4DWJA

Crystal structure of thymidylate kinase from staphylococcus aureus in complex with thymidine monophosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
203
structure length
200
Chain Sequence
b'SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHQRFKSVNADQPLENVVEDTYQTIIKYLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in complex with Thymidine Monophosphate
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
total genus 81
structure length 200
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dwjA00
4B33A 3IUYA 1P3JA 3X1XA 5C1BA 2OV2A 5JJIA 4IVQA 4LJAA 3Q3JB 5HE8A 1Z22A 2VH5R 1IN8A 3W8RA 1Z8FA 2O8DB 1E4YA 1KDTA 2V3CC 1XPOA 1Z0AA 1LW7A 5ANRB 3TUIC 4CF7A 4R7ZA 2Q6TA 5IT5A 1TF7A 4BRUA 3RWOA 2ZSDA 2P65A 1LF5A 4ABYA 3QKRA 4AG5A 4TLDA 1ZNXA 3TQCA 3OF5A 3BIFA 4BEJA 4C0SA 4P0TA 2BEKA 3I8XA 4EPRA 1Q21A 3CX7A 5B58C 3B60A 3RABA 4B3BA 3WY9A 5JWOA 4OJQA 4LGMA 4ON9A 2QMEA 4OK3A 3QI2A 4Z1MD 1KDRA 3AVQA 1P2TA 2AK2A 2QTVB 1P75A 2VLIA 4B48A 3REGA 3GLFB 4JZKA 1R0ZA 4QBIA 1OB5A 2QAGC 4XJXA 4JVSB 3TR5A 5KSZA 3G5UA 4R98A 4LJ8A 4IKEA 4DLRA 4B2PA 5FTKA 2ZVPX 4ZV4A 5AUQA 4KJZA 3W34A 2ZRJA 3T35A 4IXNA 2XX3A 4V03A 2O0HA 5JCZA 1A1VA 1RRGA 2GBLA 2A78A 4LUCA 2ZIAA 3SQWA 1E2MA 3LA6A 4W5WA 2WOJA 2RHDA 5CLLA 3AF4A 2GCNA 4GZMA 5IRCD 3UMRA 1MO6A 4JSTA 3L2OB 3T34A 2V1XA 2ZPTX 3TIFA 1OV4A 2WV9A 4GL2A 1XZPA 3L43A 2ZETA 2F43B 3WMEA 2CHQA 2FDCA 2ZRBA 4UJ3A 2KBFA 1KSHA 1R2QA 2IHYA 4O25A 4BFXA 5LD2B 3VKHA 4A2WA 3K09A 2HLDD 3SOPA 1H8HA 4GRAA 5BWMA 2IYLD 2RH5A 2ZS9A 1X8LA 2ZREA 4FMBB 2WJJA 1FTNA 3MMPA 2V9PA 1P61B 1U9IC 2W2VA 4O2RA 2KWIA 1R0WA 3T1QA 1ZD9A 4DSTA 3PR1A 2ZSFA 3KB1A 4KFSA 3FYHA 5H70A 1PJRA 3L0SA 4CIDA 1XXHB 1T3LA 3B1XA 1VIYA 4M1KA 4QBGB 4IFBA 121PA 1G4UR 2RGGA 1LY1A 4BFSA 3I5XA 4RZUA 3IPXA 3PUYA 1W48A 1G291 2IEYA 4Q7LA 4CYMA 1QG2A 5DNYB 1N25A 4HB3A 2IK8A 3VU9B 3AH8A 1E2JA 1FTSA 3SR0A 3AVUA 2QZ4A 4F4JA 2NZ8A 4TLBA 1Z6AA 3CZPA 2H18A 3LQRA 2Q9AA 4MGIR 2NG1A 4JLOA 4DKXA 3NC1C 2QU8A 2HF9A 1ZNWA 1NN3A 1P72A 1TQ6A 1Z0DA 1WP9A 4QGAA 1KIMA 2QP9X 3ASZA 1XNJA 2QMOA 3FFBA 5FOTA 1UEIA 2IXEA 3BGWA 5L3VA 5AJYA 2P6UA 3K0SA 2NMVA 2IYQA 2YWGA 1HE8B 1OXTA 3BJIC 4RJLA 3CX8A 4NCNA 2REXB 3U5ZB 4CW7A 4C2TA 3KFVA 3QKUA 1NJFA 2D2FA 1E2IA 3BK7A 4Z8YA 4JMPA 3RHFA 3N70A 1UM8A 4YDSA 3BB4A 3PG5A 3S1AA 4URVR 2O8DA 1E2PA 1JR3A 1ZIOA 1LS6A 2AXPA 2W6ID 1BIFA 2ZJYA 3UK6A 3K70B 1F60A 1NIPA 5FI0B 2CCGA 1XTSA 3B2EA 1RC8A 3EW9A 2H17A 2OUKA 3NXSA 2YOHA 3U6KA 4B71A 1E1QD 4Q7MB 4ESVA 4JSYA 1IAQA 1GWNA 3I92A 1W0KD 4PSKA 5C46F 1ZIPA 3WHKA 2QMHA 1E2NA 4PAMA 4HATA 4BEBA 4URXR 4KITB 2GWHA 4M53A 1Z0IA 2QE7A 1F3OA 4IOLA 4CGZA 3V9PA 1E9FA 5LBIA 3BB1A 2CCKA 3M0EA 4A6PA 5KUTA 2H92A 1YKSA 4MYCA 1CJTC 2PX3A 3DEFA 3CUEF 1HUQA 4MKIA 5B30A 5JECA 4G5RA 2WJGA 1EK0A 4ZIRB 4DCNA 1Q3HA 1QHHA 1XCPA 3AF1A 4MUBA 5CYOA 4IOMA 3K53A 5EZ5A 1S3GA 5FBRB 2VSOA 3KQUA 4W5HA 4JLVA 4WZBE 2ONJA 2QT1A 4ZKDA 5J4VA 4G5GA 3B1YA 1P9NA 1I2DA 1MO4A 2GA8A 3GJ8A 4B43A 2AR7A 1RJ9A 4W5JA 2WWFA 1F5NA 2RB4A 3LNCA 2B8TA 2B7CA 1M7BA 5P21A 1FW6A 2ZJ2A 2ZQ5A 1O3YA 4EPWA 3F0TA 5E95A 3C8UA 3EZ9A 2IS1A 4M21A 2EFGA 4A1FA 4D6PA 2CNWA 2QM7A 2UZIR 1KI3A 1UPTA 1KHTA 3OIUA 1NN0A 2GNOA 4LYHA 1ONBA 3HR8A 5EE0A 4P32A 1DAMA 4TLEA 3CBQA 2JJ2A 2AX4A 1UAAA 3K0CC 1W0JD 3KJGA 1CLUA 4C3ZA 1KKMA 2QP3A 1KI9A 4BZPA 5KPDA 4DCTA 4XTCS 1G17A 2ZJ8A 2FN4A 4IVPA 2JIZD 1GNRA 1EFCA 4JYCA 3EC1A 4BECA 4C0KA 2J59A 5JFGA 4MYUA 3IGFA 3TVDA 1XXHA 3HU2A 1SQ5A 2PZGA 3A1VA 4QNRA 2IT1A 3C7KA 3BE4A 3LAWA 4I99A 2PLRA 5CK5A 2C8VA 4DEYA 3RS2A 3NDBB 4WA7A 1II9A 2ECKA 1M34E 2C99A 4DLVA 1DE0A 1P9RA 4QHYA 1VG1A 3D31A 2CL6X 2JA1A 5DI3B 2XJ9A 3CNNA 2A5GA 