4DRNA

Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with {3-[(1r)-3-(3,4-dimethoxyphenyl)-1-({[(2s)-1-{[(1s,2r)-2-ethyl-1-hydroxycyclohexyl](oxo)acetyl}piperidin-2-yl]carbonyl}oxy)propyl]phenoxy}acetic acid
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 39
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drnA00
3UI5A 4MGVA 4TNSA 3LUOA 4G2PA 1T11A 5DIUA 4ITZA 4DRKA 4DZ3A 2XP9A 1F8AB 1HXVA 3O5FA 1Q1CA 1J6YA 2XP7A 3TC5A 2PV2A 2DG9A 3MDYB 3O5QA 3RGCA 1ZK6A 2LGOA 2PBCA 3CGMA 2KGJA 3O5OA 5HWBA 5J6EA 2PV3A 4ODPA 3UF8A 4LAVA 4IQCA 3VAWA 2KO7A 3PA7A 3JXVA 1ROTA 3JYJA 2ZQSA 2VN1A 4U84A 4W9PA 5GPGA 2XPBA 1P5QA 4JFJA 1TCOC 4LAWA 1D6OA 4J4OA 4ODQA 4ODLA 3IKGA 4GGQA 2RUDA 2KE0A 4JFMA 4C02B 4ODKA 3IHZA 2PV1A 4J4NA 4JFIA 2M1IA 1Q6HA 2RUCA 3NRKA 4DRMA 3TCZA 1NSGA 2FKEA 2ZQUA 1FKGA 1U79A 2MLYA 1FKLA 2MNTA 2RQSA 1FKRA 4DRJA 3KAGA 2LPVA 2LKNA 3CGNA 1PBKA 3FAPA 5HT1A 4JYSA 2XP3A 2Y78A 4QIBA 3WH0A 1J4HA 2ZR4A 3O5GA 4GIVA 1FKDA 1KT0A 1C9HA 2K8IA 3H9RB 1FKFA 3UQIA 3O5PA 5B8IC 3KABA 3UQAA 2ZQTA 5HW7A 1F40A 3O5DA 4DIPA 2PPPA 1J4RA 4DRIA 2MPHA 4DRHA 4TW8A 1R9HA 2ZQVA 3O5KA 1EYMA 3O5MA 1NMVA 1QZ2A 2PPNA 4TW7A 1W26A 4DH0A 4DRQA 5HTGA 1FJDA 2MLZA 4FAPA 1YW5A 1JNTA 4LAXA 4ODNA 4DRPA 1N1AA 2F2DA 1Q6UA 2MF9A 2XPAA 2IF4A 3NTPA 3JYMA 4LAYA 2XP8A 2Q5AA 3O5EA 2DG4A 4G50A 2KI3A 1PINA 1QPFA 2KR7A 1FKKA 2XP4A 1FKSA 3KCEA 4NNRA 4U86A 4U85A 5DITA 4DT4A 1JNSA 1BKFA 2OFNA 1FAPA 1A7XA 2L2SA 3O5LA 3UI4A 1D7JA 1QPLA 5D75A 2PPOA 4QT3A 4QT2A 3UI6A 2N87A 1FKBA 4MSPA 3O5IA 4W9OA 1D7IA 4TW6A 2FAPA 2M2AA 3EY6A 1J4IA 4R0XA 1Q6IA 5HWCA 5I98A 1L1PA 2AWGA 3KZ7A 2XP5A 1EQ3A 3I6CA 3IKDA 1FKJA 1FKTA 2RSEA 1Y0OA 4JFKA 3IK8A 1ROUA 2VCDA 2MLXA 5HUAA 5DIVA 5BXJA 1YATA 3PRDA 2M08A 3O5RA 1KT1A 2KFWA 1ZCNA 2XP6A 3KADA 1BL4A 2DG3A 4O2TA 2RURA 4FN2A 3OOBA 5HKGA 3ODKA 4W9QA 1FKHA 4ODRA 2F21A 3NI6A 3PRBA 1NMWA 2D9FA 4N19A 4DROA 3KAFA 2ZR6A 4ODOA 1JVWA 3O5JA 2F4EA 3B7XA 2JZVA 3GPKA 4IQ2A 1D7HA 1B6CA 2ZR5A 4IPXA 3TDBA 4DRNA 5HW6A 1FKIA 2ITKA 3RFWA 4TX0A 4BF8A 2RUQA 2UZ5A 4TYOA 5HW8A 3UQBA 4ODMA 1FD9A 3KACA 3KAHA 3KAIA 1M5YA 2LJ4A 4DZ2A 4JFLA
chains in the Genus database with same CATH superfamily
3UI5A 4TNSA 3AS0A 5DIUA 3WKZA 4DRKA 4DZ3A 2XP9A 2PV2A 3CGMA 5HWBA 4ODPA 4LAVA 4DWSA 4WKHA 3VAWA 2KO7A 3JYJA 3WD4A 4JFJA 3ARTA 4WKFA 1D6OA 2YBUA 4ODLA 3WL0A 3IKGA 4IT4A 1ZL1A 4ODKA 4J4NA 3BXWA 3CH9A 4S3JA 1FKLA 1D2KA 1FKRA 4DRJA 3KAGA 3WH0A 1J4HA 3O5GA 2DT1A 1KT0A 1IX5A 1E6RA 4W5UA 3O5PA 3O5DA 1X6LA 2WLYA 3FXYA 1EYMA 1QZ2A 3ARWA 5HTGA 3ARSA 2G8ZA 1YW5A 4ODNA 2F2DA 2MF9A 2XPAA 3NTPA 4KR0B 4LAYA 1RD6A 4G50A 4HBOA 2KR7A 2XP4A 3KCEA 1HJVA 4U86A 