8S A;  2PV1 A;  1O6I A;  3CGN A;  2MNT A;  3AS3 A;  1E6Z A;  1ZB5 A;  1QPL A;  2ZR6 A;  4WKA A;  3UI5 A;  2IF4 A;  2KGJ A;  1HKK A;  1ZU8 A;  5HT1 A;  1XHG A;  3IKD A;  3ARU A;  2M08 A;  3CZ8 A;  4WK9 A;  2XP4 A;  1BKF A;  1ITX A;  2YBT A;  2MLY A;  1FKB A;  4MTV A;  3FXY A;  3O5G A;  4ZPT R;  4HBE A;  1D7I A;  1NWT A;  2Y78 A;  1HKM A;  2G41 A;  5DO2 A;  2IUZ A;  4DRH A;  4Z2L A;  5HBF A;  2LJ4 A;  2KO7 A;  1ZK6 A;  1J6Y A;  2O9O A;  1D7H A;  1FKL A;  3VAW A;  1FD9 A;  3ARV A;  1HXV A;  3O5E A;  2RUD A;  3O5M A;  3G6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...