2PL3A 1LB1B 5BYKA 4B3CA 1XD9A 1JEDA 2J0UA 2PMKA 3AF2A 4ZCLA 3B1WA 1GZSA 1KI1A 3V00A 3UMFA 1T0JB 4NCIA 1KDOA 3TMKA 3LBIA 3OE7A 1OHHA 1CU1A 3MWJA 821PA 4GFDA 2H7VA 2F3RA 4LCBA 2J0SA 3OFNA 5CM8B 3LVQE 1JBKA 1N5JA 1KK2A 1NIJA 2CL0X 2ZVQX 1U98A 4BLSA 5F2EA 3AGPA 1E0KA 2OCAA 2IXGA 3TR0A 4NCJA 2B8WA 3GLIE 4L16A 1Q12A 1W4CA 2X19A 1UKVY 2Z0MA 4XSHA 1E2GA 2PH1A 5C4GB 5JRZA 2P3SA 4MRRA 2GVDC 2FNAA 3AKCA 4AI6A 5FPHA 5BN5A 1UF9A 3ZH9B 3LV8A 1FNNA 3U3RA 4O3MA 3GEIA 5KDDA 4JBYA 4W9MC 4GI7A 2HV8A 2WKRA 3VR2A 5EP4A 4QKQA 4XVRA 3VR6A 3GLHE 3DPUA 4KLNA 1FP7A 3KJHA 3TW8B 621PA 2DHRA 4DDUA 5J47A 4KI0A 4JLJA 2DY1A 1KI8A 4ZO4A 4B6FA 4QGFA 2WWIA 4HLUC 5KNBA 2E87A 4HAUA 3RC8A 2P5SA 3X1WA 2YINC 2VRWA 1GRQA 1N5LA 2G9NA 3PITA 4PQRA 3Q7QA 5FUXA 1W36B 3O8DA 1CULC 5CJ2A 3FWYA 1J8MF 4QM6A 3EZ2A 3QXJA 4F4CA 2WAXA 1GRNA 2R6AA 1FX0B 2JJ8A 1TX4B 4Z8XA 1NLFA 2WSMA 4CEHA 4C4PA 2XB4A 3MWLA 2MSEB 1KAOA 1Z6GA 2ZI3A 4G0NA 4URWR 5G3YA 2DCUA 1WDTA 5E7IA 2G77B 1NSFA 3QBVA 4PPNA 5LD2C 2JLQA 5GJBA 3L0IB 3CRW1 4N3NA 4I1VA 3EWSA 2R9VA 1L4YA 4PC7A 3X2SA 5L3SB 4LHVA 2P67A 3JZMA 1U81A 1WMSA 4PSVA 3SFVA 2F1RA 2WPDD 4PSAA 5EP1A 3RRZA 1LV7A 3P32A 2ZYVX 3F5FA 3GJ5A 5KDOA 2IXFA 1AKYA 2JJ1A 1M6NA 2UKDA 3B1ZA 3T1TA 1D8TA 4MGZR 4P31A 3UPUA 2CK3A 5HZKA 2YC4C 4LRWA 4DB4A 2AD5A 1VECA 4K8OA 1N5IA 1QHSA 4R9UC 1Z6TA 4A8JB 5IK2D 2QBYB 4WXPA 4G1UC 5FPSA 3W6OA 4B73A 4MRPA 3AVVA 2ODBA 3VTKA 5JJKA 3A4LA 3U44B 3A6PC 1E2FA 4US0R 4XSGA 3I61A 2WOOA 3ZIAA 2CEAA 4I1SA 4QFMA 4V0NA 1GITA 1XTQA 4AYWA 1G16A 2ZRKA 3U3KA 1P4SA 2WWGA 2X8AA 2IL1A 4Q7KA 2BWJA 4B2IA 3TQFA 4DCSA 4EJSB 3ZZUA 1NMZA 1GFIA 4AWXA 2FG5A 4UJ5A 1G41A 2AN9A 4IDQA 4JKIA 1S8FA 1CJKC 1MH1A 5BYJA 1JQLB 4RFSB 1OE0A 2VP9A 5AUNB 1AS3A 1IXRC 1VYVA 2BMJA 4KCGA 1HQYE 3A1SA 2OBLA 2G88A 1RYFA 3FE2A 4S2EA 3NH9A 1J90A 3K70C 2JLXA 1TQ2A 2QTFA 4RVCA 5JCPA 4DCVA 2ZUBA 1T91A 3AF3A 3LW8A 4JVNA 4XWOA 4CT5A 3GEHA 2IEZA 4AG6A 2CHGA 2OE2A 1E2KA 2QP4A 3HJNA 2CLCX 1O87A 4UNNA 2AD1A 2V54A 3RYTC 1XCGB 2BKUA 2FZLA 3R8CA 2I3BA 5AJZA 3TBKA 1JECA 2WBLC 5L3QA 1G3RA 4TL9A 1G3UA 3OIWA 2GEUA 4NZYA 5JSZB 3SJCA 3THXB 3IQXA 3RS0A 1N2CE 2OEPA 3Q8XB 3OAAD 2KBEA 2QPAA 4ZDJA 3ONWA 1S0UA 3EIQA 5G41A 1FZQA 2RGNA 2YWFA 2IYUA 4GBMA 2EYUA 4OQMA 3GJ4A 1NKSA 1COWA 1XU4A 3CF6R 1NBMA 1YR6A 4CEIB 4P3YA 2GJ9A 4XWAA 3RS4A 2OBMA 3IBYA 2OG2A 2RCNA 2OXRA 2G83A 3LD9A 1N0WA 3OEHD 3WBKA 2QI9C 3TH5A 3HU3A 1Z0KA 4ACAA 2QN6A 5SZKB 1XCMA 1QHGA 2IC5A 2R8RA 4V02A 4HAVA 1KMHB 1ZJ6A 1R0XA 1TF2A 1P7CA 3TE6A 5TV2A 4ZCIA 3AUXA 2Q21A 2PJRA 4JIMA 5CB8A 2JCSA 3EA0A 4QXAA 2WHXA 1QHIA 3GJXC 3VX4A 3AKEA 3LWNA 4WZ6A 2R6FA 3QJYA 2FFAA 2IHBA 3KUDA 4MDFA 1AN0A 5BN3A 3CX6A 1WE2A 1D2MA 2EWVA 4A0FA 4OI0A 4DVGA 3B9QA 1SXJB 1CRQA 3SDZA 2F1IA 1H8EA 1VKJA 4LYJA 3REFA 3FGNA 3KKMA 4EDHA 1E0SA 2FGKA 3CH4B 5GJVC 2ORIA 1Q1BA 3OEEA 4LYAA 2WAYA 4HAZA 4OYHA 2C9OA 1Z63A 4KSCA 3KKQA 2XEXA 3TGPA 1SVWA 1N6NA 3QIAA 1PLLA 5SZHB 4KBFA 1JQJC 3WMFA 4A8JA 4ESHA 2ZU0C 2QBYA 4A15A 1NJGA 2GKSA 4Q4AA 2GF0A 3F8TA 3C15C 4GT1A 4JLNA 2NO6A 1CEEA 4B3GA 2G6BA 1ZUNB 2RGDA 4MUAA 4XH9B 1TPZA 1JR3E 3A1WA 4JJKA 4DLXA 3SS8A 4NYMQ 4F93B 5M04A 3SC3A 4EJSA 1N6OA 3L8YA 4F38A 2G0TA 4BFYA 1KO4A 2HT6A 2QSYA 1DS6A 2PX0A 4ZDIA 1E9SA 4HLDA 4PX9A 4JL8A 1GKUB 3CR8A 4TTQA 1NMYA 4L8GA 4XVQA 1KK3A 2X2FA 5CYPA 4D82A 2WSSA 3B82A 4MYHA 1KI6B 1VCOA 1G18A 4I1OA 1JB1A 2V7QA 4B3DA 3LLUA 4B74A 1E32A 3I62A 4AYTA 4XD7D 1UJ2A 1MO5A 4DT1B 3HU1A 2NIPA 3K70D 2QGNA 2ZE6A 1GILA 4KFTA 5DO9A 2FMXA 4N1AA 2XSZD 2MMGA 1DAKA 1OXSC 2WTUA 5HZHA 3CRMA 2BV3A 3LO5A 2IS6A 4PO1A 1TMKA 4L9WA 4HYYA 1GVNB 1Q1EA 1E79D 5KU1A 3FTQA 1G7SA 2J0VA 2PMDA 5L3RA 1GUAA 4URUR 5FFMA 4QJ3A 2O8EB 1W36C 