3WD1A 3O5LA 1D7JA 3G6MA 4XAKA 2M2AA 1ZB5A 3B9EA 4Q7NA 2YBTA 1EQ3A 1LQ0A 2RSEA 5JH8A 3IK8A 1ROUA 1WB0A 3GU0A 1XHGA 2B31A 5BXJA 4P8UA 2M08A 1KT1A 2KFWA 2DG3A 1LG1A 4O2TA 1GRJA 3ODKA 4NSBA 4W9QA 4DROA 1NWUA 1NMWA 3KAFA 2ZR6A 1JVWA 2WM0A 3ARRA 2JZVA 3TDBA 4IPXA 2ZR5A 4DRNA 5HW6A 3WD2A 4DWSB 2RUQA 4TYOA 3BMBA 3KAHA 3RM4A 3KAIA 1M5YA 2DSWA 4G2PA 1T11A 4ITZA 1HXVA 3O5FA 2XP7A 3TC5A 2DG9A 3MDYB 1ZK6A 2LGOA 2PBCA 3AS1A 1XRVA 1LG2A 4ZPVR 3UF8A 2DSUA 4IQCA 4ZPWR 4HARA 3ARUA 2VN1A 4URIA 4ZS6A 2A3CA 1P5QA 1TCOC 4ODQA 2RUDA 1HKIA 2O9OA 3IHZA 4LGXA 1E6NA 2M1IA 4DRMA 3NRKA 4L72B 2PI6A 1W1PA 2O92A 3AQUA 1PBKA 4JYSA 5GPRA 1E44A 1FFQA 4ZPTR 5B8IC 3UQAA 4KQZA 2WK2A 2PPPA 3CHCA 3AS2A 4DRIA 1R9HA 3O5KA 2EULA 2PPNA 1ITXA 4DH0A 1W26A 2MLZA 4LAXA 4DRPA 1Q6UA 2IF4A 2PN0A 1OGBA 3QOKA 2QF8A 3ARYA 1VF8A 4U85A 4Z2KA 2DT3A 1WAWA 4P8WA 1QPLA 4QT3A 4QT2A 2N87A 4MSPA 3ALGA 4Q22A 1W9UA 2FDMA 2FAPA 3EY6A 4MNKA 5I98A 1L1PA 3ARZA 2AWGA 1ZBKA 1OWQA 4P8VA 3I6CA 2AOSA 1FKTA 3ALFA 2VCDA 5HUAA 2DPEA 1W1YA 1E6PA 3RMEA 1ZCNA 5DEZA 4Z2LA 2RURA 3OOBA 3EIPA 4Z2IA 2F21A 3NI6A 3ARXA 3O5JA 2F4EA 4IQ2A 1HKMA 1D7HA 1EIBA 4WJXA 4WK9A 4BF8A 3UQBA 4MNJA 4ODMA 3KACA 3B9AA 2ESCA 2LJ4A 3LUOA 4Z2GA 1Q1CA 3CZ8A 1J6YA 3PR9A 3W4RA 3WD3A 3RGCA 3O5OA 2KGJA 3AROA 5HBFA 3PA7A 4L3NA 4W9PA 5GPGA 2XPBA 4WIWA 4GGQA 2PV1A 2RUCA 3TCZA 3OA5A 2ETNA 2FKEA 1FKGA 2MNTA 5DO2A 3RM8A 3PRAA 4QIBA 1KFWA 1FKDA 2DT0A 1C9HA 3H9RB 1FKFA 1JCHB 4R5EA 3WL1A 2WLZA 4WKAA 1J4RA 4AY1A 4DRHA 3O5MA 2ZQVA 1FJDA 1UR9A 4Z2JA 1X6NA 1K9TA 1HJXA 1JNTA 2F23A 3WIJA 1N1AA 3JYMA 1W1VA 2XP8A 4MAVA 1GUVA 2DG4A 1PINA 1QPFA 1FKSA 5DITA 4MPKA 1HJWA 3B9DA 1JNSA 1LJYA 2OFNA 1FAPA 3UI4A 2L2SA 3ARVA 1LL4A 2DSZA 4W9OA 1FKBA 5DF0A 4Z2HA 1E9LA 1J4IA 1Q6IA 5HWCA 4DWSC 2IUZA 3KZ7A 2XP5A 3ARQA 2DT2A 1CTNA 1FKJA 1Y0OA 4S3KA 3B8SA 5DIVA 4MTVA 3O5RA 2XP6A 3KADA 1BL4A 1ZBVA 4FN2A 1O6IA 1HKJA 3WQVA 5HKGA 1FKHA 4ODRA 4N19A 3PRBA 2D9FA 1GOIA 4MNLA 3B7XA 3GPKA 1SR0A 2A3EA 1FKIA 2A3BA 2ITKA 4TX0A 1JNDA 4JFLA 3RM9A 4MGVA 2G41A 1E6ZA 1EDQA 4DWSD 2OLHA 1F8AB 1UR8A 1WNOA 3O5QA 5J6EA 1SYTA 2PV3A 3ARPA 4QZVB 3JXVA 1ROTA 2DSVA 2ZQSA 4U84A 3WQWA 1ZU8A 4LAWA 4J4OA 4UDMA 1E15A 4JFMA 2KE0A 3FY1A 4C02B 4JFIA 1Q6HA 1NWSA 1NSGA 2ZQUA 2MLYA 1U79A 2RQSA 1TFVA 5GQBA 2LPVA 1NWRA 2LKNA 3CGNA 3FAPA 5HT1A 1FFRA 2XP3A 2Y78A 2ZR4A 4GIVA 1GPFA 2K8IA 3UQIA 1NWTA 3KABA 2ZQTA 4NZCA 2P4VA 5HW7A 1F40A 4DIPA 4ML4A 2MPHA 4TW8A 1NMVA 4TW7A 1W9VA 4DRQA 4FAPA 1EHNA 4PTMA 1JNEA 2Q5AA 3O5EA 2B5UB 2KI3A 1FKKA 4NNRA 4DT4A 3CHEA 3G6LA 1BKFA 4HBEA 3AS3A 1A7XA 1HKKA 1NH6A 5D75A 2PPOA 3UI6A 3O5IA 1D7IA 2A3AA 3CHDA 4TW6A 1H0GA 4R0XA 1W1TA 3IKDA 3WD0A 1OGGA 1ZBCA 4JFKA 2MLXA 1LL7A 1W9PA 1YATA 3PRDA 4IT6A 3GTYX 4P8XA 4ODOA 3CHFA 1B6CA 4MNMA 1H0IA 3RFWA 5HW8A 2UZ5A 1FD9A 1LL6A 4DZ2A 1ZBWA
