4DOQA

Crystal structure of the complex of porcine pancreatic trypsin with 1/2slpi
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
221
Chain Sequence
b'IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Structure basis 1/2SLPI and porcine pancreas trypsin interaction
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 221
sequence length 223
chains with identical sequence C, E
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4doqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4doqA02
4TPIZ 1GCDA 2SGAA 2H9EH 1UO6A 1GHAG 5JBCS 3ATLA 1FAXA 4Y76A 4BNRA 1S85A 1E35B 4Y10E 3URCA 1V3XA 1OP8A 3H7TA 2Z7FE 1J14A 1C9TA 1GVLA 1P04A 3K65B 1XUIA 4OS1A 4YOJA 1GJ5H 3MI4A 2M5TA 1LHFH 3Q3XA 4TWWA 2NU1E 1LVMA 4U32A 7KMEH 1O3EA 2FPZA 4Y7AA 1A3BH 5HXFA 1QRWA 4BAHB 3S9AA 2GCHF 1QQ4A 3NPSA 4Z0KA 1QB9A 3IWMA 3TU7H 1AB9B 1GBLA 2ZDAH 4TYDA 4U01A 1RFNA 2OBQA 1O3CA 3RDZA 1LVBA 2A0QB 2G51A 5FBIA 1C1RA 4WH8A 2O8LA 2GDDA 3UUZA 3RM0H 2ZPQA 3A82A 1YLCA 1HAYB 1EZSC 1AN1E 1XKBC 1LQDB 4Y0ZE 3EAJA 2BD9A 3P8NA 3SUDA 3MYWA 5ESBA 4WJG2 1J17T 3BSQA 1EAIA 2ZFFH 5T6DA 2ZGCA 3B23B 4BTUB 1A3EH 1FUJA 3OX7U 2BY8X 4AG1A 5B6OA 3MNSA 1WUNH 1DXWA 1ELBA 1TBQH 2O8MA 3RXHA 4I33A 1MZAA 3QTVH 2UUYA 3LJJA 4FUCA 4I8HA 3BTWE 4DIHH 1XUHA 5DKMA 1NN6A 3SU2A 3MWIU 1C1SA 2Z9LA 2RCEA 1V2MT 1SGFA 1TX8A 2BVXH 1L4ZA 5E0JA 1AO5A 1ZPZA 1W14U 2A5KA 1LCYA 1K2I1 1QL7A 2BOHB 2VINA 5DP9A 4LZ4B 4LXBH 4MNWA 3DA9B 2A32A 5EW2H 2ZGJA 2XCFA 3P92A 5EQSA 1SBWA 4KKDA 3BG8A 1S83A 1TOMH 1QTFA 1XMNB 2Q1JA 1XUJA 1KLIH 2SGDE 3T28A 1W7GH 4XBDA 2Z3CA 1O3JA 3UNRA 4BANB 4KTSA 5C5OA 6GCHF 3ZZCA 3Q00A 2HNTF 5AHGH 2BD5A 3U8RH 4DCDA 3RXRA 2FYRA 1C5NH 1O5GH 1NS3A 3P8FA 2H9TH 1IQIA 4NWKA 3TJVA 1HJ8A 3RU4E 3AW1A 1MKWH 3SW2B 1H8DH 1AI8H 3S9CA 5F03A 1T32A 3VGCC 4BTTB 1YPMH 2OC7A 1GI1A 1SLUB 1Z8JB 4FU8A 1ETSH 4JK6A 4NWLA 1ZHRA 1EB2A 1Y3VA 2ZFQH 3P70B 4YT6H 3ZVAA 2YNAA 1F0UA 4KP0A 4NCYA 4IC5A 1UCYH 2OC0A 1JIRA 5C1XA 4ASHA 1JRSA 4DVAU 1F5LA 1UHBA 3UR9A 1TQ0B 3A7XA 3RC4A 2G55A 3D49H 4ZHLU 3SU3A 4A92A 4YLUA 2O8UA 3ATKA 3TNTA 4AFZA 2ZF0H 2OQUA 2OXSA 2FOMB 2ZECA 1WTHD 1ZZZA 1C2FA 5A8ZA 4OGXA 1CHOG 1OYTH 1ELGA 2A2QH 2A4GA 2EA3A 1AE5A 2FI5E 1G2MA 4JYVH 1PPBH 6CHAB 4RN6A 2P93A 4DGJA 2AFQB 4AYYB 1CT0E 4UFEH 2BQ7B 3LH3A 1IQHA 5EPNA 5JPMH 1YCPH 1BRUP 2WUBA 2BLWA 1C2DA 2AGEX 1F5KU 1Z8GA 2ZZUH 4I8KA 1DICA 2CF8H 4BAKB 2BD7A 3L33A 1AZZA 4Y11E 4B73A 1DANH 1O5BB 1CHGA 1Y5AT 1BUIA 1FJSA 2PSYA 1GI7B 1K21H 3N7OA 1NY22 1GDQA 4GUXA 5EXMA 3BTKE 3M5MA 3Q3KA 3BV9B 1ESBA 1ZHPA 1ELCA 3GCHB 3STJA 2ESTE 3NK8A 3BF6H 1P03A 3ZVEA 3SQEE 2KAIB 2G5VA 1O3FA 1SR5C 1T8LA 1D3DB 3RXEA 3RXDA 2C4FH 2G52A 4YTAA 1YPHE 1C1PA 3GYMA 1CU1A 2OC8A 1GHZA 1IQEA 4IC6A 1CGIE 2A4RA 1KXDA 1DWEH 1BBRE 3GY3A 3SU5A 3M3TA 2A4QA 3GY8A 1GMHG 1O2QA 1QHRB 4SGBE 2F9VA 2FOHA 3KCGH 1BTHH 4B71A 3FANA 2DE9A 2VGCB 1Q2WA 1WCZA 3Q77A 4E7NA 4X2WA 1BTYA 1FIZA 2B5TB 4Y71A 2IOTA 1HLTH 1BBRH 1BMLA 2Q6GA 5GCHG 5JBBS 3RLWH 1F5RA 3MO6A 1SGEE 5HYOA 5JBAS 1GCTB 1UVSH 2VWOA 1FN8A 2R2MB 1D9IA 2ZPSA 1EOJA 1GDUA 1KXFA 1BMNH 2AEIH 3TGIE 2A2XH 1GVKB 3SZNA 2Y5HA 4A1VA 2ZDNA 2BY6X 3ZZDA 1C5QA 3PWCA 2WPLS 2ZCLP 1W10U 1HJAC 1M9UA 2R3UA 2PHBA 4XFQA 2EI6A 4A7IB 3GY5A 3M3VA 4FU9A 4Y0YE 3KN2A 1P05A 1C1WH 1SGPE 3CP7A 3GISB 1HAIH 3S7HB 1MTNB 2BXUH 2GKVE 3TH2H 3A83A 2CGAA 1ELDE 1KLTA 2XBWA 2ZFTA 1TNKA 3A7YA 4CH2B 2BHGA 5A0BA 1PYTC 4LOYH 1PFXC 1SB1H 4K1EA 1BT7A 3QTOH 2ZKSA 4X1SU 3CS7A 1D3TB 3PLBA 3DFLA 4ABAA 1T8OA 2HNTC 4HZHA 1SOTA 1MU6B 1RD3B 4O3TA 2W7SA 1WU1A 1NRQH 2GTBA 1K9OE 2ZQ2A 1W2KH 3JZ1B 4GSOA 2FOGA 2CHAB 2BVRH 3GDSA 3QWCH 1L0ZA 4K69A 2PKSC 3MHWU 4CRGA 5E2PA 1C2EA 1MQ6A 4RKJB 1GHAF 1XKAC 5EG4A 1EQ9A 2ZDLA 1O3AA 1P12E 1JMOH 1EAXA 3MMGA 5DK1A 1Z1JA 3LPRA 1ZJDA 2FESH 3A87A 3VEQB 3NUMA 1GBJA 1SGYE 3U69H 1TGTA 4CRCA 5DP3A 1QJ6B 1HBTH 4BAMB 1TNJA 3ZZ4A 4ISIH 4K5ZA 3M7TA 2Z9GA 1T7CA 1ACBE 2XCNA 1Y3UA 2SGEE 1UTLM 4ABGA 1T4VH 4YLQH 3SBKA 1AVXA 4MG3A 3B9FH 2UWLA 1A2CH 2CXVA 3RXOA 1C1QA 1NFYA 2GDEH 5BPEA 1N1LA 5C5NA 5H4IB 1UMAH 1C1UH 1OWEA 1Z8IB 1HV7A 1GBMA 3GY2A 3RXVA 1ID5H 1UK4A 5LH8A 1G3EA 1AU8A 1RXPA 1O2XA 2GCTB 2FI3E 1LKAA 3ZZ3A 1MBMA 3TK9A 1JIMA 4WH6A 1D3PB 1P0SH 1C5UA 2PLXA 3SGBE 4ZMAH 2F9OA 3EA7A 1QNJA 3U98H 1VITH 1ANDA 1UK2A 2LPRA 4ABFA 2B8OH 2ZA5A 3FP7E 1QL9A 2QXJA 4NA7A 4FUGA 3GDVA 2OUAA 3T27A 1PYTD 4WMEA 1A0LA 1SOZA 3BTTE 4D9QA 3KQBA 2UWPA 1AE8H 2BTCE 5LGOA 2ANWA 3CS0A 4ABHA 1HPGA 3GCOA 4Q2KA 4JZEH 3A84A 8LPRA 3PMAB 4CR9A 1OWHA 5A8YA 3MU8A 4INHA 1BB0B 1H9LB 3U1IB 5FCKA 4ZKRU 3GCTG 2Y7XA 4ABBA 2OTVA 1SLWB 2G5NA 1ZPBA 3BEFB 3ODDA 1P06A 3H7OA 2YNBA 1EB1H 1ORFA 1WOFA 2G4TA 3LKWA 2FODA 3O8DA 3UOPA 1SSXA 4JZ1A 1HIAB 3V12A 3KL6A 3FP8E 3MU1A 1AZ8A 1HAXB 4CRBA 3SJIA 4DG4A 3PWBA 5JDUB 1U6QA 2P94A 4FVDA 4DOQA 1CQQA 4R8TB 1P09A 2FM2A 4JYUH 1UCYK 5CHAB 1FXYA 4I8JA 2FOBA 3SV2H 4ZXYH 1HCGA 1O37A 1W0YH 8GCHG 3QZRA 1N8OB 4VGCB 1V2ST 1O2JA 1QQUA 4H6TA 1C2LA 1KXBA 1YLDA 3ATIA 4NFFA 4GHQA 2OLGA 3MFJA 4MVNA 2J34A 3O8BA 1S82A 3LC3A 3UREA 4AFSA 2ALPA 2PSXA 3RU4T 1Z8RA 2XC4A 3BEIB 3MH7A 1HDTH 1H4WA 2XBVA 1MUEB 2RG3A 3PROA 