1D5CA 1N3BA 5JZVA 3VHXA 4P4TA 2IYVA 2GESA 3MGCA 4URYR 3FMOB 5A5GA 3WYAA 3O47A 3HPRA 3R9WA 1BYUA 1E9EA 3BWDD 3X1ZA 4D4KA 4UXIA 4Q4JA 4CEIA 3CLVA 2VF8A 4TMVA 1IJFA 4ZI3A 1EX6A 3R8FA 3T61A 4EKDA 1E1RA 3JVVA 4C0QC 2EYQA 2QEQA 1T4GA 4Q4HB 1AKEA 2GRJA 3ZVNA 4OQXA 2FSFA 3U7GA 4NE2A 4CT4B 5JLJA 2X77A 2ATXA 2V1UA 3QKTA 2FZ4A 1KMHA 5KSOA 5AK0A 1T9HA 1MKYA 5JHHB 4LSGA 3PUXA 3VR4A 3WBJA 2CL7X 3VMFA 1U0JA 3S1AB 1CXZA 2QL6A 1II8A 1LNZA 2J46A 2J3EA 1XXHE 4LBZA 5CLQA 5FI1B 4UXHA 1NVUQ 4WW0A 3W5JA 2G0NA 4LC1A 4F92B 3CNOA 2GJ8A 1T3HA 1AIPA 1Z2CA 4OK5A 2KSQA 4B76A 1SXJA 2LCFA 2YWEA 4M0LA 4HAXA 4D81A 3ZLJA 4YMWA 2J7PA 1W47A 2RKOA 1BH2A 1G21E 4NONA 2P0EA 2JASA 3RS7A 4KVAA 4Q7JB 3K9GA 2FOLA 2VPPA 1ANKA 3IIKA 4OJKA 5KNDA 1NP6A 3SQXA 1ZM2A 2ZITA 2FSHA 3WNDA 2LKDA 3FOZA 1YRBA 2GXAA 1QHHB 2ZR9A 1XTRA 1OFHA 1XDBA 3QF7A 1TU3A 4G5SA 4WOPA 5KDLA 3P27A 1ELOA 2XOKA 4JVMA 4L4UA 2ZANA 4QJ4A 4ERNA 3MG9A 1RJ9B 4C0AC 1W5SA 5JI2E 5FPTA 5FOXA 2W0MA 1S4QA 4NH0A 4E09A 1IBRA 1ZVQA 1GKYA 3H86A 1OYYA 2XTZA 3NHBA 2BC9A 4PPGA 5JRJA 2GXUA 4HDQB 5J4LA 1ZM4A 1OJLA 4FXPA 4UNPA 1MR3F 2ORVA 3GCGA 3PCRB 4C2UA 1OFUX 5LPNA 4ZCMA 1GNPA 1KI6A 1YRAA 1NVWQ 4WBSA 3BRWD 3U6BA 1NLZA 4Q9LA 2BBWA 2W6JA 4OI4A 2Z5FA 2BMEA 4IVRA 4DT1A 3L8ZA 1EFTA 3QXSA 3EA5A 2YOFA 2XZLA 3C5CA 5CM9C 1KDPA 4D0LB 3IEVA 2QRZA 3KXIA 1IM2A 4L5BA 1W46A 1IN6A 1Z83A 4HI0E 1OIWA 2ZI6A 4LJ6A 1HV8A 1E4VA 2VF7A 4EUNA 1WF3A 2QAJA 2YZ2A 2DWQA 4PQYA 3THWA 1DARA 3LFUA 4Q1AA 2Z43A 1HH4A 2W2XA 1XMJA 2F9LA 1SGWA 2AKAB 2FSGA 3DVLA 3QVUA 1Q1QA 2O8EA 1FP6A 3KJIA 4QBHA 5F9HA 1W36D 1EFUA 2HDNB 2ODNA 2J0UB 1J7KA 2ZE5A 1UADA 2JDID 1R5NA 3SBDA 2H5EA 1VCNA 2F6RA 4RSGA 1Y63A 3LXRA 4BASA 1YE8A 5EE3A 3PVSA 3TSWA 3TSZA 3C41J 1XZQA 1DVRA 1KO1A 4JBWA 4QRHA 3ND9A 2WWXA 2QROA 4LV8B 1NL3A 1UBCA 1YR7A 4Q4HA 1FMJA 1X8JA 4Z54A 4IOJA 3CRQA 2B7BA 3AVOA 4GOXA 1E99A 1RE0A 4PFSA 3ZGXA 4F4IA 1KO8A 721PA 1Z07A 4Q03A 5DYGA 2QMUA 4HZUA 4OK6A 1G8PA 1L7VC 5EQTA 1XJCA 2RHMA 2C78A 1RYHA 2KB0A 4MQBA 3X1DA 5KHOC 3ECCA 4N0DA 2XGJA 5LDDC 1L2TA 1DO2A 3TAUA 1ZNZA 4KYUA 2K5UA 4BGDA 2W0SA 2YV5A 1UDWA 4ILEA 2FU5C 3N2EA 1BMFD 2G1JA 4YXWA 2JEOA 3B85A 3EZ7A 5DGXA 1AS2A 1ZCBA 1OB2A 2PCLA 5FBVB 5LB2A 1R5OA 1FFHA 3QG5A 1E2DA 2FX3A 4E07A 3DMDA 5JS8A 2VP4A 3SFZA 1ZUHA 3A36A 1ZP6A 1WXQA 1US8A 2GBLC 4RY2A 4LV5B 3WRYC 3RANA 4A0RA 2BBTA 3U7EB 1X86B 4GDFA 3KKNA 5E7MA 1UFQA 1GG2A 3ADDA 3R9IA 1I4LD 4B3XA 2FFBA 4BFZA 4G01B 5HKKD 2C03A 2J7KA 3MFYA 2XNDA 4WVFA 3VQTA 1DG3A 4CEHB 4TQ9A 3SYKA 1E0JA 3KL4A 2FFQA 1EWQA 3JVUA 3RS5A 4TT3D 4U7DA 5J5CA 1S9DA 2O8BB 4KO8A 3ZS9A 2VHUA 4BLOA 1R8QA 3K09C 5EXTA 3CNLA 5FR2A 1NG1A 5CDFA 4EPYA 2ODEA 1E6CA 3G0HA 4D25A 1W4RA 2OLKA 5EXSA 4YMTA 3KB2A 3TJZA 4EPVA 3CWZA 1JPJA 2J5XA 2OFXA 1CJMA 3UATA 1OKKA 4NYJQ 1XP8A 2GJSA 5KNCA 4BQSA 2NO9A 1KTVA 1HY3A 1XTKA 2IBMA 2ZRHA 4V0KA 4DSUA 4US2R 2XZOA 2XAUA 5FL7A 4AIIA 1KSFX 4TL7A 1NBME 2C77A 1UKZA 1G20E 2VEDA 4NCKA 2ORWA 4P4UA 5KYKA 2GVZC 3QEJA 1L4UA 5DN6A 3AKDA 3U60B 2G3YA 2VL7A 3TNFA 1P2SA 2CJWB 1E2HA 1G3MA 1EGAA 2DFKB 1AGRA 5FTMA 5ELXA 3FMPB 2O52A 4IEEA 5F98A 1DBSA 3AP2A 3K0AA 3ICQB 4AKHA 4M1OA 5DLQC 2D7DA 1J2JA 2BJWA 1GSIA 3ZJYA 2NTYC 4ASUD 2E1RA 1G8HA 1G6HA 4HSEA 2F1HA 4PANA 3RDPA 1DG1G 3M1IA 1OF1A 2DBYA 4BLRA 4DUGD 4RZ2A 1JAIA 3Q85A 4DBLC 1TF5A 1OIVA 4DZZA 1XTJA 5FTNA 2XZPA 1XD2B 3CW2A 5D3QA 3DKPA 2B92A 5FOSA 3GJ0A 1AM4D 4NYJR 3U2QA 3NEJA 3R7WB 3WYFA 4PQFA 4OHVA 2AWNA 1GKIA 1G4AE 1U8ZA 1GTVA 1Z28A 2J0QA 3NHAA 3VKGA 1F2UB 4WIAA 1ZD1A 5DSZA 4BFTA 4TSFA 3CRRA 3E1SA 4IDHA 1SVMA 4UNRA 3BC1A 4IXMA 3JZAA 2BBOA 4IJMA 3GFOA 4KV9A 2FJUA 3FKSD 3QXHA 5EUQB 5HCNA 4IDNA 2EW1A 3QKSA 4PC3A 3CPEA 1G3QA 1T5IA 