chains in the Genus database with same CATH topology
3UI5A 4TNSA 3AS0A 5DIUA 3WKZA 4DRKA 4DZ3A 2XP9A 2PV2A 3CGMA 5HWBA 4ODPA 4LAVA 4DWSA 4WKHA 3VAWA 2KO7A 3JYJA 3WD4A 4JFJA 3ARTA 4WKFA 1D6OA 2YBUA 4ODLA 3WL0A 3IKGA 4IT4A 1ZL1A 4ODKA 4J4NA 3BXWA 3CH9A 4S3JA 1FKLA 1D2KA 1FKRA 4DRJA 3KAGA 3WH0A 1J4HA 3O5GA 2DT1A 1KT0A 1IX5A 1E6RA 4W5UA 3O5PA 3O5DA 1X6LA 2WLYA 3FXYA 1EYMA 1QZ2A 3ARWA 5HTGA 3ARSA 2G8ZA 1YW5A 4ODNA 2F2DA 2MF9A 2XPAA 3NTPA 4KR0B 4LAYA 1RD6A 4G50A 4HBOA 2KR7A 2XP4A 3KCEA 1HJVA 4U86A 3WD1A 3O5LA 1D7JA 3G6MA 4XAKA 2M2AA 1ZB5A 3B9EA 4Q7NA 2YBTA 1EQ3A 1LQ0A 2RSEA 5JH8A 3IK8A 1ROUA 1WB0A 1XHGA 2B31A 5BXJA 4P8UA 2M08A 1KT1A 2KFWA 2DG3A 1LG1A 4O2TA 3ODKA 4NSBA 4W9QA 4DROA 1NWUA 1NMWA 3KAFA 2ZR6A 1JVWA 2WM0A 3ARRA 2JZVA 3TDBA 4IPXA 2ZR5A 4DRNA 5HW6A 3WD2A 4DWSB 2RUQA 4TYOA 3KAHA 3RM4A 3KAIA 1M5YA 2DSWA 4G2PA 1T11A 4ITZA 1HXVA 3O5FA 2XP7A 3TC5A 2DG9A 3MDYB 1ZK6A 2LGOA 2PBCA 3AS1A 1XRVA 1LG2A 4ZPVR 3UF8A 2DSUA 4IQCA 4ZPWR 4HARA 3ARUA 2VN1A 4URIA 4ZS6A 2A3CA 1P5QA 1TCOC 4ODQA 2RUDA 1HKIA 2O9OA 3IHZA 4LGXA 1E6NA 2M1IA 4DRMA 3NRKA 4L72B 2PI6A 1W1PA 2O92A 3AQUA 1PBKA 4JYSA 5GPRA 1FFQA 4ZPTR 5B8IC 3UQAA 4KQZA 2WK2A 2PPPA 3CHCA 3AS2A 4DRIA 1R9HA 3O5KA 2PPNA 1ITXA 4DH0A 1W26A 2MLZA 4LAXA 4DRPA 1Q6UA 2IF4A 1OGBA 3QOKA 2QF8A 3ARYA 1VF8A 4U85A 4Z2KA 2DT3A 1WAWA 4P8WA 1QPLA 4QT3A 4QT2A 2N87A 4MSPA 3ALGA 4Q22A 1W9UA 2FDMA 2FAPA 3EY6A 4MNKA 5I98A 1L1PA 3ARZA 2AWGA 1ZBKA 1OWQA 4P8VA 3I6CA 2AOSA 1FKTA 3ALFA 2VCDA 5HUAA 2DPEA 1W1YA 1E6PA 3RMEA 1ZCNA 5DEZA 4Z2LA 2RURA 3OOBA 4Z2IA 2F21A 3NI6A 3ARXA 3O5JA 2F4EA 4IQ2A 1HKMA 1D7HA 1EIBA 4WJXA 4WK9A 4BF8A 3UQBA 4MNJA 4ODMA 3KACA 3B9AA 2ESCA 2LJ4A 3LUOA 4Z2GA 1Q1CA 3CZ8A 1J6YA 3PR9A 3W4RA 3WD3A 3RGCA 3O5OA 2KGJA 3AROA 5HBFA 3PA7A 4L3NA 4W9PA 5GPGA 2XPBA 4WIWA 4GGQA 2PV1A 2RUCA 3TCZA 3OA5A 2FKEA 1FKGA 2MNTA 5DO2A 3RM8A 3PRAA 4QIBA 1KFWA 1FKDA 2DT0A 1C9HA 3H9RB 1FKFA 4R5EA 3WL1A 2WLZA 4WKAA 1J4RA 4AY1A 4DRHA 3O5MA 2ZQVA 1FJDA 1UR9A 4Z2JA 1X6NA 1K9TA 1HJXA 1JNTA 3WIJA 1N1AA 3JYMA 1W1VA 2XP8A 4MAVA 1GUVA 2DG4A 1PINA 1QPFA 1FKSA 5DITA 4MPKA 1HJWA 3B9DA 1JNSA 1LJYA 2OFNA 1FAPA 3UI4A 2L2SA 3ARVA 1LL4A 2DSZA 4W9OA 1FKBA 5DF0A 4Z2HA 1E9LA 1J4IA 1Q6IA 5HWCA 4DWSC 2IUZA 3KZ7A 2XP5A 3ARQA 2DT2A 1CTNA 1FKJA 1Y0OA 4S3KA 3B8SA 5DIVA 4MTVA 3O5RA 2XP6A 3KADA 1BL4A 1ZBVA 4FN2A 1O6IA 1HKJA 3WQVA 5HKGA 1FKHA 4ODRA 4N19A 3PRBA 2D9FA 1GOIA 4MNLA 3B7XA 3GPKA 1SR0A 2A3EA 1FKIA 2A3BA 2ITKA 4TX0A 1JNDA 4JFLA 3RM9A 4MGVA 2G41A 1E6ZA 1EDQA 4DWSD 2OLHA 