3QUMP 1A0JA 2WINI 1P2NA 4MNYA 1O2IA 1O2NA 1Z7KA 1A5GH 1AMHA 2HVXA 1FONA 5L2ZH 1IOEA 1J15A 1O34A 1ELAA 1ZMJA 4F49A 1NT1A 4M7GA 4Y8ZA 6LPRA 2P3UB 3I29A 1S0QA 3SJOA 1HAZB 3HPTB 1VITG 2CF9H 1UTPA 2QF0A 1Y3YA 4A5TS 5FX6A 2ZDKA 1SPJA 4AGKA 4NGAH 4INKA 1L4DA 4FVBA 3Q76A 1C2MA 1OP2A 4MPWA 1W0ZU 4YESB 1C5XB 1GBDA 4NIWA 1HIAA 2Z9JA 3H5CB 3PM3A 4GAWA 4Y8XA 3KIDU 1L1GA 4SGAE 5TJXA 1GI0A 4QT8C 1O3KA 1RTLA 3U9AH 1GBFA 1OP0A 1LHCH 1O3PB 4O97A 3ZZ7A 1EJNA 2D26C 1F7ZA 4ISLA 1C4Y2 2ZWLH 2SGPE 1GG6C 1LVOA 1GJBB 1XM1A 4B74A 1FY8E 4O9VA 3ZVBA 1MMJN 1QIXB 5FX5A 9ESTA 7LPRA 2GT7A 1C1VH 4BTIB 4ZHAA 3TNSA 1Z6EA 2ULLA 1DX5M 4X1PU 1GL0E 1KY9A 1WAYB 1RIWC 3PO1B 5C20A 1WYKA 5J4QA 1IHSH 5DPAA 1THSH 2PR3A 1LQEA 1K1JA 3TLOA 3FVFB 1NZQH 1SI5H 3ZVCA 1NU7B 5DGJA 1EJMA 4AGJA 2AMPA 3SU4A 1D4PB 1KLJH 5AFZH 3W95A 1DE7H 1Y59T 1Z1IA 1ZTLA 4FUJA 5G4BA 1ANBA 1NRSH 2BD3A 7GCHF 3UPEA 4KTCA 1GDNA 3ZVDA 1AIXH 3P8GA 3SU0A 5EQQA 2GMTB 4HGCA 1KXEA 3U1JB 1CBWB 4A1XA 5DP8A 4DURA 1EASA 1TALA 3G01A 1C5TA 4JK5A 1BMAA 4IMZA 3SHCH 2G4UA 1E34B 1NPMA 1TLDA 3SUFA 5A09A 2QGRA 4ABJA 5L30H 3M3SA 3BIVH 4IMQA 2QYIA 2Z3DA 1HAPH 1BTUA 3BTFE 3KQDA 1C5ZB 3ZZ8A 1YCPM 2Z3EA 5EPYA 2ZHWH 2FS9A 1QBNA 1DFPA 1NFWA 1OXGA 1UHBB 2HALA 2HPPH 1HNEE 3V0XA 1SGRE 1AY6H 2QF3A 2GV7A 3EQ0H 1GBAA 1TMTH 1UTOA 2ILNA 1GBEA 4WVPE 3EA8A 1GI5A 1XVOA 1C1MA 5EW1H 4O03A 3VXEH 1MTUA 3VB4A 2Y80A 1AKSA 2BDBA 1FY5A 4MPUA 1O2TA 4H6SB 1GI2A 3SQHE 5F8ZA 3RMLH 2RA3A 1XUFA 1MKXH 1O3IA 1H8IH 1SQAA 3ELAH 4GHTA 1D3QB 3S69A 3HGNA 3QO6A 1C2IA 1TBZH 1QR3E 4K2YA 2P8OC 2WYGA 4ISOA 5TCCA 1RJXB 1C5VA 1G32B 5GWZA 4UDWH 1CA8B 3T62A 2BQ6B 2JETB 2SGFE 3KEEA 1GBTA 2EEKA 3A7TA 2NU2E 5I25A 3SNEA 3K2UA 2AIPA 3RXBA 1THPB 3ATWA 1JRTA 2W26A 1E38B 2VIWA 2W3KA 1KXAA 5A2MH 3UNSA 2AYWA 3SNAA 3TGKE 1GBKA 2GZ7A 1V2UT 3U8OH 1IQLA 1G3DA 1CO7E 2ZNKH 1UTNA 1TGCA 3AW0A 4E05H 1MCTA 2ZO3H 4E7RG 3V13A 3SU6A 1O2PA 3TIUA 1GJ9B 1QL8A 2QAAA 1AB9C 4J2YB 1O2WA 4FUEA 1V2OT 1BRCE 1C1NA 1GMDF 5E8EH 3ESTA 1OSSA 2FS8A 1P01A 1MD7A 1XXDA 1S84A 3P95A 4DY7B 1NFXA 3C1KA 9LPRA 2QN5T 2D8WA 3MOCA 1VGCB 4AORA 3RXFA 1O39A 1TA2A 3M35A 2IPHA 4YO9A 4Q7ZA 3EA9A 3A88A 2OBOA 2R9PA 2SFAA 4JZFH 1PPCE 1C2HA 3R0FA 2PUQH 5SGAE 2OD3B 2ZTXA 4X6NA 4B76A 3S0NA 5FPTA 4CRDA 4NG9H 3MO3A 1GBIA 3VB3A 1ABIH 1ZPCA 3D62A 1NTPA 2HPQH 1T4UH 1OKXA 1VCWA 3HKIB 4K8YA 3JZ2B 1OS8A 4IW4E 4I8GA 1GBCA 4X6PA 1YPGH 3RXPA 5FCRA 3FZZA 1O3GA 2F9PA 3O8RA 2NWNA 4Z6AH 1PPEE 1K28D 2NU0E 1DLKB 1BA8B 3NXPA 3OSYA 1NFUA 4MDSA 1EZUC 2FP7B 1Y3WA 3ZV8A 8GCHF 1MU8B 1LTOA 4E06H 3QZQA 1WBGB 3ZYEA 4XBBA 2GP9B 3LC5A 1HYLA 1V2RT 2SNVA 3E16B 3FZDA 3RXMA 2Y5GA 1HAGE 1EPTB 3LDXH 1MD8A 1GHYH 3NKKA 1TBRH 1DLEA 2BLVA 2C8ZB 1ELEE 4X1NU 3RXJA 2G8TA 1GJ8B 5GPIB 3R3GB 1F2SE 3F9FA 2ODQA 2ZEBA 3HATH 1ZSKA 2VB0A 1TMBH 2UUJB 3KQCA 1OWDA 2RA0A 3P6ZB 3RXIA 2IN2A 1FY4A 2FTMA 2ZFPH 2QXHA 3NCLA 2BDCA 1AUJA 1ELTA 1SL3A 1YC0A 3KHVA 2QXGA 1C5LH 2J95A 2JH0D 1GMCG 4MQAA 2AMQA 3AAUA 2HNTE 1ZRKA 2F83A 3L3TA 1A5HA 6CHAC 3VPKA 4NZQA 3SNDA 3ZZBA 1SGCA 1V2PT 3A86A 1W12U 3GYLB 5GDSH 1MBQA 2BZ6H 1GHBF 2ZGXH 4FXGH 3RXGA 4CHAB 1LMWB 1BITA 1YPLH 3M7UA 5E0HA 4J1YA 3TITA 3P17H 1EX3A 1NM6A 2GZ8A 4INLA 2HGTH 4ZKOU 3ZZAA 4AG2A 1P8VC 1O30A 3QGNB 2A1DB 4IBLH 3GCHC 3VFEA 5JYIA 1HXFH 1NRNH 1P9UA 2FZZA 2BY9X 2PTCE 2GVFA 4ABIA 2GV6A 4YM9A 1VJAU 2J4IA 1ZJKA 2BD2A 3STIA 1Z71A 2C90B 3V7TA 1GL1A 1EPTA 2FIRH 4AFQA 3FAOA 4CBOA 5DJ7A 3TK6A 1AVWA 1B0EA 1MTSA 3E6PH 3UIRA 2UUKB 2ZI2H 2P59A 1C2JA 2GCHG 1L1JA 4D76A 4THNH 1O2ZA 3URDA 2VVUA 1V2TT 3UQOA 3IG6B 1GPZA 1GI4A 4R0IA 3AASA 1BOQA 2ODPA 2P3FH 1CT2E 1TIOA 3BIUH 1KTTB 2STBE 2VGCC 1YPKH 2VVVA 3QLPH 3T29A 4MNXA 2ZG0H 3EGKH 4DW2U 1CA0B 4JMYA 2BDYA 1W8BH 3I77A 3D23A 3UQVA 3BTGE 4XBCA 2OQ5A 1P11E 2EI8A 2C93B 1C5WB 1GCTC 3K6ZA 4FUHA 2AMDA 4OS2A 2Q6FA 3AAVA 3LJOA 5HM9A 2O9QA 3RMNH 2W7UA 3UNQA 4X2XA 3KQEA 1WSSH 3RXUA 1H9HE 2PW8H 1V2QT 3ODFA 4K1SA 1GGDB 3LIWA 1IQNA 1O2VA 2H2ZA 4Y7BA 1P2IA 3GOVB 1GHWH 2CJIA 2QY0B 3T5FH 3W94A 4WWYA 2J2UA 2WUCA 1MTNC 3E3TA 1ZRBA 3RXAA 3SV7A 1IQMA 4DT7B 1CGHA 1V2WT 3SGAE 2O8WA 3DUXH 2F3CE 3P8OA 2ODYB 6GCHG 5JB8S 2XW9A 4ISNA 1QJ7B 1TB6H 1T31A 1C5YB 2EI7A 1MKXK 2VH0A 3RMMH 1KTSB 1EATA 3A8CA 2ZCKP 4I31A 1FIWA 3BN9A 3QDZB 1NRRH 5A0AE 4LZ1H 1A0HB 1KIGH 3A8BA 1BJVA 3DFJA 1MZDA 1AHTH 2CHAC 3PTBA 4K1TA 3UTUH 2ZDVH 1AFQB 1BRBE 1OWIA 2J94A 1O2LA 3QGJA 1MH0A 2Q6DA 2V0BA 2QV1A 3SHAH 2PFEA 2R0KA 1ANEA 1O2HA 1GBBA 2GT8A 1NC6A 1P3EA 1FAKH 1QB6A 3TJOA 1YM0A 2WPJS 3TPIZ 2Z9KA 2OINA 1A7SA 1PQAA 1MKWK 2BLOA 3M36A 1HAVB 5EGMA 3FFGA 1ZOMA 3E0PB 1K1MA 1O3LA 4LK4A 4U2WA 1LPZB 2D1JA 3RUOA 3F68H 4MPVA 4A1TA 2G81E 1DOJA 1O2GH 3CENA 1O3NA 6ESTA 1GJ7B 1C2GA 3ZZ5A 1ARBA 2PTNA 1GJ4H 4CBNA 1SLXB 1LHEH 2LNCA 5EXLA 1Y3XA 1JBUH 1TYNA 1DXPA 1O0DH 1YKTA 3MU4A 4WY3A 2TBSA 2GCTC 3GY7A 1LO6A 3LGWA 4Y6DA 5T6GA 2C8YB 1OPHB 3S7KB 4NIVA 1C4V2 4ABEA 1ZSLA 1A1RA 4D7FA 3M5NA 1LHDH 2FXRA 1CHOF 1FV9A 4I8LA 2ZFRH 3BG4B 1YCPK 4X8SH 1EAWA 1WTGH 2BXTH 2I6SA 4FUFA 1QA7A 4B2CA 4Q80A 3UWIA 1XVMA 1S0RA 3ZYDA 1K1IA 5C2ZA 1C5OH 4X6MA 1XUGA 4UONA 1FMGA 1ZLRA 5PTPA 2WPIS 2ZPRA 4ZROA 