4DOQB

Crystal structure of the complex of porcine pancreatic trypsin with 1/2slpi
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
47
structure length
47
Chain Sequence
b'KPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trypsin
publication title Structure basis 1/2SLPI and porcine pancreas trypsin interaction
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 6
structure length 47
sequence length 47
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00095 WAP WAP-type (Whey Acidic Protein) 'four-disulfide core'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.75.10 Few Secondary Structures Irregular R-elafin Elafin-like 4doqB00
3NGGA 2Z7FI 4DOQB 1UDKA 2RELA 1FLEI
chains in the Genus database with same CATH superfamily
3NGGA 2Z7FI 4DOQB 1UDKA 2RELA 1FLEI
chains in the Genus database with same CATH topology
3NGGA 2Z7FI 4DOQB 1UDKA 2RELA 1FLEI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGG A;  2Z7F I;  4DOQ B;  1UDK A;  2REL A;  1FLE I; 
#chains in the Genus database with same CATH topology
 3NGG A;  2Z7F I;  4DOQ B;  1UDK A;  2REL A;  1FLE I; 
#chains in the Genus database with same CATH homology
 3NGG A;  2Z7F I;  4DOQ B;  1UDK A;  2REL A;  1FLE I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...