1NI3A 4TYPA 2ZRIA 1OFIA 1Z6XA 3P4XA 3I32A 4LWZA 3C5HA 4XIGS 5L3QB 2GHIA 3IHWA 5FOWA 3THYA 1YVDA 1GOTA 1KMQA 5JEEA 1IN5A 1KY2A 3Q72A 1EFRA 2ZEJA 2WJYA 1EX7A 1I2MA 2V6IA 3CPHA 1RZ3A 1ZC3A 4G3XA 1W4BA 1W5TA 3E70C 2ZRMA 2B6HA 1QG4A 4GPTA 2OZEA 4GMXA 1E9AA 5EJEA 4RZXA 3MAAC 1KO5A 4RD3A 4U02A 3WNCA 4H1UA 5DH9A 3UMSA 2W83A 4JJZA 1NF3A 1Z08A 3A58B 4BPBA 1ZRHA 3LXXA 1CTQA 5BN4A 3NDPA 5C4MA 2IYZA 2HF8A 1Z3IX 4Q00A 2AXNA 4OBEA 4R2IA 3B8HA 4ARZB 2PZFA 3H4MA 3LBHA 3QE0A 4NCHA 2IUTA 2G1KA 2IS4A 3ZZ0A 1RPZA 1E9RA 2F1JA 3UXMA 2LKCA 4BZXA 5J4YA 1DAHA 1N5KA 2ZRAA 2JLWA 2O8BA 4FCVA 4Q4LA 1VCIA 4JYBA 4N0EA 3ZQ6A 4EQ6B 2VP6A 3L82B 2C96A 1CJVC 1H8HD 2IUSA 2GDJA 3AVPA 5SZJA 2X2EA 2PCJA 2Z83A 4JLAA 2QQ0A 3QUSA 3GMTA 1Z47A 3U3MA 1DAGA 5DI9A 2WM9B 3D6TB 2NZJA 1SHZA 3FHCB 4V0MA 1R4AA 3RSLA 1XEFA 1BS1A 4FW9A 2IWRA 5E7JA 4TYQA 4DLZA 1OXUA 4AKIA 4TLAA 3FMFA 3FFAA 2ZU6A 2ZRNA 5SZIA 3DM9B 1NY5A 2EQBA 5FR1A 1WQ1R 4US1R 4A6XA 4IFEA 4F91B 4LC0A 3AUYA 1G19A 3U7HB 2VP5A 4PO9A 2CJWA 3EG5A 4NHOA 2BMDA 5AR1A 1J8YF 4DRZA 1L8QA 5DIFA 5EZ6B 4OHYA 1T3SA 2EU8A 4Q4AB 4TMZA 1M74A 2BCGY 1JAHA 1QVRA 3I72A 3V4RA 3EXAA 3FB4A 3P20A 4XTRA 4CDGA 1E98A 2BOVA 3KZ1E 3BB3A 2FF7A 1R7RA 2Q0HA 2EFDB 2ZTSA 3UG6A 2C98A 5GADl 4OQLA 4FMCF 4MKHA 2GETA 1Q3TA 3AVWA 1Q1ZA 4FMCB 3UWKA 4O2LA 2R6GA 1M8PA 1XD2A 3IEUA 3O8BA 1H65A 1SXJE 3RWMB 1CP2A 1FL9A 2RAPA 2QT0A 2BVNA 3QVVA 2H57A 4Z1MA 3WMGA 5FTLA 3B7GA 3FMIA 3N2IA 1KK0A 3R7WA 4Q1BA 3GJ6A 5LB4A 2Q3FA 2GZHA 2IYWA 4OQFA 1PVOA 3U4QA 3H84A 1F2UA 4TTPA 1FMLA 1XEWY 1JR3D 4M9QA 4D26A 5FBWB 2ZS7A 1S96A 1VTKA 2QAGB 3E5HA 1YZLA 5GJCA 2YYZA 3W9YA 2GJKA 4Z51A 2RMKA 4TTRA 1Q22A 1CKEA 1W44A 4MA4A 1FQJA 2YKGA 4TYYA 4TZ6A 1B0UA 2FEMA 4JT4A 2FSIA 4RCZA 1CR2A 1HURA 1G1MA 1LF0A 2J45A 3IKJA 1S2MA 4ZDWA 4M2LA 1JNYA 2QE7D 2VHCA 3DM5A 1C9KA 2FPLA 3C4JA 4EFLA 2UVQA 3WNBA 2D06A 2ZRDA 3W90A 5TY0A 1DAIA 2VHTA 2CLDX 2A5DA 4TL6A 3MWKA 2ZRPA 1PLJA 4Q19A 5K8IA 1ETUA 3LBNA 1OFTA 2F3TA 2FE4A 4DC9A 1J70A 2HLDA 2H1LA 3LLMA 2J41A 1NVXQ 4M1YA 1OH7A 1OLOA 2PEYA 4LPSA 4Q4JB 1CF4A 1VYTA 1SHKA 5JWRA 1XJQA 2GZDA 3UWOA 4CZ2A 1KK1A 2BM0A 2ZRCA 4K46A 4TLCA 4OHZA 4TZ0A 5G53C 1RRPA 3HYTA 4BLTA 4R71A 3NKVA 4MYTA 2GF9A 1XTIA 1KJZA 3QF4A 4PPQA 4Q48A 2O5VA 4UXJA 4L9SA 5FBLB 3U3OA 4ARZA 2QSZA 4JLKA 5KO2A 2ZSEA 4BFUA 1KGDA 2IW3A 3EZFA 3MUFA 5AWFC 4DEXA 4XVUA 1CRPA 1II8B 2CNWD 3A8TA 4X8HA 3IO3A 1MRNA 3SN6A 1IXZA 1N0UA 4D2IA 1HT2E 4EQ6A 1G5PA 2RGXA 2F55A 4LJ9A 1Z6YA 3MWYW 3VFDA 4E03A 2JJ2D 2AHOA 4NYIR 4R2HA 1Z2AA 5EE1A 1IY2A 3DMNA 4UQOA 4QNMA 4LPKA 2P6RA 3MLEA 2ZXUA 2XJ4A 2FA9A 1BO6A 2JLUA 2ERYA 4X8OA 5EXXA 1EESA 2QUZA 2DFTA 2CVHA 2EFCB 1W2HA 2WMOB 1T8UA 3I73A 3KFXA 4HB0A 5C2JB 1HT1E 5B2ZA 3TAHA 2OFOA 3LH5A 4C30A 4DSOA 2Q3MA 3TVTA 4HUTA 5FUWA 1ZU4A 2GK7A 4W7SA 2RGAA 1ZW6A 4TMTA 2A5JA 1II0A 4DDTA 2NPFA 2W6IA 1QBKC 2BMFA 1FPMA 3SE0A 1TADA 3ZD7A 4HAWA 2VA8A 1GRRA 2O8CA 4FMDF 2CHVA 1E1QA 3M4YA 1P60A 421PA 1IONA 1A2BA 1PLKA 1W0KA 1YR8A 3EARA 2HUPA 2REBA 3OE7D 1ZMXA 1OHHD 2AFIE 4JS0A 3RSOA 4DLWA 3BAFA 2IUUA 3C16C 1LTQA 1NN1A 3OFND 3OIVA 3QBTA 1YZUA 3HR7A 4B75A 4EPXA 3PUZA 2DB3A 4OKSA 1SZPA 2I1VB 3QXCA 5EE5B 1CR1A 4AY2A 2YOGA 5K8UA 2IS2A 2OAQ1 3AP1A 2VIIA 3T06B 1OXXK 3A37A 3BS4A 5CIWA 1F48A 3CH5A 1W49A 1UKYA 4LOAA 1ZU5A 4L15A 4MKFA 4A4DA 4YMUA 1U8YA 5HE9A 1XB2A 1SVSA 4Q9HA 3GFTA 4HUQB 2QAGA 3PENA 5FUYA 3CONA 2GCPA 2Q9BA 2IYSA 4KVGA 3A1UA 4Q1FA 4D0NA 3GQBA 1OH8A 1XEWX 2O8FA 1MOZA 2QPTA 1DO0A 1AA9A 3THWB 1MRSA 3WP1B 4I81A 1VYUA 2BHRA 3FKQA 2RGNC 3W3AA 3B9PA 4LHXA 4HLCA 2D2EA 4AK9A 2QTHA 1QZXA 1R5BA 3B5JA 2MMCA 1MT0A 4NMMA 1XWIA 3QXXA 2GAAA 2ZAMA 3SNHA 3WHLA 1AS0A 1NVVR 4PC1A 2HCJB 5CDFE 1OH5A 