1O2YA 1HFDA 1NU9A 1IQJA 2THFB 2AIQA 4YOIA 3DD2H 1KYNA 2ZGBH 1B5GH 1VZQH 2B9LA 1YPEH 5DO4H 1O32A 1XUKA 4H42U 1IQKA 4AFUA 1QURH 1TPPA 1UVUH 2AS9A 2EC9H 2VIPA 1HAVA 3A85A 4NZLA 1OWKA 1FZZA 1V2LT 4HI3A 1O33A 1YYY1 3RMOH 3BTDE 1FY3A 1AGJA 1MAYA 2ZU1A 3T25A 1THRH 1HRTH 3SUEA 1GMHF 1Q3XA 4X1RU 2V35A 1SQOA 2ZCHP 1BHXF 1EUFA 1O5FH 1O3OA 1HUTH 2R2WU 1N8OC 4VGCC 1KDQB 1EOLA 3MNXA 4O3UA 3EE0B 3LGTA 1BBRK 1AKSB 2BY7X 1NROH 1BTXA 4MNVA 1OWJA 1SFIA 1GJDB 5IDKA 3F1SB 1DVAH 5GCHF 1GMCF 3SORA 3HK6B 4NIYA 5JBTA 1O2KA 2FX4A 3MNBA 1SVPA 1TNIA 3A81A 2FLRH 2XC0A 5C1UA 5I46H 2C3SA 3M5OA 1UTKA 3PLPA 2QIQA 5CMXH 1BQYA 2VVCA 1P02A 1TONA 1QRXA 1UVTH 3A7ZA 2VIOA 5FPYA 1T8NA 3QN7A 1MQ5A 1QFKH 1O2RA 1C2KA 1P2MA 1ESAA 4X0WU 3VB6A 2ANMH 1IQFA 1EZXC 4OGYA 1WQVH 2H5DA 3RLYH 3LH1A 2UWOA 2VWNA 5LPRA 2QCYA 4ISHH 3F6UH 1TABE 3GY6A 1C5MD 3ZZ6A 4D8NA 2PGQB 1TA6A 1C1OA 3M37A 8KME2 1SHYA 1UJ1A 2AGIX 1ETRH 4AZ2B 2R3YA 3D65E 1L1NA 3LU9B 1VCQA 3NZIA 1H1BA 1HJ9A 1ZMLA 3SGQE 2BQWB 3TJNA 1RRKA 1W7XH 3VGCB 5GJ4B 1TRYA 2BD8A 4NA9H 2BLQA 1QBVH 2BM2A 4JCNA 4K3JA 2V6NA 4A6LA 2PKAB 1G30B 3SOSA 1PQ7A 1PPFE 4X2VA 2V3OH 1KDQA 1BHXB 1PJPA 4RSPA 3PYHA 1O35A 1VR1H 3A7WA 2A7HA 1RS0A 1ZR0A 1IHTH 4NIXA 2WPKS 2XBXA 3F9EA 3PO1C 4AB8A 1BCUH 1Y5UT 2DUCA 4FUIA 4UFFH 1QGFA 4UFDH 1DWCH 1V2VT 4WXIA 1EAUA 3PMJA 1N6XA 1FDPA 1W11U 3GY4A 1F92A 1DY9A 3A7VA 1O3DA 1UTJA 3SV9A 1K1PA 5K0HA 1B0FA 1GI9B 4ESTE 1TX6A 2GMTC 2VIVA 1BTWA 1CBWC 2PGBB 1DSUA 1GI3A 1DY8A 2ZTZA 2VIQA 2Y5FA 1DSTA 2BD4A 2BVSH 3K6YA 5FHTA 3SJ8A 4B2AA 1DDJA 4K60A 2VIDA 4CRFA 1O3HA 2K1QA 1TRNA 2FWWA 2GGVB 4HTCH 5C3NA 1G36A 1TNGA 2ANYA 3HGPA 1K1LA 2ANKH 1QY6A 3RXLA 2XTTB 4B1TA 2FO9A 1UCYE 1QJ1B 2ZHQH 5T6FA 4PROA 4Q7XA 1K22H 1ZTKA 2BX3A 2H5CA 2FLBH 2OC1A 5L6NH 5EODA 4YOGA 4H4FA 3L6PA 5A8XA 1BZXE 4GVUA 2GZ9A 3E90B 1O5DH 1QA0A 3AVZA 1E37B 5AF9H 2FX6A 1LPKB 2PKAA 4JZDH 2A31A 2ZHFH 3T2NA 1EKBB 1A46H 3UWJH 1NRPH 3GDUA 3RM2H 1GJCB 2A45B 1J16A 1TNHA 1DS2E 3GCTF 4BAQB 1EP5A 5HM2A 1MCVA 5LPFA 3LGUA 3KF2A 2TPIZ 2Z9IA 5GIBA 5DG6A 2PV9B 2FOCA 2G00A 2ZGHA 5C1YA 3MO9A 1SGFG 3PLKA 3K9XB 1H9IE 2FOAA 1TPSA 2VNTA 5AFYH 3IITA 3BTQE 3LONA 2JETC 4MPXA 1S5SA 1MTWA 3ATMA 1DITH 1T8MA 2C8XB 4CRAA 1HJAB 1ESTA 4OS6A 2YOLA 4Y79A 1XXFA 2H6MA 1JXPA 2ZQ1A 1UTQA 3OYPA 5FAHA 2QC2A 1HAHH 1GVZA 3BTEE 5E2OA 1S6HA 3ENSB 1F0SA 1DUEA 1SQTA 1D6WA 2SGQE 4I32A 1DUAA 2C8WB 2P95A 3NWUA 2FMJA 3E91A 4DJZB 1TAWA 1EP6A 1TPAE 2Y82A 1GJAB 2JH5D 1G37A 1TPOA 3UR6A 2ZU5A 5DP4A 2TIOA 1FPCH 4JZIA 3E0NB 2A5IA 1DT2A 2CV3A 4UE7H 2P16A 2Z6BD 3M61U 1BDAA 1S81A 1VGCC 1VITF 3DHKH 1O36A 2BOKA 1YF4A 4X8TH 3OTJE 2VH6A 4K8BA 4ZKNU 2PKSB 5DP5A 1YBWA 3SU1A 3ZVGA 4OS5A 3MH6A 3SUGA 4KGAA 2FTLE 1INCA 2BB4A 1G2LA 2TGTA 1AWHB 4KELA 3PV4A 1O31A 1V6DA 2V3HH 3C27B 3KNXA 1JWTA 1TNLA 1O38A 2HOBA 1TRMA 3MNCA 1O5AB 4D9RA 1UTMA 2BZAA 1YPHC 1C1TA 1TWXB 1O2SA 3U8TH 4BXWA 2OP9A 4GCHG 2GD4B 1E36B 1IQGA 1KXCA 1RTKA 5HGGA 1WQSA 2AERH 1S6FA 1IAUA 1SGNE 1DM4B 7GCHG 1J8AA 2TGAA 2XNIA 2TGDA 5HMAA 4D7GA 5IYTA 3RU4D 1ZMNA 4CH8B 5C67A 1AUTC 4OS4A 2XXLA 4RKOB 2ZU4A 3E8LA 1BTZA 2W3IA 3RXCA 4AX9H 3I78A 1O2OA 2WPMS 3ITIA 5L2YH 3BTME 1C5SA 1EPTC 1O2MA 4WF8A 1HAOH 3DT0H 2Y81A 4GPGA 3O8CA 1TE0A 2KAIA 1J9CH 3GICB 1FLEE 3BEUA 1QBOA 1CGJE 4FUDA 1F0TA 5DP7A 3F9GA 4IGDA 4DIIH 2A4OA 1F0RA 2H1UA 1GHVH 1ETTH 1EJAA 2HRVA 2FYQA 1BIOA 1MTVA 1ELVA 1QCPA 4CREA 2ZDMA 1C4U2 1TX7A 2W5EA 1GWAA 4NFEA 1HGTH 4YZUA 1OX1A 3VB5A 2NU3E 1LVYA 4XOJA 1C9PA 1FI8A 2VJ1A 3M7QA 3PMHB 1P2KA 3RC5A 2ZP0H 3HKJB 3A89A 4HFPB 3F9HA 3SI4H 1VCPA 5DP6A 1DWBH 1K1OA 2XC5A 3RXSA 2WPHS 2J92A 2XWBI 5FXLA 2IJOB 2A5AA 1FN6A 4BOHA 5EQRA 5ABWA 3UOUA 2VU8E 4IN1A 4CHAC 2PWXA 4TWYA 3MH4A 2AGGX 3TK5A 4FU7A 1JOUB 1L2EA 2Z94A 1ELFA 1P57B 4OS7A 2QA9E 2TGPZ 3MH5A 3MU5A 1O5EH 1BRAA 1FY1A 2ALVA 3SNBA 3LT3A 1NO9H 1PQ5A 4IN2A 4ZKSU 2BYAX 1TGBA 3SNCA 3T26A 2A7JA 4AOQA 2RDLA 1ZGVA 1NESE 3MTYA 1TMUH 5LPEA 4U30A 4MTBA 4WMDA 2Y7ZA 1PPHE 2P3TB 3TH3H 4BAOB 4ZXXH 3UFAA 4ZH8A 2B0FA 1GBHA 3LGVA 5F8TA 3VB7A 5GXPA 1TQ7B 3QX5H 3A80A 2CMYA 4IS5A 1CVWH 4UD9H 1E0FD 3OU0A 4XE4A 3A8DA 1MAXA 1GMDG 1O2UA 2BDAA 3TVJB 2JKHA 7ESTE 2GX4A 1FNIA 1TGSZ 3A8AA 4BXSA 5AVDA 2HWLB 2I6QA 1CA0C 1P3CA 2J38A 1C5RA 2SNWA 4TY6A 1P10A 1AQ7A 1V2JT 2PUXB 3QK1A 2ZU3A 1XX9A 4GLYA 3LGIA 2F91A 1GHXH 3RP2A 4XSKU 1AFEH 3S9BA 3E1XB 3ZZ9A 3EDXB 1TFXA 1SG8B 1G9IE 5EU8A 2XWAA 2JH6D 1DWDH 4NSYA 4FUBA 2BDHA 5FBEA 1ZSJA 1GGDC 1ZYOA 4ZAEA 1W3CA 1A4WH 3KGPA 1O5CB 2WYJA 2CN0H 2FOFA 3MU0A 2TRMA 4XDEA 1HB0B 1O3MA 1OOKB 1LKBA 1PQ8A 1GG6B 2WV4A 1ZGIA 2A7CA 1YGCH 3SJKA 1SHHB 5ESTE 2XBYA 1B7XB 3TJUA 1ARCA 2WV5A 5TCAA 4F4OC 4WXVA 1YP9A 1G3CA 4KTUA 3PTNA 3ZV9A 4AYVB 2O8TA 2STAE 3BTHE 1QRZA 2ZC9H 5T3HA 1GI6A 1UVPA 1SGDE 3Q3YA 1CSOE 4Y8YA 1RIWB 3RXKA 1P9SA 3LOXA 5A0CA 1ABJH 1HXEH 4B2BA 5F6MA 2BDGA 4X2YA 3RC6A 1ANCA 3LGYA 3ZVFA 3SJ9A 2VWMA 4X6OA 1UVOA 4TPYA 3SV8A 1SGQE 2F9NA 1SLVB 2DE8A 2XRCA 1AFQC 4B75A 2H9HA 1GI8B 1LHGH 3PB1E 4I7YH 4X8UH 1WV7H 1PPZA 2QXIA 1EZQA 1BTPA 3OY6U 1Y5BT 2FOEA 2BMGB 1PPGE 1TGNA 2R0LA 4NA8A 2BX4A 5ETXA 4Q7YA 5K7RA 5E0GA 2F9UA 4X8VH 4UEHH 4ZUHA 3UY9A 1V2NT 1ZHMA 4ZHMU 1AD8H 1O3BA 1P2JA 2ZU2A 3M5LA 1Z6JH 4MLFB 2ZHEH 4AB9A 1BJUA 3TGJE 2B7DH 1SC8U 4X1QU 1UK3A 5CHAC 1K1NA 2BY5X 1A5IA 1QB1A 2XYAA 3SO3A 1CT4E 1X7AC 3RXTA 4NSVA 3B8JA 1SMFE 1VJ9U 2AH4X 1GHBG 1RTFB 1SFQB 3GCNA 5JB9S 2F9BH 2UUFB 2NU4E 1V2KT 5BRRE 1LPGB 2ZHDA 1Y8TA 1GJ6A 1P2OA 4UFGH 1RGQA 2D2DA 8ESTE 3EYDA 1ZTJA 1OYQA 1YPJH 1N6YA 3V3MA 1KSNA 2Y6TA 4TY7A 5EXNA 3SV6A 2ASUB 3OY5U 3RXQA 4JYTA 1A61H 1DPOA 1SGIB 2FI4E 2HLCA 3BG4C 1AWFH 3SI3H 1C5PA 1AVGH 1SGTA 5F8XA 3FP6E 3HK3B 1G3BA 2ZTYA 4AN7A 1W13U 2BDIA 2VWLA 1LDTT 1CE5A 1D6RA 1Q31A 3WY8A 1BMMH 5FPSA 4CR5A 4YT7H 1TOCB 3TH4H 1FPHH 4WMFA 2ZIQH 2J9NA 1FQ3A 5J4SA 3SN8A 1EXFA 2FDAA 4GCHF 2ZFSA 4ABDA 5EOKA 2P8OB 1P2QA 3VXFH 2OCVB 5CE1A 3PMBB 2FEQH