1F8AB 1UR8A 1WNOA 3O5QA 5J6EA 1SYTA 2PV3A 3ARPA 4QZVB 3JXVA 1ROTA 2DSVA 2ZQSA 4U84A 3WQWA 1ZU8A 4LAWA 4J4OA 1E15A 4JFMA 2KE0A 3FY1A 4C02B 4JFIA 1Q6HA 1NWSA 1NSGA 2ZQUA 2MLYA 1U79A 2RQSA 1TFVA 5GQBA 2LPVA 1NWRA 2LKNA 3CGNA 3FAPA 5HT1A 1FFRA 2XP3A 2Y78A 2ZR4A 4GIVA 1GPFA 2K8IA 3UQIA 1NWTA 3KABA 2ZQTA 4NZCA 5HW7A 1F40A 4DIPA 4ML4A 2MPHA 4TW8A 1NMVA 4TW7A 1W9VA 4DRQA 4FAPA 1EHNA 4PTMA 1JNEA 2Q5AA 3O5EA 2KI3A 1FKKA 4NNRA 4DT4A 3CHEA 3G6LA 1BKFA 4HBEA 3AS3A 1A7XA 1HKKA 1NH6A 5D75A 2PPOA 3UI6A 3O5IA 1D7IA 2A3AA 3CHDA 4TW6A 1H0GA 4R0XA 1W1TA 3IKDA 3WD0A 1OGGA 1ZBCA 4JFKA 2MLXA 1LL7A 1W9PA 1YATA 3PRDA 4IT6A 4P8XA 4ODOA 3CHFA 1B6CA 4MNMA 1H0IA 3RFWA 5HW8A 2UZ5A 1FD9A 1LL6A 4DZ2A 1ZBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UI5 A;  4MGV A;  4TNS A;  3LUO A;  4G2P A;  1T11 A;  5DIU A;  4ITZ A;  4DRK A;  4DZ3 A;  2XP9 A;  1F8A B;  1HXV A;  3O5F A;  1Q1C A;  1J6Y A;  2XP7 A;  3TC5 A;  2PV2 A;  2DG9 A;  3MDY B;  3O5Q A;  3RGC A;  1ZK6 A;  2LGO A;  2PBC A;  3CGM A;  2KGJ A;  3O5O A;  5HWB A;  5J6E A;  2PV3 A;  4ODP A;  3UF8 A;  4LAV A;  4IQC A;  3VAW A;  2KO7 A;  3PA7 A;  3JXV A;  1ROT A;  3JYJ A;  2ZQS A;  2VN1 A;  4U84 A;  4W9P A;  5GPG A;  2XPB A;  1P5Q A;  4JFJ A;  1TCO C;  4LAW A;  1D6O A;  4J4O A;  4ODQ A;  4ODL A;  3IKG A;  4GGQ A;  2RUD A;  2KE0 A;  4JFM A;  4C02 B;  4ODK A;  3IHZ A;  2PV1 A;  4J4N A;  4JFI A;  2M1I A;  1Q6H A;  2RUC A;  3NRK A;  4DRM A;  3TCZ A;  1NSG A;  2FKE A;  2ZQU A;  1FKG A;  1U79 A;  2MLY A;  1FKL A;  2MNT A;  2RQS A;  1FKR A;  4DRJ A;  3KAG A;  2LPV A;  2LKN A;  3CGN A;  1PBK A;  3FAP A;  5HT1 A;  4JYS A;  2XP3 A;  2Y78 A;  4QIB A;  3WH0 A;  1J4H A;  2ZR4 A;  3O5G A;  4GIV A;  1FKD A;  1KT0 A;  1C9H A;  2K8I A;  3H9R B;  1FKF A;  3UQI A;  3O5P A;  5B8I C;  3KAB A;  3UQA A;  2ZQT A;  5HW7 A;  1F40 A;  3O5D A;  4DIP A;  2PPP A;  1J4R A;  4DRI A;  2MPH A;  4DRH A;  4TW8 A;  1R9H A;  2ZQV A;  3O5K A;  1EYM A;  3O5M A;  1NMV A;  1QZ2 A;  2PPN A;  4TW7 A;  1W26 A;  4DH0 A;  4DRQ A;  5HTG A;  1FJD A;  2MLZ A;  4FAP A;  1YW5 A;  1JNT A;  4LAX A;  4ODN A;  4DRP A;  1N1A A;  2F2D A;  1Q6U A;  2MF9 A;  2XPA A;  2IF4 A;  3NTP A;  3JYM A;  4LAY A;  2XP8 A;  2Q5A A;  3O5E A;  2DG4 A;  4G50 A;  2KI3 A;  1PIN A;  1QPF A;  2KR7 A;  1FKK A;  2XP4 A;  1FKS A;  3KCE A;  4NNR A;  4U86 A;  4U85 A;  5DIT A;  4DT4 A;  1JNS A;  1BKF A;  2OFN A;  1FAP A;  1A7X A;  2L2S A;  3O5L A;  3UI4 A;  1D7J A;  1QPL A;  5D75 A;  2PPO A;  4QT3 A;  4QT2 A;  3UI6 A;  2N87 A;  1FKB A;  4MSP A;  3O5I A;  4W9O A;  1D7I A;  4TW6 A;  2FAP A;  2M2A A;  3EY6 A;  1J4I A;  4R0X A;  1Q6I A;  5HWC A;  