1BYIA 2CBZA 2BKEA 4D4LA 3SYLA 4H9GA 3DOEA 3PV0A 4NBSA 1ZAKA 1SVLA 5HTKA 1LS1A 4NDZA 3EZ6A 1EXMA 3SEAA 3EX7C 1LFDB 3Q9LA 4FWTA 1PUIA 3NBFA 5KSYA 1W0JA 1XD8A 4MITA 2IA5A 2CE7A 5CK4A 4RD4A 2WKQA 1DELA 3KQNA 1P62B 2FEOA 2AK3A 3SU8A 4UNSA 4YDHB 2JIZA 5UKDA 2DWOA 1TQ4A 4B35A 1U9IA 4CRWB 2C95A 2VBCA 2ZJ5A 2HCBA 3QEOA 2D7CA 3K1JA 1E2QA 4FWIB 4HDCA 2BJVA 1U90A 4FIDA 4A36A 1W4AA 3K9HA 2NO1A 1R6BX 1I4TD 1SULA 3KXKA 3T15A 4JLBA 3K0EA 4HZUB 4NU0A 2JLVA 1W7AA 1QF9A 4BFWA 1JXOA 3BH7A 3ZYCA 1CJUC 4LYFA 3V4FA 4XOIA 2YNMA 4DB2A 3PEVA 3QPWA 1TTTA 1QHYA 2WJIA 4IDPA 2JJ1D 2PT7A 1Z29A 4DWJA 1QHXA 4AURA 3GLGA 4P4SB 1U8AA 2CK3D 1JPNA 4A8JC 4QGGA 4DXAA 1ZM7A 1TEXA 5JJLA 4DDVA 3I1FA 4D4JA 4BWYA 4GNKA 1XMSA 2GCOA 3ADKA 3BFVA 2YJTD 1PV4A 3R9XA 3AVTA 1YZGA 2OBNA 4B44A 3ZIAD 1IHUA 4D0GA 1US8B 4K81B 4MGYR 2FGJA 5DYIA 2YWHA 2RGCA 3FKSA 2GEDA 2W00A 1BOFA 3F3YA 3T5DA 4EJSC 1U94A 2EVWX 3MRSA 2Q9CA 4Q1EA 3T1VA 1RIFA 1U99A 2JAQA 2VHJA 4TYNA 4FINA 1YR9A 2OILA 1M7HA 3HWSA 5HR5A 1MV5A 2ONKA 2OHFA 4LZZA 1E94E 2ZM5A 2IYTA 4QHTA 1DTSA 1P9WA 1OIXA 4NP6A 3EC2A 1IJEA 4PR0A 3KTAA 1GIAA 2QPOA 4RCYA 3BFXA 5KSPA 2R44A 1YZKA 4AKEA 1AZTA 1G6OA 2WMNB 3MSXA 4D4MA 3UANA 1M7GA 1A82A 4ITRC 3KQLA 4EFNA 1KI2A 2CXXA 1X6VA 4ZKEA 2XXAA 1G7CA 1KSJA 1D2EA 3AB3A 2VSXA 3X1YA 4Y0AA 3IO5A 3ADBA 5B57C 1TAGA 1E9CA 1CBUA 1MO3A 4YC7A 4HUQA 2EWWA 1HTWA 2HEIA 4Q47A 3ICEA 1NKTA 3MD0A 1VDZA 2DPXA 3P1JA 1W2GA 2B21A 1MABB 3LDAA 1GL6A 3RRYA 3ZZTA 2A3RA 3SJBA 3TSOA 4BLQA 1IN7A 1C4OA 4QBFA 3AEZA 1KO7A 4B32A 5CB6A 3SJAA 2HT1A 2DFNA 3K0AB 4Q1DA 2NPIA 5J4KA 3D3QA 3RAPR 2UZ3A 3DKVA 3I5YA 4XWKA 2HXSA 4DLTA 3N5CA 3AGQA 5IF9A 1UKEA 1COWD 4QL3A 1SKYE 2CDNA 1NBMD 1N6PA 4DLUA 4M8NE 2OLJA 3OESA 2WICA 1UBEA 3ASYA 2WPDA 3CR7A 2PT5A 4X8LA 4NTZA 5EP3A 1EG7A 3KQKA 3A4MA 3SI7A 3O8RA 2R6CA 2VO1A 4KLZA 1NSTA 3SZRA 4DJTA 4JL6A 3ZS8A 3NH6A 4YMVA 1ZINA 2XTMA 4TQAA 3EPLA 4KFUA 4V0ME 4RD1A 1D9ZA 1XX6A 2I1QA 4GP6A 4HDOB 5FUVA 3GEEA 3K0CA 2QA5A 4LHZA 1NRJB 2ATVA 2OO7A 5IK2A 4IHQA 4KFRA 3L0OA 4U5XA 3BFKA 1EWRA 5A0FA 2VSFA 1S3SA 1ZBDA 1K6MA 1VMAA 4PXAA 1FQKA 4Q18A 2GXQA 5KOYA 3THOA 3MCAA 1KJWA 1SXJC 1V43A 4LHYA 2AKYA 2R2AA 2PZEA 3QKSB 4NL4H 3GFPA 4YQFA 2IYXA 2JLSA 2XTNA 4JLMA 3CZQA 3BH0A 1H8ED 2PLFA 3NG1A 2ZROA 1U0HC 3NBYC 5DISB 4BE7B 2WJHA 3OEED 1AJEA 5AUOB 1XBTA 3BOSA 4FCTA 3LRPA 3THYB 2OT3B 4C0HA 4KU4A 3U3JA 4D80A 4P4SA 1ZUIA 3FVQA 5TMPA 2W2TA 2JLZA 4C0JA 1M2OB 4WXRA 1IN4A 3W6PA 3SYNA 1E3MA 2EFEB 2RGBA 1U0LA 1AZSC 2DWPA 2ERXA 2F9MA 3W8NA 3FDIA 3WP0A 1N6RA 1P5ZB 2NQ2C 2PJZA 5FH9A 1OYWA 2JLYA 1VG8A 1YQTA 5G3ZA 1A2KC 4Q9IA 5TXGA 3C14C 4UKDA 1N6IA 1OT3A 2ZAOA 3AV0B 1HE1C 3DHWC 4PAOA 3VAAA 1WB9A 4MDEA 3O8CA 1WBBA 2IF0A 4PHGA 1FUKA 5DHFA 3BXZA 3VR3A 1WRBA 2GTPA 2A9KA 1E2EA 4A0GA 1Y3AA 3D8BA 2WJVA 4CVNA 3AVXA 3ZDQA 2ZI9A 3AP3A 3GPLA 2ZSAA 2WZQA 4IRUB 1VPLA 1ZM9A 2WSSD 1SKYB 4LI0A 4HB2A 4YONB 4KSBA 5TVKA 2ZYUX 1GNQA 4JKYA 3RRMA 4Q5IA 3OAAA 2V7QD 2HJVA 5EXPA 3GLFA 4EIWA 1P2UA 2V4ZA 3AF0A 2HYIC 3PFIA 3PQCA 1G8YA 4PZZA 5BW8A 4ZPXA 1Z0FA 3HPQA 4HLUA 3IBGA 3SJZA 5AJXA 3RC3A 2P2LA 3FHTA 3DZDA 4POAA 1B23P 4AD8A 2DYKA 2QQEA 1ESMA 2ZJOA 4M1TA 1A5TA 5TB5A 1S1CA 3OEHA 4GOKA 5AJVB 1RW4A 5JBQA 3RVBA 5A4JA 3IIJA 2R62A 3T1OA 4Q01A 3PXGA 4RD0A 2GK6A 4TMWA 1TQDA 1NNEA 1NMXA 1MABA 2AWOA 3VR1A 4AKGA 4M1WA 1TU4A 5HPYB 3H1TA 1KSGA 3P26A 1JI0A 3EASA 2F43A 3K0FB 1P2VA 1GL9B 2Z6VA 2IYRA 1YHNA 2VP0A 4YLGA 3W5IA 2A30A 2A5YB 1G64A 4KODA 1RRCA 1AQYA 1N6KA 2ASEA 5FTJA 3BORA 2ODWA 2RGEA 1ZM3A 3VNVA 5JI3E 2C04A 2DFLA 1JJ7A 1PUJA 2PEZA 4MRSA 2KI5A 1UEJA 3AQ4A 1Z06A 1D2NA 2O0JA 2HJGA 4S35A 1E1RD 3CO5A 4PZYA 4TL8A 4WZAE 2CE2X 2QGZA 3A1TA 1JJVA 5IDVA 