chains in the Genus database with same CATH superfamily
4TPIZ 1GCDA 2SGAA 2H9EH 1UO6A 1GHAG 5JBCS 3ATLA 1FAXA 4Y76A 4BNRA 1S85A 1E35B 4Y10E 5HIZA 3URCA 1V3XA 1OP8A 3H7TA 2Z7FE 1J14A 1C9TA 1GVLA 3W1EA 1P04A 3K65B 1XUIA 4OS1A 4YOJA 1GJ5H 3MI4A 2M5TA 1LHFH 3Q3XA 4TWWA 2NU1E 1LVMA 4U32A 7KMEH 1O3EA 2FPZA 4Y7AA 1A3BH 5HXFA 3SYJA 1QRWA 4BAHB 3S9AA 2GCHF 1QQ4A 3NPSA 4Z0KA 1QB9A 3MQKC 3IWMA 3TU7H 1AB9B 1GBLA 5F53A 2ZDAH 4TYDA 4U01A 1RFNA 2OBQA 1O3CA 3RDZA 1LVBA 2A0QB 2G51A 5FBIA 1C1RA 4WH8A 2O8LA 2GDDA 3UUZA 3RM0H 2ZPQA 3A82A 1YLCA 1HAYB 1EZSC 1AN1E 1XKBC 1LQDB 4Y0ZE 3EAJA 2BD9A 3P8NA 3SUDA 3MYWA 5ESBA 4WJG2 1J17T 3BSQA 1EAIA 2ZFFH 5T6DA 2ZGCA 3B23B 4BTUB 1A3EH 1FUJA 3OX7U 2BY8X 4AG1A 5B6OA 3MNSA 1WUNH 1DXWA 1ELBA 1TBQH 2O8MA 3RXHA 4I33A 1MZAA 3QTVH 2UUYA 3LJJA 4FUCA 4I8HA 3BTWE 4DIHH 1XUHA 5DKMA 1NN6A 3SU2A 3MWIU 1C1SA 2Z9LA 2RCEA 1V2MT 1SGFA 1TX8A 2BVXH 1L4ZA 5E0JA 1AO5A 1ZPZA 1W14U 2A5KA 1LCYA 1K2I1 1QL7A 2BOHB 2VINA 5DP9A 4LZ4B 4LXBH 4MNWA 3DA9B 2A32A 5EW2H 2ZGJA 2XCFA 3P92A 5EQSA 1SBWA 4KKDA 3BG8A 1S83A 1TOMH 1QTFA 1XMNB 2Q1JA 1XUJA 1KLIH 2SGDE 3T28A 1W7GH 4XBDA 2Z3CA 1O3JA 3UNRA 4BANB 4KTSA 5C5OA 6GCHF 3ZZCA 3Q00A 2HNTF 5AHGH 2BD5A 3U8RH 4DCDA 3RXRA 2FYRA 1C5NH 1O5GH 1NS3A 3P8FA 2H9TH 1IQIA 4NWKA 3TJVA 1HJ8A 3RU4E 3AW1A 1MKWH 3SW2B 1H8DH 1AI8H 3S9CA 5F03A 1T32A 3VGCC 4BTTB 1YPMH 2OC7A 1GI1A 1SLUB 1Z8JB 4FU8A 1ETSH 4JK6A 4NWLA 1ZHRA 1EB2A 1Y3VA 2ZFQH 3P70B 4YT6H 2JDID 3ZVAA 2VBCA 2YNAA 1F0UA 4KP0A 4NCYA 4IC5A 1UCYH 2OC0A 1JIRA 5C1XA 4ASHA 1JRSA 4DVAU 1F5LA 1UHBA 3UR9A 1TQ0B 3A7XA 3RC4A 2G55A 3D49H 4ZHLU 3SU3A 4A92A 4YLUA 2O8UA 3ATKA 3TNTA 4AFZA 2ZF0H 2OQUA 2OXSA 2FOMB 2ZECA 1WTHD 1ZZZA 1C2FA 5A8ZA 4OGXA 1CHOG 1OYTH 3N7EA 1ELGA 2A2QH 2A4GA 2EA3A 1AE5A 2FI5E 1G2MA 4JYVH 1PPBH 6CHAB 4RN6A 2P93A 4DGJA 3DSPA 2AFQB 4AYYB 1CT0E 4UFEH 2BQ7B 3LH3A 1IQHA 5EPNA 5JPMH 1YCPH 1BRUP 2WUBA 2BLWA 1C2DA 2AGEX 1F5KU 1Z8GA 2ZZUH 4I8KA 1DICA 2CF8H 4BAKB 2BD7A 3L33A 1AZZA 4Y11E 4B73A 1DANH 1O5BB 1CHGA 1Y5AT 1BUIA 1FJSA 2PSYA 1GI7B 1K21H 3N7OA 1NY22 1GDQA 4GUXA 5EXMA 3BTKE 3M5MA 3Q3KA 3BV9B 1ESBA 1ZHPA 1ELCA 3GCHB 3STJA 2ESTE 3NK8A 3BF6H 1P03A 3ZVEA 3SQEE 2KAIB 2G5VA 1O3FA 1SR5C 1T8LA 1D3DB 4P00A 3RXEA 3RXDA 2QF4A 2C4FH 2G52A 4YTAA 1YPHE 1C1PA 3GYMA 1W0JD 1CU1A 2OC8A 1GHZA 1IQEA 4IC6A 1CGIE 2A4RA 1KXDA 1DWEH 1BBRE 3GY3A 3SU5A 3M3TA 2A4QA 3GY8A 1GMHG 1O2QA 1QHRB 4SGBE 2F9VA 2FOHA 3KCGH 1BTHH 4B71A 3FANA 2DE9A 2VGCB 1Q2WA 1WCZA 3Q77A 4E7NA 4X2WA 1BTYA 1FIZA 2B5TB 4Y71A 2IOTA 1HLTH 1BBRH 1BMLA 2Q6GA 1YY3A 5GCHG 5JBBS 3RLWH 1F5RA 3MO6A 2EQNA 1SGEE 5HYOA 5JBAS 1GCTB 1UVSH 2VWOA 5T1VA 1FN8A 2R2MB 1D9IA 2ZPSA 1EOJA 1GDUA 1KXFA 1BMNH 2AEIH 3TGIE 2A2XH 1GVKB 3SZNA 2Y5HA 4A1VA 2ZDNA 2BY6X 3ZZDA 1C5QA 3PWCA 2WPLS 2ZCLP 1W10U 1HJAC 1M9UA 2R3UA 2PHBA 4XFQA 2EI6A 4A7IB 3GY5A 3M3VA 4FU9A 4Y0YE 3KN2A 1P05A 1C1WH 1SGPE 3CP7A 3GISB 1HAIH 3S7HB 1MTNB 2BXUH 2GKVE 3TH2H 3A83A 2CGAA 1ELDE 1KLTA 2XBWA 2ZFTA 1TNKA 3A7YA 3WW7A 4CH2B 2LELA 2BHGA 5A0BA 1PYTC 4LOYH 1PFXC 1SB1H 4K1EA 1BT7A 3QTOH 2ZKSA 4X1SU 3CS7A 1D3TB 3PLBA 3DFLA 4ABAA 1T8OA 2HNTC 4HZHA 1SOTA 1MU6B 1RD3B 4O3TA 2W7SA 1WU1A 1NRQH 2GTBA 3DSOA 1K9OE 2ZQ2A 1W2KH 3JZ1B 2RFKC 4GSOA 2FOGA 2CHAB 2BVRH 3GDSA 3QWCH 1L0ZA 4K69A 2PKSC 3MHWU 4CRGA 5E2PA 1C2EA 1MQ6A 4RKJB 1GHAF 1XKAC 5EG4A 1EQ9A 2ZDLA 1O3AA 1P12E 1JMOH 1EAXA 3MMGA 5DK1A 1Z1JA 3LPRA 1ZJDA 2FESH 3A87A 3VEQB 3NUMA 1GBJA 1SGYE 3U69H 1TGTA 4CRCA 5DP3A 1QJ6B 1HBTH 4BAMB 1TNJA 3ZZ4A 4ISIH 4K5ZA 3M7TA 2Z9GA 1T7CA 1ACBE 2XCNA 1Y3UA 2SGEE 1UTLM 3PV2A 4ABGA 1T4VH 4YLQH 3SBKA 1AVXA 4MG3A 3B9FH 2UWLA 1A2CH 2CXVA 3RXOA 1C1QA 1NFYA 2GDEH 5BPEA 1N1LA 5C5NA 5H4IB 1UMAH 1C1UH 1OWEA 1Z8IB 1HV7A 1GBMA 3GY2A 3RXVA 1ID5H 1UK4A 5LH8A 1G3EA 1AU8A 1RXPA 1O2XA 2GCTB 2FI3E 1LKAA 3ZZ3A 1MBMA 4RT1A 3TK9A 1JIMA 4WH6A 1D3PB 1P0SH 1C5UA 2PLXA 3SGBE 4ZMAH 2F9OA 3EA7A 1QNJA 3KQ5A 3U98H 1VITH 1ANDA 5B6LA 1UK2A 2LPRA 4ABFA 2B8OH 2ZA5A 3FP7E 1QL9A 2QXJA 4NA7A 4FUGA 3GDVA 2OUAA 3T27A 1PYTD 4WMEA 1A0LA 1SOZA 3BTTE 4D9QA 3KQBA 2UWPA 1AE8H 2BTCE 5LGOA 2ANWA 3CS0A 4ABHA 1HPGA 3GCOA 4Q2KA 4JZEH 3A84A 8LPRA 3PMAB 4CR9A 1OWHA 5A8YA 3MU8A 4INHA 1BB0B 1H9LB 3U1IB 5FCKA 4ZKRU 3GCTG 2Y7XA 4ABBA 2OTVA 1SLWB 2G5NA 4RI0A 2EY4C 1ZPBA 3BEFB 1H8HD 3ODDA 4XRNA 1P06A 3H7OA 2YNBA 1EB1H 1ORFA 1WOFA 2G4TA 3LKWA 2FODA 