5I98 A;  1L1P A;  2AWG A;  3KZ7 A;  2XP5 A;  1EQ3 A;  3I6C A;  3IKD A;  1FKJ A;  1FKT A;  2RSE A;  1Y0O A;  4JFK A;  3IK8 A;  1ROU A;  2VCD A;  2MLX A;  5HUA A;  5DIV A;  5BXJ A;  1YAT A;  3PRD A;  2M08 A;  3O5R A;  1KT1 A;  2KFW A;  1ZCN A;  2XP6 A;  3KAD A;  1BL4 A;  2DG3 A;  4O2T A;  2RUR A;  4FN2 A;  3OOB A;  5HKG A;  3ODK A;  4W9Q A;  1FKH A;  4ODR A;  2F21 A;  3NI6 A;  3PRB A;  1NMW A;  2D9F A;  4N19 A;  4DRO A;  3KAF A;  2ZR6 A;  4ODO A;  1JVW A;  3O5J A;  2F4E A;  3B7X A;  2JZV A;  3GPK A;  4IQ2 A;  1D7H A;  1B6C A;  2ZR5 A;  4IPX A;  3TDB A;  4DRN A;  5HW6 A;  1FKI A;  2ITK A;  3RFW A;  4TX0 A;  4BF8 A;  2RUQ A;  2UZ5 A;  4TYO A;  5HW8 A;  3UQB A;  4ODM A;  1FD9 A;  3KAC A;  3KAH A;  3KAI A;  1M5Y A;  2LJ4 A;  4DZ2 A;  4JFL A; 
#chains in the Genus database with same CATH topology
 3UI5 A;  4TNS A;  3AS0 A;  5DIU A;  3WKZ A;  4DRK A;  4DZ3 A;  2XP9 A;  2PV2 A;  3CGM A;  5HWB A;  4ODP A;  4LAV A;  4DWS A;  4WKH A;  3VAW A;  2KO7 A;  3JYJ A;  3WD4 A;  4JFJ A;  3ART A;  4WKF A;  1D6O A;  2YBU A;  4ODL A;  3WL0 A;  3IKG A;  4IT4 A;  1ZL1 A;  4ODK A;  4J4N A;  3BXW A;  3CH9 A;  4S3J A;  1FKL A;  1D2K A;  1FKR A;  4DRJ A;  3KAG A;  3WH0 A;  1J4H A;  3O5G A;  2DT1 A;  1KT0 A;  1IX5 A;  1E6R A;  4W5U A;  3O5P A;  3O5D A;  1X6L A;  2WLY A;  3FXY A;  1EYM A;  1QZ2 A;  3ARW A;  5HTG A;  3ARS A;  2G8Z A;  1YW5 A;  4ODN A;  2F2D A;  2MF9 A;  2XPA A;  3NTP A;  4KR0 B;  4LAY A;  1RD6 A;  4G50 A;  4HBO A;  2KR7 A;  2XP4 A;  3KCE A;  1HJV A;  4U86 A;  3WD1 A;  3O5L A;  1D7J A;  3G6M A;  4XAK A;  2M2A A;  1ZB5 A;  3B9E A;  4Q7N A;  2YBT A;  1EQ3 A;  1LQ0 A;  2RSE A;  5JH8 A;  3IK8 A;  1ROU A;  1WB0 A;  3GU0 A;  1XHG A;  2B31 A;  5BXJ A;  4P8U A;  2M08 A;  1KT1 A;  2KFW A;  2DG3 A;  1LG1 A;  4O2T A;  1GRJ A;  3ODK A;  4NSB A;  4W9Q A;  4DRO A;  1NWU A;  1NMW A;  3KAF A;  2ZR6 A;  1JVW A;  2WM0 A;  3ARR A;  2JZV A;  3TDB A;  4IPX A;  2ZR5 A;  4DRN A;  5HW6 A;  3WD2 A;  4DWS B;  2RUQ A;  4TYO A;  3BMB A;  3KAH A;  3RM4 A;  3KAI A;  1M5Y A;  2DSW A;  4G2P A;  1T11 A;  4ITZ A;  1HXV A;  3O5F A;  2XP7 A;  3TC5 A;  2DG9 A;  3MDY B;  1ZK6 A;  2LGO A;  2PBC A;  3AS1 A;  1XRV A;  1LG2 A;  4ZPV R;  3UF8 A;  2DSU A;  4IQC A;  4ZPW R;  4HAR A;  3ARU A;  2VN1 A;  4URI A;  4ZS6 A;  2A3C A;  1P5Q A;  1TCO C;  4ODQ A;  2RUD A;  1HKI A;  2O9O A;  3IHZ A;  4LGX A;  1E6N A;  2M1I A;  4DRM A;  3NRK A;  4L72 B;  2PI6 A;  1W1P A;  2O92 A;  3AQU A;  1PBK A;  4JYS A;  5GPR A;  1E44 A;  1FFQ A;  4ZPT R;  5B8I C;  3UQA A;  4KQZ A;  2WK2 A;  2PPP A;  3CHC A;  3AS2 A;  4DRI A;  1R9H A;  3O5K A;  2EUL A;  2PPN A;  1ITX