2ZJBA 1RKBA 1A4RA 2ZI4A 2ZRLA 2ZE7A 1ESNA 3KXLA 2ANCA 3ND8A 2IX3A 4M1SA 4B6EA 5F3WB 5H1YA 1CR0A 1DAFA 1CS4C 2Z4SA 3MJHA 3U4QB 3KKOA 2ZRFA 4G5OA 3NVAA 2TMKA 3DZ8A 2OFWA 3CF2A 3VU9A 3IDQA 5FPYA 3EPJA 2BCJQ 5K8LA 1G3IA 3GP8A 1NLYA 5HCIA 3AM1A 2CLSA 4E22A 3CF0A 1IQPA 4M9XA 2ZYTX 2R65A 1SXJD 1KJYA 4AC9A 1KOFA 4PC6A 3PEYA 1A7JA 1VCMA 2ZR0A 3G82C 1AQUA 5CJPA 4HZIA 2J7PD 3DDCA 1R10A 5H68A 3OZXA 1FNMA 2PBRA 2WVJA 3TUZC 4JL5A 1YU9A 1X8KA 1GAJA 3TK1A 4OHXA 3B13B 4Q21A 3EPKA 1Z5ZA 3TLXA 2SHKA 4DSNA 4A9AA 1YJ5A 5FBQB 1X1SA 1Z0JA 2A5FA 3P4YA 1IXSB 2QENA 5J4HA 3K8YA 1HEIA 2GZAA 1YZTA 4XD7A 5D3MB 5GVSA 1DAEA 1XMVA 2ZR7A 3RNLA 2XOKD 2ZRGA 5C18A 2XSZA 3HYRA 3K9NA 3TW4A 5FPKA 2JLRA 1DADA 3PEUA 4JLPA 4NPHA 2NO7A 4M9SA 2MSCB 3QF4B 3L0PA 1G5RA 4MGKR 4BRWA 1SVIA 4QG7A 1G7RA 1E79A 1KKLA 1E0AA 4OHWA 4PZLA 1I4DD 1TEVA 3EAQA 4DLSA 2REOA 2YHSA 1KY3A 4II7A 3T5GA 4A92A 4B3FX 2D4HA 5AJWA 4TYWA 2C9CA 2MSDB 3IILA 4ZIRA 2WWWA 5TARA 4LY6A 1HYQA 2W6JD 4LBWA 3NTUA 4MRVA 5KTYA 3EWAA 3BH6A 4LBVA 4QGHA 1C1YA 2AFHE 1E69A 4QHSA 3WRXC 2A2ZA 4A82A 4O0MA 4BFVA 1XJ0A 3W3ZB 3BD9A 2OESA 3QPVA 4Q9JA 1DOAA 3VHLB 4TMXA 1ODFA 4DHEA 1E9DA 3KDSE 4LHWA 2WWYA 4ZDKA 2C9YA 4RD6A 3H0KA 1XF9A 3QQ5A 3MJRA 1X1RA 4IDOA 4HEJA 4JLDA 3LQQA 1R8SA 3DO6A 2P6NA 3RRNA 3H2YA 3K0FA 5KPJA 2DR3A 1SKQA 8OHMA 1ZCAA 1ZD8A 1KYIA 2O8CB 1JXMA 4TWZA 3ZVRA 5IHPA 2VQSA 2I4IA 4RKFA 4LDJA 2C5LA 4NKRA 3ZQJA 5BXQC 2JATA 3RS3A 1WBDA 2GJAA 3OIYA 3ZD6A 1KAGA 4H1VA 1RFLA 2J1LA 4B47A 3IHLA 2J87A 4QC2A 1OW3B 3RLFA 3KQHA 1G8GA 4FD2A 1KI7A 4RD2A 4Y0VA 5TDHA 4EPTA 3GLGE 4MH0R 4A2PA 1OSNA 1BKDR 2BM1A 2GEVA 3GLIB 3KKPA 4KXFB 3GJ3A 2FPMA 1NY6A 1KNXA 5L8VA 2BDTA 2OM2A 3R20A 3QNUA 3AKYA 4U00A 4BUJA 4RZ3A 2D74A 3NWJA 1N6HA 2CVFA 4IEIA 4LX0A 3BBPA 3GJ7A 1F2TB 2L0XA 2QG6A 4I1UA 1VHTA 3GLHB 2ZI7A 4HAYA 5DI3A 2F7SA 3CIOA 2XITA 2FH5B 4UNQA 3UIEA 2O8FB 1WCV1 2XNSA 1G5TA 3KUCA 1N0VC 1XEXB 2VP2A 4YXWD 5EE9A 3VR5A 4BZQA 3E2IA 1RRFA 1W1WA 2BIFA 3I3SR 3PUVA 1EFHA 2QY9A 3KJEA 5CIQA 1ZYUA 5BQ5A 1AK2A 4NYIQ 2QRNA 4GMDA 1QHNA 2ZYWX 4RKEA 4TN1A 5JMTA 1VG9B 1LVGA 1SVKA 4X8MA 4JT2A 3A4NA 5GVRA 2H16A 3KX2A 4KYIB 3Q5DA 1G8FA 4DCUA 2ZI5A 3U61B 4LJ7A 4FI3C 5D3MA 3IQWA 2IYYA 3B1VA 2XNDD 1XPRA 1VG0B 1T5LA 2HXYA 4DIEA 2XB2A 2A7QA 1XPUA 1S9HA 2Z4RA 2V55B 4OL0A 4I4LA 2YVUA 4EFMA 4TQUS 3EIHA 3W6NA 1P6XA 5FL3A 3IPYA 4DLYA 4QM7A 1OPXA 3PEWA 4HLQB 3M6AA 521PA 3SHFA 4FCWA 4G5QA 4PHHA 1T0HB 3ZVLA 2OXCA 2R6DA 1E96A 4KBGA 4DDWA 2EFHB 5JS7A 1OKKD 4BLPA 1ZC4A 3CWQA 1Q0UA 4V0LA 4TMKA 2V6JA 4Q1CA 2W58A 3NIBA 3OHMA 1GL7A 4PHFA 5GJWC 2X1VA 2WKPA 5FL7D 4C7OB 1VIAA 3CPJB 4RFVA 3LX5A 6Q21A 2JGNA 4HB4A 3GLGB 5EUMA 1SVOA 2JDIA 4QJ5A 4CEJB 1FX0A 4B2LA 3EIEA 4DIDA 3QY0A 5DN6D 3CKLA 1NN5A 2GAOA 3VNUA 1S1MA 2H8KA 4IOKA 1RVDA 2LWIA 2Y8EA 2N42A 2D3WA 3PJRA 2GCOB 1PZNA 2O0KA 2FWRA 2WIAA 1JR6A 4PPFA 1QVAA 2NO0A 1Q20A 1DEKA 3FPAA 3SBEA 1YZNA 2ZJZA 1TUIA 2E9SA 1UBFA 5FOVA 2ZJAA 2YC2C 3I4LA 3NBZC 3QKRB 5L3SA 1E9BA 5JHGB 1D6JA 3CM0A 4GSYA 3WYGA 2N1BA 4LV6A 1TNDA 3PUWA 4IW3B 2KJQA 1KNQA 3AVYA 3I8SA 2P5TB 3WXMA 3LVRE 4LBYA 1M1YE 4A2QA 4AYXA 5JEDA 3QENA 5K8TA 5CITA 3K9LA 1FOEB 4FMDB 1KI4A 3B78A 1TUEA 2BEJA 2D62A 4QOSA 5E3HA 2FFHA 1NVVQ 1ZNYA 2ZUCA 4C0BA 1BMFA 1IY1A 1J99A 1KZGB 1IOZA 1T8TA 3KTAB 4YMSA 3ETLA 1DPFA 1XRJA 4ACBA 4TSFD 1R0YA 1CR4A 3PIRA 3U44A 2IWHA 1K5DA 3CRVA 3GLIA 1K5GA 3T12A 2CMKA 2N46A 3VKWA 2XXAB 1UBGA 3CB4A 1D9XA 2ZS8A 4M9ZA 5FOUA 1HQCA 3LX8A 5F9FA 2OCPA 2ANBA 2V8OA 3FHOA 4Q02A 3QSYA 2OCBA 1F2TA 3DOFA 5G40A 221PA 3GLHA 2QM8A 4OI1A 3J81k 1KZ7B 3QOFA 4PTLA 1YZQA 5DHAA 1HA3A 4C9BA 1WA5A 5HKKA 2CCJA 1P73A 1GDDA 3QG1A 2AL7A 1U2RA 2GILA 2J9RA 3EPHA 1EFRD 2IF2A 