3O8DA 3UOPA 1SSXA 4JZ1A 1HIAB 3V12A 3KL6A 3FP8E 3MU1A 1AZ8A 1HAXB 4CRBA 3SJIA 4DG4A 3PWBA 5JDUB 1U6QA 2P94A 4FVDA 4DOQA 1CQQA 4R8TB 1P09A 2FM2A 4JYUH 1UCYK 5CHAB 1FXYA 4I8JA 2FOBA 3SV2H 4ZXYH 1HCGA 1O37A 1W0YH 8GCHG 2WV9A 3QZRA 1N8OB 4VGCB 1V2ST 1O2JA 1QQUA 4H6TA 1C2LA 1KXBA 1YLDA 3ATIA 4NFFA 4GHQA 2QF5A 2OLGA 3MFJA 4MVNA 3AK5A 2J34A 3O8BA 1S82A 1W0KD 3LC3A 3UREA 4AFSA 2ALPA 2PSXA 3RU4T 1Z8RA 2XC4A 3BEIB 3MH7A 1HDTH 1H4WA 2XBVA 1MUEB 2RG3A 3PROA 3QUMP 1A0JA 2WINI 1P2NA 3H09A 4MNYA 1O2IA 1O2NA 1Z7KA 1A5GH 1AMHA 2HVXA 1FONA 5L2ZH 1IOEA 1J15A 1O34A 1ELAA 1ZMJA 4F49A 1NT1A 4M7GA 4Y8ZA 6LPRA 2P3UB 3I29A 1S0QA 3SJOA 1HAZB 3HPTB 1VITG 2CF9H 3VG8A 1UTPA 2QF0A 1Y3YA 4A5TS 5FX6A 2ZDKA 1SPJA 4AGKA 4NGAH 4INKA 1L4DA 4FVBA 3Q76A 1C2MA 1OP2A 3F3BA 4MPWA 1W0ZU 4YESB 1C5XB 1WDIA 1GBDA 4NIWA 1HIAA 2Z9JA 3H5CB 3PM3A 4GAWA 4Y8XA 3KIDU 1L1GA 4SGAE 5TJXA 1GI0A 4QT8C 1O3KA 1RTLA 3U9AH 1GBFA 1OP0A 1LHCH 1O3PB 4O97A 3ZZ7A 1EJNA 2D26C 1F7ZA 2J98B 4ISLA 1C4Y2 2ZWLH 2SGPE 1GG6C 1LVOA 1GJBB 1XM1A 4B74A 3OFND 1FY8E 4O9VA 3ZVBA 1MMJN 1QIXB 5FX5A 9ESTA 7LPRA 2GT7A 1C1VH 2HVYB 4BTIB 4ZHAA 3TNSA 1Z6EA 2ULLA 1DX5M 2KFWA 4X1PU 1GL0E 1KY9A 2WHXA 1WAYB 1RIWC 3PO1B 5C20A 1WYKA 5J4QA 1IHSH 5DPAA 1THSH 2PR3A 1LQEA 1K1JA 3TLOA 3FVFB 1NZQH 1SI5H 3ZVCA 1NU7B 5DGJA 2KR7A 1EJMA 4AGJA 2AMPA 3SU4A 1D4PB 1KLJH 5AFZH 3W95A 1DE7H 1Y59T 1Z1IA 1ZTLA 4FUJA 5G4BA 1ANBA 1NRSH 2BD3A 7GCHF 3UPEA 4KTCA 1GDNA 3ZVDA 1AIXH 3P8GA 3SU0A 5EQQA 2GMTB 4HGCA 1KXEA 3U1JB 1CBWB 5C17A 4A1XA 5DP8A 4DURA 1EASA 1TALA 3G01A 1C5TA 4JK5A 1BMAA 4IMZA 3SHCH 2G4UA 5HKKD 1E34B 3N99A 3ZIAD 1NPMA 1TLDA 3SUFA 5A09A 2QGRA 4ABJA 5L30H 3M3SA 3BIVH 4IMQA 2QYIA 2Z3DA 1HAPH 5HIYA 1BTUA 3BTFE 3KQDA 1C5ZB 3ZZ8A 1YCPM 2Z3EA 5EPYA 2ZHWH 2FS9A 1QBNA 2J98A 1DFPA 1NFWA 1OXGA 1UHBB 2HALA 2HPPH 1HNEE 3V0XA 1SGRE 1AY6H 2QF3A 2GV7A 3EQ0H 1GBAA 1TMTH 1UTOA 2ILNA 1GBEA 4WVPE 3EA8A 1GI5A 1XVOA 1C1MA 5EW1H 4O03A 3VXEH 1MTUA 3VB4A 2Y80A 1AKSA 2BDBA 1FY5A 4MPUA 1O2TA 4H6SB 1GI2A 1UW7A 3SQHE 5F8ZA 3RMLH 2RA3A 1XUFA 1MKXH 1O3IA 1H8IH 1SQAA 3OAAD 3ELAH 4GHTA 1D3QB 3S69A 3HGNA 3F2FA 3OEHD 3QO6A 1C2IA 1TBZH 1QR3E 4K2YA 2P8OC 2WYGA 4ISOA 5TCCA 1RJXB 1C5VA 1G32B 5GWZA 4UDWH 1CA8B 3T62A 2BQ6B 2JETB 2SGFE 3KEEA 1GBTA 2EEKA 3A7TA 2NU2E 5I25A 3SNEA 3K2UA 4B6FA 2AIPA 3RXBA 1THPB 3ATWA 1JRTA 2W26A 1E38B 2VIWA 2W3KA 1KXAA 5A2MH 3UNSA 2AYWA 3SNAA 3TGKE 2AHME 1GBKA 2GZ7A 4Q63A 1V2UT 2CK3D 3U8OH 1IQLA 1G3DA 2IJD1 1CO7E 5C0UA 2ZNKH 1UTNA 3WWFA 1TGCA 3AW0A 4E05H 1MCTA 2ZO3H 4E7RG 2W6JD 3V13A 3SU6A 1O2PA 2WSSD 3TIUA 1GJ9B 1QL8A 2QAAA 1AB9C 4J2YB 1O2WA 4FUEA 1V2OT 1BRCE 1C1NA 1GMDF 5E8EH 3ESTA 1OSSA 2FS8A 1P01A 1MD7A 1XXDA 1S84A 3P95A 4DY7B 1NFXA 3C1KA 9LPRA 2QN5T 2D8WA 3MOCA 1VGCB 4AORA 3RXFA 1O39A 1TA2A 3FKSD 3M35A 2IPHA 2HLDD 4YO9A 4Q7ZA 2KCPA 3EA9A 3A88A 2OBOA 2R9PA 2SFAA 4JZFH 1PPCE 1C2HA 3R0FA 2PUQH 5SGAE 2OD3B 2ZTXA 4X6NA 4AC9A 1K0HA 4B76A 3S0NA 5FPTA 4CRDA 4NG9H 3MO3A 1GBIA 3VB3A 1ABIH 1ZPCA 3D62A 2KCOA 1NTPA 2HPQH 1T4UH 1OKXA 1VCWA 3HKIB 4K8YA 3JZ2B 1OS8A 4IW4E 4F55A 4I8GA 1GBCA 4X6PA 1YPGH 3F2GA 3RXPA 5FCRA 3FZZA 1O3GA 2F9PA 3O8RA 2NWNA 4Z6AH 2L6OA 1PPEE 1K28D 2NU0E 1DLKB 1BA8B 3NXPA 3OSYA 1NFUA 4MDSA 1EZUC 2FP7B 1Y3WA 3ZV8A 8GCHF 1MU8B 1LTOA 1H8ED 4E06H 3QZQA 1WBGB 3ZYEA 4XBBA 2GP9B 1KMHB 3LC5A 1HYLA 1V2RT 5EIYA 2SNVA 3E16B 3FZDA 5CHBA 3RXMA 2Y5GA 1HAGE 1EPTB 3LDXH 1MD8A 1GHYH 3CNRA 3NKKA 4ACBA 1TBRH 1DLEA 2BLVA 2C8ZB 1ELEE 4X1NU 5EJ1A 4RT0A 3RXJA 2G8TA 1GJ8B 5GPIB 3R3GB 1F2SE 2IPQX 3F9FA 2ODQA 2ZEBA 3HATH 1ZSKA 2VB0A 1TMBH 2UUJB 3KQCA 1OWDA 2RA0A 3P6ZB 3RXIA 2IN2A 4ASUD 1FY4A 1YLNA 2FTMA 2ZFPH 1BMFD 2QXHA 3NCLA 2BDCA 1AUJA 1ELTA 1SL3A 1YC0A 3KHVA 2QXGA 1C5LH 2J95A 1COWD 2JH0D 1GMCG 4MQAA 2AMQA 3AAUA 2HNTE 1ZRKA 5KECA 2F83A 3L3TA 1A5HA 3DSGA 6CHAC 3VPKA 4NZQA 3SNDA 3ZZBA 1SGCA 1V2PT 3PRBA 3A86A 1W12U 3GYLB 5GDSH 1MBQA 2BZ6H 1GHBF 2ZGXH 4FXGH 3RXGA 4CHAB 1LMWB 1BITA 1YPLH 3M7UA 4FETA 5E0HA 4J1YA 3TITA 3P17H 1EX3A 1NM6A 2GZ8A 4INLA 2HGTH 4ZKOU 3ZZAA 4AG2A 3DCLA 1P8VC 1O30A 3QGNB 2A1DB 4IBLH 3GCHC 3OEED 3VFEA 5JYIA 1HXFH 1NRNH 1P9UA 2FZZA 3KYGA 2BY9X 2PTCE 2GVFA 4ABIA 2GV6A 4YM9A 1VJAU 2J4IA 1ZJKA 2BD2A 3STIA 1Z71A 2LP6A 2C90B 3V7TA 1GL1A 1EPTA 2FIRH 4AFQA 3FAOA 4CBOA 5DJ7A 3TK6A 1AVWA 1B0EA 1MTSA 3E6PH 3UIRA 2UUKB 2ZI2H 2P59A 1C2JA 2GCHG 1L1JA 4D76A 4THNH 1O2ZA 3URDA 2VVUA 1V2TT 3UQOA 3IG6B 1GPZA 1GI4A 4R0IA 3AASA 1BOQA 2ODPA 2P3FH 1CT2E 1TIOA 3BIUH 1KTTB 2STBE 2VGCC 1YPKH 2VVVA 3QLPH 3T29A 2YMSB 4MNXA 2ZG0H 3EGKH 4DW2U 1CA0B 4JMYA 3FOAA 2BDYA 1W8BH 3I77A 3D23A 3UQVA 3BTGE 4XBCA 2OQ5A 1P11E 2EI8A 2KCYA 2C93B 1C5WB 1GCTC 3K6ZA 4FUHA 2AMDA 4OS2A 4Q4LA 2Q6FA 5CDFE 3AAVA 3LJOA 5HM9A 2O9QA 3RMNH 2W7UA 3UNQA 4X2XA 3KQEA 1WSSH 3RXUA 1H9HE 2PW8H 1V2QT 3ODFA 4K1SA 1GGDB 3LIWA 1IQNA 1O2VA 1NBME 2H2ZA 4Y7BA 1P2IA 3GOVB 1GHWH 2CJIA 2QY0B 3T5FH 3W94A 4WWYA 2J2UA 2WUCA 1MTNC 3E3TA 4TSFD 1ZRBA 3RXAA 3SV7A 1IQMA 4DT7B 1CGHA 1V2WT 3SGAE 2JJ2D 2O8WA 3DUXH 2F3CE 3P8OA 2ODYB 6GCHG 5JB8S 2XW9A 4ISNA 1QJ7B 1TB6H 1T31A 1C5YB 2EI7A 1MKXK 2VH0A 3RMMH 1KTSB 1EATA 3A8CA 