A;  4DH0 A;  1W26 A;  2MLZ A;  4LAX A;  4DRP A;  1Q6U A;  2IF4 A;  2PN0 A;  1OGB A;  3QOK A;  2QF8 A;  3ARY A;  1VF8 A;  4U85 A;  4Z2K A;  2DT3 A;  1WAW A;  4P8W A;  1QPL A;  4QT3 A;  4QT2 A;  2N87 A;  4MSP A;  3ALG A;  4Q22 A;  1W9U A;  2FDM A;  2FAP A;  3EY6 A;  4MNK A;  5I98 A;  1L1P A;  3ARZ A;  2AWG A;  1ZBK A;  1OWQ A;  4P8V A;  3I6C A;  2AOS A;  1FKT A;  3ALF A;  2VCD A;  5HUA A;  2DPE A;  1W1Y A;  1E6P A;  3RME A;  1ZCN A;  5DEZ A;  4Z2L A;  2RUR A;  3OOB A;  3EIP A;  4Z2I A;  2F21 A;  3NI6 A;  3ARX A;  3O5J A;  2F4E A;  4IQ2 A;  1HKM A;  1D7H A;  1EIB A;  4WJX A;  4WK9 A;  4BF8 A;  3UQB A;  4MNJ A;  4ODM A;  3KAC A;  3B9A A;  2ESC A;  2LJ4 A;  3LUO A;  4Z2G A;  1Q1C A;  3CZ8 A;  1J6Y A;  3PR9 A;  3W4R A;  3WD3 A;  3RGC A;  3O5O A;  2KGJ A;  3ARO A;  5HBF A;  3PA7 A;  4L3N A;  4W9P A;  5GPG A;  2XPB A;  4WIW A;  4GGQ A;  2PV1 A;  2RUC A;  3TCZ A;  3OA5 A;  2ETN A;  2FKE A;  1FKG A;  2MNT A;  5DO2 A;  3RM8 A;  3PRA A;  4QIB A;  1KFW A;  1FKD A;  2DT0 A;  1C9H A;  3H9R B;  1FKF A;  1JCH B;  4R5E A;  3WL1 A;  2WLZ A;  4WKA A;  1J4R A;  4AY1 A;  4DRH A;  3O5M A;  2ZQV A;  1FJD A;  1UR9 A;  4Z2J A;  1X6N A;  1K9T A;  1HJX A;  1JNT A;  2F23 A;  3WIJ A;  1N1A A;  3JYM A;  1W1V A;  2XP8 A;  4MAV A;  1GUV A;  2DG4 A;  1PIN A;  1QPF A;  1FKS A;  5DIT A;  4MPK A;  1HJW A;  3B9D A;  1JNS A;  1LJY A;  2OFN A;  1FAP A;  3UI4 A;  2L2S A;  3ARV A;  1LL4 A;  2DSZ A;  4W9O A;  1FKB A;  5DF0 A;  4Z2H A;  1E9L A;  1J4I A;  1Q6I A;  5HWC A;  4DWS C;  2IUZ A;  3KZ7 A;  2XP5 A;  3ARQ A;  2DT2 A;  1CTN A;  1FKJ A;  1Y0O A;  4S3K A;  3B8S A;  5DIV A;  4MTV A;  3O5R A;  2XP6 A;  3KAD A;  1BL4 A;  1ZBV A;  4FN2 A;  1O6I A;  1HKJ A;  3WQV A;  5HKG A;  1FKH A;  4ODR A;  4N19 A;  3PRB A;  2D9F A;  1GOI A;  4MNL A;  3B7X A;  3GPK A;  1SR0 A;  2A3E A;  1FKI A;  2A3B A;  2ITK A;  4TX0 A;  1JND A;  4JFL A;  3RM9 A;  4MGV A;  2G41 A;  1E6Z A;  1EDQ A;  4DWS D;  2OLH A;  1F8A B;  1UR8 A;  1WNO A;  3O5Q A;  5J6E A;  1SYT A;  2PV3 A;  3ARP A;  4QZV B;  3JXV A;  1ROT A;  2DSV A;  2ZQS A;  4U84 A;  3WQW A;  1ZU8 A;  4LAW A;  4J4O A;  4UDM A;  1E15 A;  4JFM A;  2KE0 A;  3FY1 A;  4C02 B;  4JFI A;  1Q6H A;  1NWS A;  1NSG A;  2ZQU A;  2MLY A;  1U79 A;  2RQS A;  1TFV A;  5GQB A;  2LPV A;  1NWR A;  2LKN A;  3CGN A;  3FAP A;  5HT1 A;  1FFR A;  2XP3 A;  2Y78 A;  2ZR4 A;  4GIV A;  1GPF A;  2K8I A;  3UQI A;  1NWT A;  3KAB A;  2ZQT A;  4NZC A;  2P4V A;  5HW7 A;  1F40 A;  4DIP A;  4ML4 A;  2MPH A;  4TW8 A;  1NMV A;  4TW7 A;  1W9V A;  4DRQ A;  4FAP A;  1EHN A;  4PTM A;  1JNE A;  2Q5A A;  3O5E A;  2B5U B;  2KI3 A;  1FKK A;  