4TT3A 4RFSA 1XEXA 2BBSA 1Q44A 1QDEA 4GP7A 3NBXX 4LJ4A 4J0QA 4P33A 2OCYC 4Q9KA 1X3SA 3TUJC 1NG9A 1G9XA 3NEYA 2VTKA 4A0HA 1QRAA 4M4SA 2ZSBA 3LY5A 4GZLA 2QNRA 4C0LA 5EP2A 5H8WA 3GD7A 1K8RA 3LW7A 1GP2A 3HP1A 1JEEA 2KE5A 4PO8A 4WAUA 3GLFE 4E5UA 3ADCA 4LK2A 4KHZA 5JWHA 3B6EA 3TKLA 4URZR 4M22A 3UKDA 3Q5EA 1F6BA 1VHLA 2FV8A 4B34A 4F7WA 5AUPB 1JALA 3BERA 5B64A 2OSBA 4PAQA 4JBXA 1G7TA 4V0OA 2FPKA 1Q57A 1XFAA 5J40A 1V5WA 4LJYA 2NGRA 4JVLA 4KAXA 2OAP1 4NYMR 3HDTA 1CIPA 4OQNA 4FN5A 5JSZA 3THXA 2ZUDA 2WIBA 3IIMA 4Q66C 3UG7A 2VYFA 2ZE8A 1FUUA 1OXVA 2VHQA 1T6NA 3DL0A 1N6LA 4PHTA 2GXSA 4MRNA 3U7FB 3TRFA 4ASUA 4LJ5A 5DE3A 1OH6A 3QPUA 3NC0C 3D7MA 1E2LA 2HYDA 4DUGA 1AGPA 2NOAA 3ZVMA 4PC2A 3VX3A 3SHWA 1XMIA 2WWHA 4MKGA 4OI2A 4C7OA 1UDXA 1IY0A 1TL7C 3Q7PA 1GM5A 4GOJA 4ZI2A 4CEJA 4EAQA 2Q3HA 2QORA 5E4FA 4M1MA 2C2HA
chains in the Genus database with same CATH superfamily
1V3VA 4UAVA 1LPPA 5CA0F 2W2QA 3X1XA 5C1BA 2ZT8A 1Z9BA 4G81A 4HK4A 2G72A 1IN8A 1HRDA 1ZJZA 2A57A 2GM5A 3KLPX 1ISGA 3X2FA 1E4YA 2CZQA 1O03A 2EW2A 4MP8A 1XPOA 5CVVA 1QIGA 1UBHS 4PIMA 1LW7A 5A4MS 4CF7A 4CG2A 5IT5A 3O3CA 5CB4A 1SQFA 4KLCA 2Q8NA 2ZSDA 2D00A 3NT4A 5E9QA 5E2AA 4RGQA 2YYAA 4QEKA 1U4NA 4M37A 1FDVA 5KQSA 3OF5A 3KOMA 3STXA 4X60A 1KJ8A 5TQ0B 3MJVA 4HXYA 4BEJA 5FAKA 1TJ3A 1WPGA 3I8XA 1B4DA 1Q21A 3QX7A 5DOVA 4RM2A 3ZE7A 6LDHA 3KZXA 5JWOA 1ZSVA 1P39A 5A5DA 5CYGA 1X7DA 4PYIA 5F4ZA 3RK4A 3E4CA 1UXJA 1P2TA 2IRWA 3FLMA 1KJIA 1IHDA 3EFHA 5CNIA 3WLEA 5BORA 2OHXA 3ZWMA 1P3Y1 3ONNA 3REGA 3WJ2A 3EHEA 1W6RA 4JZKA 1T8PA 2IOYA 3ZDRA 2DBRA 1SJ9A 2R25B 1V7PC 2QAGC 2RAVA 5ICGA 3TLAA 2XYPA 3F73A 4NDNE 2HIHA 2LE0A 4LJ8A 1C3EA 3ONVA 1OLUA 2JFWA 2DE0X 2ZVPX 5AUQA 1U0OC 4KJZA 3WC4A 3ZV6A 4BZWA 4ZV4A 5J1SB 1TKAA 4IXNA 5HJ5A 3TG8A 3HE3A 4MR7A 4P38A 1B2RA 1RRGA 3SQWA 2P9TA 3B7WA 3ORFA 3CKKA 2QNBA 4F84A 3WYEA 2J67A 3KVNA 2P9HA 3R0XA 3L2OB 3T34A 4I36A 3AUAA 2V1XA 4Q3KA 3TIFA 5H3HA 3FLBA 2WV9A 2ZB7A 4QWMA 5A0VA 1C3OB 1WDWB 1RI1A 3T7JA 3VVCA 4KO2S 1IXKA 3DBHA 1W5EA 1CUEA 3ONFA 3T0FA 4GMKA 2SBTA 1KSHA 1ZI8A 2IHYA 2Q7DA 4BFXA 3FGPA 2YQZA 3U49A 4LOKA 4A2WA 3SOPA 1AE1A 1H8HA 2Q2WA 2VYQA 3ZNOA 3ABRB 2RH5A 2BFEA 2F00A 1X8LA 2XUQA 3GEPA 3OUUA 5DNAA 2H08A 1NUHA 2GBGA 3BSYA 3MMPA 3A1CA 2ZTUA 1U9IC 4L0CA 4O2RA 4XUEA 2PO7A 1YS6A 1PJTA 3C5VA 4ZPJA 3G17A 2BFCB 2AIRA 1QBGA 1P4HA 5LZ4A 3ER8A 2OXIA 1XXHB 3B1XA 4YJKA 4HS4A 2H8GA 4RFLA 2X40A 1G4UR 5ER6A 2RGGA 4BV3A 4ZT4A 3I5XA 4RZUA 1DDGA 3EQ7A 3JWJA 1I30A 4MQ4A 4C3OB 5DNYB 3T8YA 4PM4A 4FZ5A 3VU9B 5L95A 3A11A 3AH8A 2R7KA 1I32A 4R1TA 4JOCA 2UVDA 4PYNA 5BVGB 2QZ4A 2V7EA 4OKIA 5AVOA 1HO3A 2AS0A 1DV2A 3P94A 1Z6AA 2O0LA 3KPUA 2WM2A 1VP9A 3C3EA 1O9BA 1P9OA 4LKOA 3WKEA 1U0NA 4JLOA 4TUYA 1N5DA 4GPBA 1N9ZA 3U7JA 3GNSA 2ZIGA 4X90A 4YRPA 4DHWA 2JG3A 3GGDA 7ADHA 4KE7A 4YX9A 1ZNWA 1UODA 1P72A 5DNWA 4DQXA 3LBAA 2ZYIA 1KIMA 4KAFA 2WF9A 2IP2A 3FFBA 3ZJVA 1BJTA 1UEIA 3BGWA 4KGDA 5LLTA 2PE5A 4KNYA 4JI4B 1OXTA 1NBEA 4RJLA 5GZ1A 5JYDA 3B6MA 3SE7A 5F2KA 5LA6A 2R8PA 4H16A 4CW7A 3FYSA 3KFVA 2D2FA 2WTMA 2ZBEA 1P5FA 4QUIA 1QHEA 3RTAA 3N70A 4KGXA 3PG5A 1KVUA 3CT6A 2CWWA 3BQ9A 1E2PA 3TW0A 1QYCA 1LS6A 2W6ID 2ZJYA 1BIFA 4X1KA 5CT5A 3K70B 4UPVA 5B7GA 1XTSA 3B2EA 2LRHA 4N0MA 2YOHA 5KTPA 1GT6A 1E1QD 1E92A 1XNHA 1BQ4A 1YJXA 4Q7MB 2CXOA 1GWNA 2X4GA 4CCAA 3UAOA 3WK6A 1RM3A 3R7AA 3BXXA 4TKVB 2QMHA 1WULS 1J2YA 4NFSA 2GWHA 4F86A 3AL3A 1U11A 2QE7A 2GS9A 4CGZA 3U9LA 3GK3A 3EE6A 4JXZA 1S2LA 4Z4FA 2IDKA 3BB1A 3LMKA 1R6TA 3M0EA 3SMVA 2FPGB 3I39X 4IV8A 4M1EA 4TTVA 3HDQA 1L7OA 4MYCA 4U7GA 1NQVA 3DEFA 2HR1A 1HUQA 3IT3A 1R0CA 3G49A 1EJ2A 1SC9A 5A9RA 4PYJA 4KFCA 2X14A 4ZIRB 1P8JA 1RWMA 2AXQA 1Q3HA 2WWRA 