4DWEA

Crystal structure of a putative polysaccharide deacetylase (bacova_03992) from bacteroides ovatus atcc 8483 at 2.01 a resolution
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
460
structure length
460
Chain Sequence
DNGKRRDVICETEFIYPFGNETADKEIEITIHLKADRQVGYLYTEIPTLKYNKDWLFLMTQDDCMHSAFSYTWAAIHGKPLSYIYYCDLAHLQNGDLPPDYYSLGKTLATTNGTGQEVRFSFGTTVAADDDLMNTQTWVQNGYTRDYFRFYKKTMLVWGNLQEMMNYGVSIAFHDLNLPDEDKTEDKLLAQFPVAQSMIREKLNNRTCKMLAEPNGDKNYIKAALRYDKIRTLCAQSGATKLYPFQENGDIEQVVIERAFYDPPEGSGLTNPDMIKAAILKEMENPKEERAAISIGAHNTDTGWVNFLEWLNDTYGRDGDDSMWFTNQEEYYEYYYYRLHSKPEIKQVNTHTWKLTLNLNGEDSAPFYYPSVTVNIFGLKMGDIESIKSNEDVTGLSYGDHKDFFMLNIDCRKYLAEHAENFVKRYEANPTDVSAKADANYFVNMLKDSDKKTELKKRIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
publication title Crystal structure of a hypothetical protein (BACOVA_03992) from Bacteroides ovatus ATCC 8483 at 2.01 A resolution
rcsb
source organism Bacteroides ovatus
total genus 156
structure length 460
sequence length 460
ec nomenclature
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15421 Polysacc_deac_3 Putative polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...