4NNR A;  4DT4 A;  3CHE A;  3G6L A;  1BKF A;  4HBE A;  3AS3 A;  1A7X A;  1HKK A;  1NH6 A;  5D75 A;  2PPO A;  3UI6 A;  3O5I A;  1D7I A;  2A3A A;  3CHD A;  4TW6 A;  1H0G A;  4R0X A;  1W1T A;  3IKD A;  3WD0 A;  1OGG A;  1ZBC A;  4JFK A;  2MLX A;  1LL7 A;  1W9P A;  1YAT A;  3PRD A;  4IT6 A;  3GTY X;  4P8X A;  4ODO A;  3CHF A;  1B6C A;  4MNM A;  1H0I A;  3RFW A;  5HW8 A;  2UZ5 A;  1FD9 A;  1LL6 A;  4DZ2 A;  1ZBW A; 
#chains in the Genus database with same CATH homology
 3UI5 A;  4TNS A;  3AS0 A;  5DIU A;  3WKZ A;  4DRK A;  4DZ3 A;  2XP9 A;  2PV2 A;  3CGM A;  5HWB A;  4ODP A;  4LAV A;  4DWS A;  4WKH A;  3VAW A;  2KO7 A;  3JYJ A;  3WD4 A;  4JFJ A;  3ART A;  4WKF A;  1D6O A;  2YBU A;  4ODL A;  3WL0 A;  3IKG A;  4IT4 A;  1ZL1 A;  4ODK A;  4J4N A;  3BXW A;  3CH9 A;  4S3J A;  1FKL A;  1D2K A;  1FKR A;  4DRJ A;  3KAG A;  3WH0 A;  1J4H A;  3O5G A;  2DT1 A;  1KT0 A;  1IX5 A;  1E6R A;  4W5U A;  3O5P A;  3O5D A;  1X6L A;  2WLY A;  3FXY A;  1EYM A;  1QZ2 A;  3ARW A;  5HTG A;  3ARS A;  2G8Z A;  1YW5 A;  4ODN A;  2F2D A;  2MF9 A;  2XPA A;  3NTP A;  4KR0 B;  4LAY A;  1RD6 A;  4G50 A;  4HBO A;  2KR7 A;  2XP4 A;  3KCE A;  1HJV A;  4U86 A;  3WD1 A;  3O5L A;  1D7J A;  3G6M A;  4XAK A;  2M2A A;  1ZB5 A;  3B9E A;  4Q7N A;  2YBT A;  1EQ3 A;  1LQ0 A;  2RSE A;  5JH8 A;  3IK8 A;  1ROU A;  1WB0 A;  1XHG A;  2B31 A;  5BXJ A;  4P8U A;  2M08 A;  1KT1 A;  2KFW A;  2DG3 A;  1LG1 A;  4O2T A;  3ODK A;  4NSB A;  4W9Q A;  4DRO A;  1NWU A;  1NMW A;  3KAF A;  2ZR6 A;  1JVW A;  2WM0 A;  3ARR A;  2JZV A;  3TDB A;  4IPX A;  2ZR5 A;  4DRN A;  5HW6 A;  3WD2 A;  4DWS B;  2RUQ A;  4TYO A;  3KAH A;  3RM4 A;  3KAI A;  1M5Y A;  2DSW A;  4G2P A;  1T11 A;  4ITZ A;  1HXV A;  3O5F A;  2XP7 A;  3TC5 A;  2DG9 A;  3MDY B;  1ZK6 A;  2LGO A;  2PBC A;  3AS1 A;  1XRV A;  1LG2 A;  4ZPV R;  3UF8 A;  2DSU A;  4IQC A;  4ZPW R;  4HAR A;  3ARU A;  2VN1 A;  4URI A;  4ZS6 A;  2A3C A;  1P5Q A;  1TCO C;  4ODQ A;  2RUD A;  1HKI A;  2O9O A;  3IHZ A;  4LGX A;  1E6N A;  2M1I A;  4DRM A;  3NRK A;  4L72 B;  2PI6 A;  1W1P A;  2O92 A;  3AQU A;  1PBK A;  4JYS A;  5GPR A;  1FFQ A;  4ZPT R;  5B8I C;  3UQA A;  4KQZ A;  2WK2 A;  2PPP A;  3CHC A;  3AS2 A;  4DRI A;  1R9H A;  3O5K A;  2PPN A;  1ITX A;  4DH0 A;  1W26 A;  2MLZ A;  4LAX A;  4DRP A;  1Q6U A;  2IF4 A;  1OGB A;  3QOK A;  2QF8 A;  3ARY A;  1VF8 A;  4U85 A;  4Z2K A;  2DT3 A;  1WAW A;  4P8W A;  1QPL A;  4QT3 A;  4QT2 A;  2N87 A;  4MSP A;  3ALG A;  4Q22 A;  1W9U A;  2FDM A;  2FAP A;  3EY6 A;  4MNK A;  5I98 A;  1L1P A;  3ARZ A;  2AWG A;  1ZBK A;  1OWQ A;  4P8V A;  3I6C A;  2AOS A;  1FKT A;  3ALF A;  2VCD A;  5HUA A;  