2ZCKP 4I31A 1FIWA 3BN9A 3QDZB 1NRRH 5A0AE 4LZ1H 1A0HB 1KIGH 3A8BA 5DSFA 1BJVA 3DFJA 1MZDA 5IK2D 1AHTH 2CHAC 3PTBA 4K1TA 3UTUH 2ZDVH 1AFQB 1BRBE 1OWIA 2J94A 1O2LA 3UB0A 3QGJA 1MH0A 2Q6DA 2V0BA 2QV1A 3SHAH 2PFEA 2R0KA 1ANEA 1O2HA 2L74A 1GBBA 2GT8A 1NC6A 1P3EA 1FAKH 1QB6A 3TJOA 1YM0A 2WPJS 3TPIZ 2Z9KA 2OINA 1A7SA 1PQAA 1MKWK 2BLOA 3M36A 1HAVB 5EGMA 3FFGA 1ZOMA 4I86A 3E0PB 2M2AA 1K1MA 1O3LA 4LK4A 4U2WA 1LPZB 2D1JA 3RUOA 3F68H 4MPVA 4A1TA 2G81E 1DOJA 1O2GH 1OHHD 3CENA 1O3NA 6ESTA 1GJ7B 3KYFA 1C2GA 3ZZ5A 1ARBA 2PTNA 1GJ4H 4CBNA 1SLXB 1LHEH 2LNCA 5EXLA 1Y3XA 1JBUH 1TYNA 1DXPA 1O0DH 1YKTA 3MU4A 4WY3A 2TBSA 1E79D 2GCTC 3GY7A 1LO6A 3LGWA 4Y6DA 5T6GA 2C8YB 1OPHB 3S7KB 4NIVA 1C4V2 4ABEA 1ZSLA 1A1RA 4D7FA 3M5NA 1LHDH 2FXRA 1CHOF 1FV9A 4I8LA 2ZFRH 3BG4B 1YCPK 4X8SH 1EAWA 1WTGH 2BXTH 2I6SA 4FUFA 1QA7A 4B2CA 4Q80A 3UWIA 1XVMA 1S0RA 3ZYDA 1K1IA 5C2ZA 1C5OH 4B6EA 4X6MA 1XUGA 2V7QD 4UONA 1FMGA 1ZLRA 5PTPA 4OM9A 2WPIS 2ZPRA 4ZROA 1O2YA 1HFDA 1NU9A 1IQJA 2THFB 2AIQA 4YOIA 1FX0B 3DD2H 1KYNA 2ZGBH 1B5GH 1VZQH 2B9LA 1YPEH 5DO4H 3FO8D 1O32A 1XUKA 4H42U 1IQKA 3EE7A 4AFUA 1QURH 1TPPA 1UVUH 2AS9A 1NBMD 2WPDD 2EC9H 2VIPA 1HAVA 3A85A 4NZLA 1OWKA 1FZZA 1V2LT 4HI3A 4DT4A 1O33A 1YYY1 3RMOH 3BTDE 1FY3A 1AGJA 1MAYA 2ZU1A 3T25A 2JJ1D 1THRH 1HRTH 3SUEA 1GMHF 1Q3XA 4X1RU 2V35A 1SQOA 2ZCHP 4ZCNA 1BHXF 1EUFA 1O5FH 1MABB 1O3OA 1HUTH 2R2WU 1N8OC 4VGCC 1KDQB 1EOLA 3MNXA 3NRLA 4O3UA 3EE0B 3LGTA 1BBRK 1AKSB 2BY7X 1NROH 1BTXA 2XNDD 4MNVA 1OWJA 1SFIA 1GJDB 5IDKA 3F1SB 1DVAH 5GCHF 1GMCF 3SORA 3HK6B 4NIYA 5JBTA 1O2KA 2FX4A 2PP6A 3MNBA 1SVPA 1TNIA 3A81A 2FLRH 2XC0A 5C1UA 5I46H 2C3SA 3M5OA 1UTKA 3PLPA 2QIQA 5CMXH 1BQYA 2VVCA 1P02A 1TONA 1QRXA 1UVTH 3A7ZA 2VIOA 5FPYA 1T8NA 3QN7A 1MQ5A 1QFKH 1O2RA 1C2KA 1P2MA 1ESAA 4X0WU 3VB6A 2ANMH 3U28C 1IQFA 1EZXC 4OGYA 1WQVH 2H5DA 3RLYH 3LH1A 2UWOA 2VWNA 5LPRA 2QCYA 4ISHH 3F6UH 1TABE 3GY6A 1C5MD 3ZZ6A 4D8NA 2PGQB 1TA6A 1C1OA 3M37A 8KME2 1SHYA 1UJ1A 2AGIX 1ETRH 4AZ2B 4ACAA 2R3YA 5C94A 3D65E 1L1NA 3LU9B 1VCQA 3NZIA 1H1BA 1HJ9A 1ZMLA 3SGQE 2BQWB 3TJNA 1RRKA 1W7XH 3VGCB 5GJ4B 1TRYA 2BD8A 4NA9H 2BLQA 1QBVH 2BM2A 4JCNA 4K3JA 2V6NA 4A6LA 2PKAB 1G30B 3SOSA 1PQ7A 1PPFE 4X2VA 2V3OH 1KDQA 1BHXB 1PJPA 4RSPA 3PYHA 1O35A 1VR1H 3A7WA 2A7HA 1RS0A 1ZR0A 1IHTH 2F43B 4NIXA 3WWBA 2WPKS 2XBXA 3F9EA 3PO1C 4AB8A 1BCUH 1Y5UT 2DUCA 4FUIA 4UFFH 1QZ8A 1QGFA 4UFDH 1DWCH 1V2VT 4WXIA 1EAUA 3PMJA 1N6XA 1FDPA 1W11U 3GY4A 1SKYE 1F92A 1DY9A 3A7VA 1O3DA 1UTJA 3SV9A 2V3MA 1K1PA 5K0HA 1B0FA 1GI9B 4ESTE 1TX6A 2GMTC 2VIVA 1BTWA 1CBWC 1DSUA 1GI3A 1DY8A 2PGBB 2J97A 2ZTZA 2VIQA 3UAIC 2Y5FA 1DSTA 2BD4A 2BVSH 3K6YA 5FHTA 3SJ8A 4B2AA 1DDJA 4K60A 2VIDA 4CRFA 1O3HA 2K1QA 3PV5A 1TRNA 2FWWA 2GGVB 4HTCH 5C3NA 1G36A 1TNGA 2ANYA 3HGPA 1K1LA 2ANKH 1QY6A 3RXLA 2XTTB 4B1TA 2FO9A 1UCYE 1QJ1B 2ZHQH 5T6FA 4PROA 4Q7XA 2GJGA 1K22H 1ZTKA 2BX3A 2H5CA 2FLBH 2OC1A 5L6NH 5EODA 2XOKD 4YOGA 4H4FA 3L6PA 5A8XA 1BZXE 4GVUA 2GZ9A 3E90B 1O5DH 1QA0A 3AVZA 1E37B 5AF9H 2FX6A 1LPKB 2PKAA 4JZDH 2A31A 2ZHFH 3T2NA 1EKBB 1A46H 3UWJH 1NRPH 3GDUA 3RM2H 1GJCB 2A45B 1J16A 1TNHA 1DS2E 3GCTF 4BAQB 4Z1MD 1EP5A 4P02A 5HM2A 1MCVA 5LPFA 3LGUA 3KF2A 2TPIZ 2Z9IA 5GIBA 5DG6A 2PV9B 2KZ4A 2FOCA 2G00A 3FN8A 2ZGHA 5C1YA 3MO9A 1SGFG 3PLKA 3K9XB 1H9IE 2FOAA 1TPSA 2VNTA 5AFYH 3IITA 3BTQE 3LONA 3F0OA 2JETC 4MPXA 1S5SA 1MTWA 3ATMA 1DITH 1T8MA 2C8XB 4CRAA 1HJAB 1ESTA 4OS6A 2YOLA 4Y79A 1XXFA 1SQRA 2H6MA 1JXPA 2ZQ1A 1UTQA 3OYPA 5FAHA 2QC2A 1HAHH 3OTPA 1GVZA 3BTEE 5E2OA 1S6HA 3ENSB 3F2HA 1F0SA 1DUEA 1SQTA 5KGOA 1D6WA 2SGQE 4I32A 1DUAA 2C8WB 2P95A 3NWUA 2FMJA 3E91A 4DJZB 1TAWA 1EP6A 1TPAE 2Y82A 1GJAB 2JH5D 1G37A 1TPOA 2KM0A 3UR6A 2ZU5A 5DP4A 2TIOA 1FPCH 4JZIA 3E0NB 2A5IA 1DT2A 2CV3A 4UE7H 2P16A 2Z6BD 3M61U 1BDAA 1S81A 1VGCC 1VITF 3DHKH 1O36A 2BOKA 1YF4A 4X8TH 3OTJE 2VH6A 4K8BA 4ZKNU 2PKSB 5DP5A 1YBWA 3SU1A 3ZVGA 4OS5A 3MH6A 3SUGA 4KGAA 2FTLE 1INCA 2BB4A 1G2LA 2TGTA 1AWHB 4KELA 3PV4A 1O31A 1V6DA 2V3HH 3C27B 3KNXA 1JWTA 1TNLA 1O38A 5DN6D 2HOBA 1TRMA 3MNCA 1O5AB 4D9RA 1UTMA 2BZAA 1YPHC 1C1TA 1TWXB 1O2SA 3U8TH 4BXWA 2OP9A 4GCHG 2GD4B 1WXRA 1E36B 1IQGA 1KXCA 1RTKA 5HGGA 1WQSA 2K0QA 2AERH 1S6FA 1IAUA 3GS9A 1SGNE 1DM4B 7GCHG 1J8AA 2TGAA 2XNIA 2TGDA 2KX4A 5HMAA 5IYTA 3RU4D 2WZQA 1ZMNA 4CH8B 4D7GA 5C67A 1AUTC 4OS4A 2XXLA 4RKOB 2ZU4A 3E8LA 1BTZA 2W3IA 4XD7D 3RXCA 3I78A 4AX9H 1O2OA 2WPMS 3ITIA 5L2YH 3BTME 1C5SA 1EPTC 1O2MA 4WF8A 1HAOH 3DT0H 2Y81A 4GPGA 3O8CA 1TE0A 2KAIA 1J9CH 3GICB 1FLEE 3BEUA 1QBOA 1CGJE 4FUDA 1F0TA 5DP7A 3F9GA 4IGDA 4M9FA 4DIIH 1YWUA 2A4OA 2OK5A 1F0RA 2H1UA 1GHVH 1ETTH 1EJAA 2W6ID 2HRVA 2FYQA 1E1RD 1BIOA 1MTVA 1ELVA 1QCPA 4CREA 2ZDMA 1C4U2 1TX7A 2W5EA 1GWAA 4NFEA 1HGTH 4YZUA 1OX1A 3VB5A 2NU3E 1LVYA 4XOJA 1C9PA 1FI8A 2VJ1A 3M7QA 3PMHB 1P2KA 3RC5A 2ZP0H 3SZEA 3HKJB 3A89A 4HFPB 3F9HA 3SI4H 1VCPA 2JIZD 5DP6A 1DWBH 1K1OA 2XC5A 3RXSA 2WPHS 2J92A 2XWBI 5FXLA 2IJOB 2A5AA 1E1QD 1FN6A 2F4LA 4BOHA 5EQRA 5ABWA 3UOUA 2VU8E 4IN1A 4CHAC 2PWXA 4TWYA 3MH4A 2AGGX 3TK5A 4FU7A 5EJLA 1JOUB 1L2EA 1VKYA 2Z94A 1ELFA 1P57B 4OS7A 2QA9E 2TGPZ 3MH5A 3MU5A 1O5EH 1BRAA 1FY1A 2ALVA 3SNBA 3LT3A 1NO9H 1PQ5A 4IN2A 4ZKSU 2BYAX 1TGBA 3SNCA 3T26A 2A7JA 4AOQA 2RDLA 1ZGVA 1NESE 3MTYA 1TMUH 5LPEA 4U30A 4MTBA 4WMDA 2Y7ZA 1PPHE 2P3TB 3TH3H 4BAOB 4ZXXH 3UFAA 4ZH8A 2B0FA 1GBHA 3LGVA 5F8TA 3VB7A 2QE7D 5GXPA 1TQ7B 3QX5H 5KEDA 3A80A 1S6LA 2CMYA 4IS5A 1CVWH 4UD9H 1E0FD 3OU0A 4XE4A 3A8DA 1MAXA 1GMDG 1O2UA 2BDAA 2K8IA 2JKHA 3TVJB 7ESTE 2GX4A 1FNIA 3N7DA 2YMSC 1TGSZ 3A8AA 4BXSA 5AVDA 2HWLB 2I6QA 1CA0C 1P3CA 2J38A 1C5RA 2SNWA 4TY6A 1P10A 1AQ7A 1V2JT 2PUXB 3QK1A 2ZU3A 1XX9A 4GLYA 3LGIA 2F91A 1GHXH 3RP2A 4XSKU 1AFEH 2RDEA 3S9BA 3E1XB 5FL7D 3ZZ9A 3EDXB 1TFXA 1SG8B 1G9IE 5EU8A 2XWAA 2JH6D 1DWDH 4NSYA 4FUBA 2BDHA 5FBEA 1ZSJA 1GGDC 1ZYOA 4F48B 4ZAEA 1W3CA 1A4WH 3KGPA 1O5CB 2WYJA 2CN0H 2FOFA 5EJZA 3MU0A 2TRMA 4XDEA 1HB0B 1O3MA 1OOKB 1LKBA 1PQ8A 1GG6B 2WV4A 1ZGIA 2A7CA 1YGCH 3SJKA 1SHHB 4TT3D 5ESTE 2XBYA 1B7XB 3TJUA 1ARCA 2WV5A 5TCAA 4F4OC 4WXVA 1YP9A 1G3CA 4KTUA 3PTNA 3ZV9A 4AYVB 2O8TA 2STAE 2KCAA 3BTHE 1QRZA 1EFRD 2ZC9H 5GNDA 5T3HA 1GI6A 1UVPA 1SGDE 3Q3YA 1CSOE 4Y8YA 1RIWB 3RXKA 1P9SA 3LOXA 5A0CA 1ABJH 1HXEH 4B2BA 5F6MA 2BDGA 4X2YA 3RC6A 1ANCA 3LGYA 3ZVFA 3SJ9A 2VWMA 4X6OA 1UVOA 4TPYA 3SV8A 1SGQE 2F9NA 1SLVB 2DE8A 2XRCA 1AFQC 4B75A 2H9HA 1GI8B 1LHGH 3PB1E 4I7YH 4X8UH 1WV7H 1PPZA 2QXIA 1EZQA 1BTPA 3OY6U 1Y5BT 2FOEA 2BMGB 1PPGE 1TGNA 2R0LA 4NA8A 2BX4A 5ETXA 4Q7YA 5K7RA 5E0GA 2F9UA 4X8VH 4UEHH 4ZUHA 3UY9A 1V2NT 1ZHMA 2J5UA 4ZHMU 1AD8H 1O3BA 1P2JA 2ZU2A 3M5LA 1Z6JH 2YMSD 4MLFB 2ZHEH 4AB9A 1BJUA 3TGJE 2B7DH 1SC8U 4X1QU 1UK3A 5CHAC 1K1NA 5C0TA 2BY5X 1A5IA 1QB1A 2XYAA 3SO3A 1CT4E 1X7AC 3RXTA 4NSVA 3PRDA 3B8JA 1SMFE 1VJ9U 2AH4X 1GHBG 1RTFB 1SFQB 3GCNA 5JB9S 2F9BH 4HG6A 3OE7D 2UUFB 2NU4E 1V2KT 5BRRE 1LPGB 2ZHDA 4FOUC 1Y8TA 1GJ6A 1P2OA 4UFGH 1RGQA 2D2DA 8ESTE 3EYDA 1ZTJA 1OYQA 1YPJH 1N6YA 3V3MA 1KSNA 2Y6TA 4TY7A 5EXNA 3SV6A 2ASUB 3OY5U 3RXQA 4JYTA 1A61H 1DPOA 1SGIB 2FI4E 2HLCA 3BG4C 1AWFH 3SI3H 1C5PA 1AVGH 1SGTA 5F8XA 3FP6E 3HK3B 1G3BA 2ZTYA 4AN7A 1W13U 2BDIA 2VWLA 1LDTT 1CE5A 1D6RA 1Q31A 3WY8A 1BMMH 5FPSA 4CR5A 4YT7H 1TOCB 3TH4H 1FPHH 4WMFA 2ZIQH 2J9NA 4YXWD 1FQ3A 5J4SA 3SN8A 3F0PA 1EXFA 2FDAA 4GCHF 2ZFSA 4ABDA 5EOKA 2P8OB 1P2QA 3VXFH 2OCVB 5CE1A 3PMBB 2FEQH
chains in the Genus database with same CATH topology
4TPIZ 1GCDA 2SGAA 2H9EH 1UO6A 1GHAG 5JBCS 3ATLA 1FAXA 4Y76A 4BNRA 1S85A 1E35B 4Y10E 3URCA 1V3XA 1OP8A 3H7TA 2Z7FE 1J14A 1C9TA 1GVLA 1P04A 3K65B 1XUIA 4OS1A 4YOJA 1GJ5H 3MI4A 2M5TA 1LHFH 3Q3XA 4TWWA 2NU1E 1LVMA 4U32A 7KMEH 1O3EA 2FPZA 4Y7AA 1A3BH 5HXFA 1QRWA 4BAHB 3S9AA 2GCHF 1QQ4A 3NPSA 4Z0KA 1QB9A 3IWMA 3TU7H 1AB9B 1GBLA 2ZDAH 4TYDA 4U01A 1RFNA 2OBQA 1O3CA 3RDZA 1LVBA 2A0QB 2G51A 5FBIA 1C1RA 4WH8A 2O8LA 2GDDA 3UUZA 3RM0H 2ZPQA 3A82A 1YLCA 1HAYB 1EZSC 1AN1E 1XKBC 1LQDB 4Y0ZE 3EAJA 2BD9A 3P8NA 3SUDA 3MYWA 5ESBA 4WJG2 1J17T 3BSQA 1EAIA 2ZFFH 5T6DA 2ZGCA 3B23B 4BTUB 1A3EH 1FUJA 3OX7U 2BY8X 4AG1A 5B6OA 3MNSA 1WUNH 1DXWA 1ELBA 1TBQH 2O8MA 3RXHA 4I33A 1MZAA 3QTVH 2UUYA 3LJJA 4FUCA 4I8HA 3BTWE 4DIHH 1XUHA 5DKMA 1NN6A 3SU2A 3MWIU 1C1SA 2Z9LA 2RCEA 1V2MT 1SGFA 1TX8A 2BVXH 1L4ZA 5E0JA 1AO5A 1ZPZA 1W14U 2A5KA 1LCYA 1K2I1 1QL7A 2BOHB 2VINA 5DP9A 4LZ4B 4LXBH 4MNWA 3DA9B 2A32A 5EW2H 2ZGJA 2XCFA 3P92A 5EQSA 1SBWA 4KKDA 3BG8A 1S83A 1TOMH 1QTFA 1XMNB 2Q1JA 1XUJA 1KLIH 2SGDE 3T28A 1W7GH 4XBDA 2Z3CA 1O3JA 3UNRA 4BANB 4KTSA 5C5OA 6GCHF 3ZZCA 3Q00A 2HNTF 5AHGH 2BD5A 3U8RH 4DCDA 3RXRA 2FYRA 1C5NH 1O5GH 1NS3A 3P8FA 2H9TH 1IQIA 4NWKA 3TJVA 1HJ8A 3RU4E 3AW1A 1MKWH 3SW2B 1H8DH 1AI8H 3S9CA 5F03A 1T32A 3VGCC 4BTTB 1YPMH 2OC7A 1GI1A 1SLUB 1Z8JB 4FU8A 1ETSH 4JK6A 4NWLA 1ZHRA 1EB2A 1Y3VA 2ZFQH 3P70B 4YT6H 3ZVAA 2YNAA 1F0UA 4KP0A 4NCYA 4IC5A 1UCYH 2OC0A 1JIRA 5C1XA 4ASHA 1JRSA 4DVAU 1F5LA 1UHBA 3UR9A 1TQ0B 3A7XA 3RC4A 2G55A 3D49H 4ZHLU 3SU3A 4A92A 4YLUA 2O8UA 3ATKA 3TNTA 4AFZA 2ZF0H 2OQUA 2OXSA 2FOMB 2ZECA 1WTHD 1ZZZA 1C2FA 5A8ZA 4OGXA 1CHOG 1OYTH 1ELGA 2A2QH 2A4GA 2EA3A 1AE5A 2FI5E 1G2MA 4JYVH 1PPBH 6CHAB 4RN6A 2P93A 4DGJA 2AFQB 4AYYB 1CT0E 4UFEH 2BQ7B 3LH3A 1IQHA 5EPNA 5JPMH 1YCPH 1BRUP 2WUBA 2BLWA 1C2DA 2AGEX 1F5KU 1Z8GA 2ZZUH 4I8KA 1DICA 2CF8H 4BAKB 2BD7A 3L33A 1AZZA 4Y11E 4B73A 1DANH 1O5BB 1CHGA 1Y5AT 1BUIA 1FJSA 2PSYA 1GI7B 1K21H 3N7OA 1NY22 1GDQA 4GUXA 5EXMA 3BTKE 3M5MA 3Q3KA 3BV9B 1ESBA 1ZHPA 1ELCA 3GCHB 3STJA 2ESTE 3NK8A 3BF6H 1P03A 3ZVEA 3SQEE 2KAIB 2G5VA 1O3FA 1SR5C 1T8LA 1D3DB 3RXEA 3RXDA 2C4FH 2G52A 4YTAA 1YPHE 1C1PA 3GYMA 1CU1A 2OC8A 1GHZA 1IQEA 4IC6A 1CGIE 2A4RA 1KXDA 1DWEH 1BBRE 3GY3A 3SU5A 3M3TA 2A4QA 3GY8A 1GMHG 1O2QA 1QHRB 4SGBE 2F9VA 2FOHA 3KCGH 1BTHH 4B71A 3FANA 2DE9A 2VGCB 1Q2WA 1WCZA 3Q77A 4E7NA 4X2WA 1BTYA 1FIZA 2B5TB 4Y71A 2IOTA 1HLTH 1BBRH 1BMLA 2Q6GA 5GCHG 5JBBS 3RLWH 1F5RA 3MO6A 1SGEE 5HYOA 5JBAS 1GCTB 1UVSH 2VWOA 1FN8A 2R2MB 1D9IA 2ZPSA 1EOJA 1GDUA 1KXFA 1BMNH 2AEIH 3TGIE 2A2XH 1GVKB 3SZNA 2Y5HA 4A1VA 2ZDNA 2BY6X 3ZZDA 1C5QA 3PWCA 2WPLS 2ZCLP 1W10U 1HJAC 1M9UA 2R3UA 2PHBA 4XFQA 2EI6A 4A7IB 3GY5A 3M3VA 4FU9A 4Y0YE 3KN2A 1P05A 1C1WH 1SGPE 3CP7A 3GISB 1HAIH 3S7HB 1MTNB 2BXUH 2GKVE 3TH2H 3A83A 2CGAA 1ELDE 1KLTA 2XBWA 2ZFTA 1TNKA 