2DPE A;  1W1Y A;  1E6P A;  3RME A;  1ZCN A;  5DEZ A;  4Z2L A;  2RUR A;  3OOB A;  4Z2I A;  2F21 A;  3NI6 A;  3ARX A;  3O5J A;  2F4E A;  4IQ2 A;  1HKM A;  1D7H A;  1EIB A;  4WJX A;  4WK9 A;  4BF8 A;  3UQB A;  4MNJ A;  4ODM A;  3KAC A;  3B9A A;  2ESC A;  2LJ4 A;  3LUO A;  4Z2G A;  1Q1C A;  3CZ8 A;  1J6Y A;  3PR9 A;  3W4R A;  3WD3 A;  3RGC A;  3O5O A;  2KGJ A;  3ARO A;  5HBF A;  3PA7 A;  4L3N A;  4W9P A;  5GPG A;  2XPB A;  4WIW A;  4GGQ A;  2PV1 A;  2RUC A;  3TCZ A;  3OA5 A;  2FKE A;  1FKG A;  2MNT A;  5DO2 A;  3RM8 A;  3PRA A;  4QIB A;  1KFW A;  1FKD A;  2DT0 A;  1C9H A;  3H9R B;  1FKF A;  4R5E A;  3WL1 A;  2WLZ A;  4WKA A;  1J4R A;  4AY1 A;  4DRH A;  3O5M A;  2ZQV A;  1FJD A;  1UR9 A;  4Z2J A;  1X6N A;  1K9T A;  1HJX A;  1JNT A;  3WIJ A;  1N1A A;  3JYM A;  1W1V A;  2XP8 A;  4MAV A;  1GUV A;  2DG4 A;  1PIN A;  1QPF A;  1FKS A;  5DIT A;  4MPK A;  1HJW A;  3B9D A;  1JNS A;  1LJY A;  2OFN A;  1FAP A;  3UI4 A;  2L2S A;  3ARV A;  1LL4 A;  2DSZ A;  4W9O A;  1FKB A;  5DF0 A;  4Z2H A;  1E9L A;  1J4I A;  1Q6I A;  5HWC A;  4DWS C;  2IUZ A;  3KZ7 A;  2XP5 A;  3ARQ A;  2DT2 A;  1CTN A;  1FKJ A;  1Y0O A;  4S3K A;  3B8S A;  5DIV A;  4MTV A;  3O5R A;  2XP6 A;  3KAD A;  1BL4 A;  1ZBV A;  4FN2 A;  1O6I A;  1HKJ A;  3WQV A;  5HKG A;  1FKH A;  4ODR A;  4N19 A;  3PRB A;  2D9F A;  1GOI A;  4MNL A;  3B7X A;  3GPK A;  1SR0 A;  2A3E A;  1FKI A;  2A3B A;  2ITK A;  4TX0 A;  1JND A;  4JFL A;  3RM9 A;  4MGV A;  2G41 A;  1E6Z A;  1EDQ A;  4DWS D;  2OLH A;  1F8A B;  1UR8 A;  1WNO A;  3O5Q A;  5J6E A;  1SYT A;  2PV3 A;  3ARP A;  4QZV B;  3JXV A;  1ROT A;  2DSV A;  2ZQS A;  4U84 A;  3WQW A;  1ZU8 A;  4LAW A;  4J4O A;  1E15 A;  4JFM A;  2KE0 A;  3FY1 A;  4C02 B;  4JFI A;  1Q6H A;  1NWS A;  1NSG A;  2ZQU A;  2MLY A;  1U79 A;  2RQS A;  1TFV A;  5GQB A;  2LPV A;  1NWR A;  2LKN A;  3CGN A;  3FAP A;  5HT1 A;  1FFR A;  2XP3 A;  2Y78 A;  2ZR4 A;  4GIV A;  1GPF A;  2K8I A;  3UQI A;  1NWT A;  3KAB A;  2ZQT A;  4NZC A;  5HW7 A;  1F40 A;  4DIP A;  4ML4 A;  2MPH A;  4TW8 A;  1NMV A;  4TW7 A;  1W9V A;  4DRQ A;  4FAP A;  1EHN A;  4PTM A;  1JNE A;  2Q5A A;  3O5E A;  2KI3 A;  1FKK A;  4NNR A;  4DT4 A;  3CHE A;  3G6L A;  1BKF A;  4HBE A;  3AS3 A;  1A7X A;  1HKK A;  1NH6 A;  5D75 A;  2PPO A;  3UI6 A;  3O5I A;  1D7I A;  2A3A A;  3CHD A;  4TW6 A;  1H0G A;  4R0X A;  1W1T A;  3IKD A;  3WD0 A;  1OGG A;  1ZBC A;  4JFK A;  2MLX A;  1LL7 A;  1W9P A;  1YAT A;  3PRD A;  4IT6 A;  4P8X A;  4ODO A;  3CHF A;  1B6C A;  4MNM A;  1H0I A;  3RFW A;  5HW8 A;  2UZ5 A;  1FD9 A;  1LL6 A;  4DZ2 A;  1ZBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...