3A7YA 4CH2B 2BHGA 5A0BA 1PYTC 4LOYH 1PFXC 1SB1H 4K1EA 1BT7A 3QTOH 2ZKSA 4X1SU 3CS7A 1D3TB 3PLBA 3DFLA 4ABAA 1T8OA 2HNTC 4HZHA 1SOTA 1MU6B 1RD3B 4O3TA 2W7SA 1WU1A 1NRQH 2GTBA 1K9OE 2ZQ2A 1W2KH 3JZ1B 4GSOA 2FOGA 2CHAB 2BVRH 3GDSA 3QWCH 1L0ZA 4K69A 2PKSC 3MHWU 4CRGA 5E2PA 1C2EA 1MQ6A 4RKJB 1GHAF 1XKAC 5EG4A 1EQ9A 2ZDLA 1O3AA 1P12E 1JMOH 1EAXA 3MMGA 5DK1A 1Z1JA 3LPRA 1ZJDA 2FESH 3A87A 3VEQB 3NUMA 1GBJA 1SGYE 3U69H 1TGTA 4CRCA 5DP3A 1QJ6B 1HBTH 4BAMB 1TNJA 3ZZ4A 4ISIH 4K5ZA 3M7TA 2Z9GA 1T7CA 1ACBE 2XCNA 1Y3UA 2SGEE 1UTLM 4ABGA 1T4VH 4YLQH 3SBKA 1AVXA 4MG3A 3B9FH 2UWLA 1A2CH 2CXVA 3RXOA 1C1QA 1NFYA 2GDEH 5BPEA 1N1LA 5C5NA 5H4IB 1UMAH 1C1UH 1OWEA 1Z8IB 1HV7A 1GBMA 3GY2A 3RXVA 1ID5H 1UK4A 5LH8A 1G3EA 1AU8A 1RXPA 1O2XA 2GCTB 2FI3E 1LKAA 3ZZ3A 1MBMA 3TK9A 1JIMA 4WH6A 1D3PB 1P0SH 1C5UA 2PLXA 3SGBE 4ZMAH 2F9OA 3EA7A 1QNJA 3U98H 1VITH 1ANDA 1UK2A 2LPRA 4ABFA 2B8OH 2ZA5A 3FP7E 1QL9A 2QXJA 4NA7A 4FUGA 3GDVA 2OUAA 3T27A 1PYTD 4WMEA 1A0LA 1SOZA 3BTTE 4D9QA 3KQBA 2UWPA 1AE8H 2BTCE 5LGOA 2ANWA 3CS0A 4ABHA 1HPGA 3GCOA 4Q2KA 4JZEH 3A84A 8LPRA 3PMAB 4CR9A 1OWHA 5A8YA 3MU8A 4INHA 1BB0B 1H9LB 3U1IB 5FCKA 4ZKRU 3GCTG 2Y7XA 4ABBA 2OTVA 1SLWB 2G5NA 1ZPBA 3BEFB 3ODDA 1P06A 3H7OA 2YNBA 1EB1H 1ORFA 1WOFA 2G4TA 3LKWA 2FODA 3O8DA 3UOPA 1SSXA 4JZ1A 1HIAB 3V12A 3KL6A 3FP8E 3MU1A 1AZ8A 1HAXB 4CRBA 3SJIA 4DG4A 3PWBA 5JDUB 1U6QA 2P94A 4FVDA 4DOQA 1CQQA 4R8TB 1P09A 2FM2A 4JYUH 1UCYK 5CHAB 1FXYA 4I8JA 2FOBA 3SV2H 4ZXYH 1HCGA 1O37A 1W0YH 8GCHG 3QZRA 1N8OB 4VGCB 1V2ST 1O2JA 1QQUA 4H6TA 1C2LA 1KXBA 1YLDA 3ATIA 4NFFA 4GHQA 2OLGA 3MFJA 4MVNA 2J34A 3O8BA 1S82A 3LC3A 3UREA 4AFSA 2ALPA 2PSXA 3RU4T 1Z8RA 2XC4A 3BEIB 3MH7A 1HDTH 1H4WA 2XBVA 1MUEB 2RG3A 3PROA 3QUMP 1A0JA 2WINI 1P2NA 4MNYA 1O2IA 1O2NA 1Z7KA 1A5GH 1AMHA 2HVXA 1FONA 5L2ZH 1IOEA 1J15A 1O34A 1ELAA 1ZMJA 4F49A 1NT1A 4M7GA 4Y8ZA 6LPRA 2P3UB 3I29A 1S0QA 3SJOA 1HAZB 3HPTB 1VITG 2CF9H 1UTPA 2QF0A 1Y3YA 4A5TS 5FX6A 2ZDKA 1SPJA 4AGKA 4NGAH 4INKA 1L4DA 4FVBA 3Q76A 1C2MA 1OP2A 4MPWA 1W0ZU 4YESB 1C5XB 1GBDA 4NIWA 1HIAA 2Z9JA 3H5CB 3PM3A 4GAWA 4Y8XA 3KIDU 1L1GA 4SGAE 5TJXA 1GI0A 4QT8C 1O3KA 1RTLA 3U9AH 1GBFA 1OP0A 1LHCH 1O3PB 4O97A 3ZZ7A 1EJNA 2D26C 1F7ZA 4ISLA 1C4Y2 2ZWLH 2SGPE 1GG6C 1LVOA 1GJBB 1XM1A 4B74A 1FY8E 4O9VA 3ZVBA 1MMJN 1QIXB 5FX5A 9ESTA 7LPRA 2GT7A 1C1VH 4BTIB 4ZHAA 3TNSA 1Z6EA 2ULLA 1DX5M 4X1PU 1GL0E 1KY9A 1WAYB 1RIWC 3PO1B 5C20A 1WYKA 5J4QA 1IHSH 5DPAA 1THSH 2PR3A 1LQEA 1K1JA 3TLOA 3FVFB 1NZQH 1SI5H 3ZVCA 1NU7B 5DGJA 1EJMA 4AGJA 2AMPA 3SU4A 1D4PB 1KLJH 5AFZH 3W95A 1DE7H 1Y59T 1Z1IA 1ZTLA 4FUJA 5G4BA 1ANBA 1NRSH 2BD3A 7GCHF 3UPEA 4KTCA 1GDNA 3ZVDA 1AIXH 3P8GA 3SU0A 5EQQA 2GMTB 4HGCA 1KXEA 3U1JB 1CBWB 4A1XA 5DP8A 4DURA 1EASA 1TALA 3G01A 1C5TA 4JK5A 1BMAA 4IMZA 3SHCH 2G4UA 1E34B 1NPMA 1TLDA 3SUFA 5A09A 2QGRA 4ABJA 5L30H 3M3SA 3BIVH 4IMQA 2QYIA 2Z3DA 1HAPH 1BTUA 3BTFE 3KQDA 1C5ZB 3ZZ8A 1YCPM 2Z3EA 5EPYA 2ZHWH 2FS9A 1QBNA 1DFPA 1NFWA 1OXGA 1UHBB 2HALA 2HPPH 1HNEE 3V0XA 1SGRE 1AY6H 2QF3A 2GV7A 3EQ0H 1GBAA 1TMTH 1UTOA 2ILNA 1GBEA 4WVPE 3EA8A 1GI5A 1XVOA 1C1MA 5EW1H 4O03A 3VXEH 1MTUA 3VB4A 2Y80A 1AKSA 2BDBA 1FY5A 4MPUA 1O2TA 4H6SB 1GI2A 3SQHE 5F8ZA 3RMLH 2RA3A 1XUFA 1MKXH 1O3IA 1H8IH 1SQAA 3ELAH 4GHTA 1D3QB 3S69A 3HGNA 3QO6A 1C2IA 1TBZH 1QR3E 4K2YA 2P8OC 2WYGA 4ISOA 5TCCA 1RJXB 1C5VA 1G32B 5GWZA 4UDWH 1CA8B 3T62A 2BQ6B 2JETB 2SGFE 3KEEA 1GBTA 2EEKA 3A7TA 2NU2E 5I25A 3SNEA 3K2UA 2AIPA 3RXBA 1THPB 3ATWA 1JRTA 2W26A 1E38B 2VIWA 2W3KA 1KXAA 5A2MH 3UNSA 2AYWA 3SNAA 3TGKE 1GBKA 2GZ7A 1V2UT 3U8OH 1IQLA 1G3DA 1CO7E 2ZNKH 1UTNA 1TGCA 3AW0A 4E05H 1MCTA 2ZO3H 4E7RG 3V13A 3SU6A 1O2PA 3TIUA 1GJ9B 1QL8A 2QAAA 1AB9C 4J2YB 1O2WA 4FUEA 1V2OT 1BRCE 1C1NA 1GMDF 5E8EH 3ESTA 1OSSA 2FS8A 1P01A 1MD7A 1XXDA 1S84A 3P95A 4DY7B 1NFXA 3C1KA 9LPRA 2QN5T 2D8WA 3MOCA 1VGCB 4AORA 3RXFA 1O39A 1TA2A 3M35A 2IPHA 4YO9A 4Q7ZA 3EA9A 3A88A 2OBOA 2R9PA 2SFAA 4JZFH 1PPCE 1C2HA 3R0FA 2PUQH 5SGAE 2OD3B 2ZTXA 4X6NA 4B76A 3S0NA 5FPTA 4CRDA 4NG9H 3MO3A 1GBIA 3VB3A 1ABIH 1ZPCA 3D62A 1NTPA 2HPQH 1T4UH 1OKXA 1VCWA 3HKIB 4K8YA 3JZ2B 1OS8A 4IW4E 4I8GA 1GBCA 4X6PA 1YPGH 3RXPA 5FCRA 3FZZA 1O3GA 2F9PA 3O8RA 2NWNA 4Z6AH 1PPEE 1K28D 2NU0E 1DLKB 1BA8B 3NXPA 3OSYA 1NFUA 4MDSA 1EZUC 2FP7B 1Y3WA 3ZV8A 8GCHF 1MU8B 1LTOA 4E06H 3QZQA 1WBGB 3ZYEA 4XBBA 2GP9B 3LC5A 1HYLA 1V2RT 2SNVA 3E16B 3FZDA 3RXMA 2Y5GA 1HAGE 1EPTB 3LDXH 1MD8A 1GHYH 3NKKA 1TBRH 1DLEA 2BLVA 2C8ZB 1ELEE 4X1NU 3RXJA 2G8TA 1GJ8B 5GPIB 3R3GB 1F2SE 3F9FA 2ODQA 2ZEBA 3HATH 1ZSKA 2VB0A 1TMBH 2UUJB 3KQCA 1OWDA 2RA0A 3P6ZB 3RXIA 2IN2A 1FY4A 2FTMA 2ZFPH 2QXHA 3NCLA 2BDCA 1AUJA 1ELTA 1SL3A 1YC0A 3KHVA 2QXGA 1C5LH 2J95A 2JH0D 1GMCG 4MQAA 2AMQA 3AAUA 2HNTE 1ZRKA 2F83A 3L3TA 1A5HA 6CHAC 3VPKA 4NZQA 3SNDA 3ZZBA 1SGCA 1V2PT 3A86A 1W12U 3GYLB 5GDSH 1MBQA 2BZ6H 1GHBF 2ZGXH 4FXGH 3RXGA 4CHAB 1LMWB 1BITA 1YPLH 3M7UA 5E0HA 4J1YA 3TITA 3P17H 1EX3A 1NM6A 2GZ8A 4INLA 2HGTH 4ZKOU 3ZZAA 4AG2A 1P8VC 1O30A 3QGNB 2A1DB 4IBLH 3GCHC 3VFEA 5JYIA 1HXFH 1NRNH 1P9UA 2FZZA 2BY9X 2PTCE 2GVFA 4ABIA 2GV6A 4YM9A 1VJAU 2J4IA 1ZJKA 2BD2A 3STIA 1Z71A 2C90B