2Z2JA 1QHHA 3QEMA 4NCXA 3ESRA 5CYOA 1PT5A 3KOOA 4IOMA 1Z8HA 2ZUVA 1S3GA 3K53A 2Z98A 4Y0NA 5HCUA 2BGTA 3LWBA 4RA6A 5F1YA 3ROMA 4EM6A 2HD4A 4N7JA 5TGZA 3HWWA 1B2LA 3Q3HA 2BEUA 3DEZA 4DYDA 1P9NA 1T15A 3F8SA 2RKBA 2CXSA 3C3JA 1HEYA 4F72A 1I2DA 2QDXA 1GQYA 4LI3X 4MUMA 5T8KC 1SBZA 1HBJA 1PO7A 1RJ9A 1KERA 1YGYA 1ZGGA 4W5JA 1LC3A 1U7OA 1YFZA 2OGUA 2WWFA 1EJBA 1NUAA 4HEA1 1NFFA 1D3AA 3EIXA 1BE6A 2PLAA 2B8TA 2B7CA 1SBYA 2IFTA 3R75A 2J9FB 3AW8A 5P21A 4BAUA 3PNMA 4NI5A 5EJMA 1FW6A 4BY9E 3GVCA 2XECA 1O3YA 3G1TA 4I9GA 2WP0A 3M83A 3C8UA 4BP8A 2QVLA 3EZ9A 4HX9A 2IS1A 1LJLA 1Z13A 2XYHA 3F74A 3Q9SA 2QR5A 2QM7A 2SICE 4MP6A 3W6ZA 1KI3A 1UMDB 4A0SA 5C8YB 1KHTA 1MAAA 1ONNA 1KQPA 1NN0A 1ZJYA 2H31A 2IZ0A 1R4NB 1UPCA 1E7RA 1DDIA 1IQRA 2RHCA 4R16A 1UP6A 3TO5A 1LZLA 1ONBA 3QWBA 1R9NA 1VE3A 1ZJ4A 4P32A 4UM5A 1DT3A 3PHLA 2JCBA 3I04M 4P7KA 2YJ4A 4TLEA 4Y8VA 5PNTA 3FCYA 3COWA 5ICCA 3DF7A 1W0JD 5DX0A 1O6BA 3N2LA 1DNPA 2JFNA 3KJGA 2O5RA 3NNSA 4F6RB 1A9XA 1U8CB 1F8FA 5AKJA 4MQMA 3BGIA 3BF7A 1G17A 4Y3UA 4IILA 3L4KA 2IBTA 4NK4A 5AESA 2UUCB 4C0KA 4QLBA 2J59A 1B8VA 3LX4A 3TVDA 5BMVA 5KX5A 1LX7A 1SQ5A 3AWDA 2HIGA 1UWCA 3DMHA 3LAWA 2PLRA 5CK5A 3BHNA 4DEYA 4CQNA 1NU8A 3EY9A 5CBKA 1FTQA 5KAMA 2AUTA 2O23A 2QLNA 4CKEA 4DLVA 3TGLA 1DE0A 1P9RA 2PRYA 3C3AA 5DI3B 3CNNA 1RQGA 2F48A 2PL3A 3B6JA 4B3CA 5A4AA 1YHZA 3I2HA 2PMKA 5KNLA 3VPAA 1YOBA 4G9GA 4CGYA 2Z2XA 4U39A 1M6VB 3CMCO 3GIWA 3UMFA 3RHZA 4G0WA 2AUMA 2E4UA 1Z7GA 1K2VN 5K3CA 5GPBA 8ABPA 3MWJA 4ZAGA 821PA 1ZMOA 4GLJA 1ND6A 4TWBA 3A3OA 3QJ5A 4DR4B 1QH1B 3A05A 2QTNA 3ZHSA 4C6TA 2X42A 1JBKA 3OA0A 4WK4B 1KARA 1QE3A 2XVXA 1TO2E 4UVGA 1MXFA 2N0SA 1DC7A 2ON6A 1ZA1A 4MCJA 1EBUA 1E0KA 3AGPA 3ID6C 3NBKA 3HY4A 2VJCA 1NVDA 2X9NA 2B4KA 1VOTA 3TR0A 3GLIE 4BQOA 4L16A 3WK4A 2Z0MA 1J25A 2DUMA 4W7IA 3CEMA 3SHTA 5IN4A 3UBTA 4G1VA 5FJJA 4NV0A 1KJJA 5LP6B 2GVDC 5I4IA 3INGA 3KZVA 4GQAA 3T1YB 3E84A 2R0QC 4KDCA 5BN5A 1UF9A 4ID9A 2R751 3LDFA 4YUWA 2QRUA 4W9MC 3PXCX 1RD4A 4GEGA 3P0RA 621PA 3GLHE 2PIAA 3TW8B 1UMKA 2JKZA 3G9UA 1DKRA 4S1NA 5D51S 5FWXA 5FRDA 4KI0A 4DDUA 1C9DB 3U3DA 2DY1A 3NOXA 4ZO4A 4B6FA 2P41A 4LHSA 2AJBA 4MWBA 5J5AA 2WMDA 1WPXA 2O6LA 2QRPA 3PIIA 4HAUA 4KH1A 3ZD8A 5KNBA 2P5SA 4X5OA 3T3GA 1ZK1A 2VRWA 3G2QA 4DCCA 5KHAA 2K87A 5JS6A 4KGZA 4NBUA 1SM4A 3KALA 3ORRA 1SUAA 3H4TA 1JLLA 1NAIA 1ZDMA 3FHJA 5JFOA 3MUNA 4XVHA 5CJ2A 2BGLA 2ZJ6A 3FWYA 2PGLA 3DPSA 5C52B 3IV9A 4KZKA 3V3TA 3IB3A 3QXJA 2WAXA 1BDMA 3C98A 2GARA 2R6AA 3ZXUB 3HCNA 4BC0A 4UD2A 1AKUA 2JJ8A 2WNHA 3RIEA 3U16A 2W90A 1VZ2A 2PNJA 1Y5IA 1P5RA 4XSVA 4Z3DA 3ORSA 4NE9A 2HA7A 2ZYHA 5AOCA 2JJYA 2DTXA 1CUYA 1KAOA 2MSEB 1PX2A 3JRNA 4L4SA 4URWR 2DCUA 3Q5GA 1L5LA 4ZO6A 3DLIA 1NSFA 3QBVA 2ACEA 2GZ1A 4ECEA 5M5BA 2H52A 2JLQA 3L0IB 1ESZA 3CRW1 4LN1A 5GJBA 1SXGA 2Y1FA 3EWSA 4RC9A 3CNHA 2QZJA 3VVLA 1CB7A 1EUCB 4PC7A 3X2SA 5L3SB 1AQNA 3LC2O 4HVTA 5I47A 1UKBA 1YS2X 2P67A 3JZMA 3RYHA 1U81A 5A06A 1DHRA 1T5BA 1K89A 1XDUA 3RVPA 2UYGA 4TWRA 4YJFB 1RACA 3HUDA 4PSAA 4B3MB 2FW8A 1LV7A 5AW5A 5L4SA 4KXQA 1V2GA 1JJIA 4S12A 1VC2A 2FRDA 1D8TA 1GD1O 4NZ9A 3ITNA 4P31A 2GPAA 4R1QA 1MB0A 4YCDA 5HZKA 4AY3A 1E3IA 1VECA 2BFOA 1EDBA 4JXXA 3LYLA 1CETA 3BWBA 4TXMA 1A1SA 4UHHA 2QBYB 2R4UA 1IBCA 2AN3A 3QFCA 2HFJA 3DBOB 2GO7A 3U44B 1E2FA 1BXRA 4PF1A 4TRRA 4XSGA 5CGZA 5B7PA 4KL8S 2OC4A 3ZIAA 1X7HA 3RYCB 3DKIA 4KK4A 4PGAA 4DPKA 1XRMA 4QGBA 3DE6X 2BI8A 4AYWA 3DL7A 1SCKA 2REQA 2OWEA 2QTBA 4A27A 1GYPA 4DSZA 1P4SA 1TAHA 3H2ZA 3LVFO 2IL1A 3HB9A 4B2IA 2BWJA 2HJRA 3TQFA 4BN4A 4DCSA 4EJSB 4HNVA 2DXIA 3CFYA 1H9CA 1GFWA 3HBNA 1LDGA 5DX1A 4X45A 1ACMA 2RARA 4RGVA 3E82A 2MT9A 3BN3A 4Q7QA 4AWXA 5CLHA 5IN5A 4R2MA 2FG5A 3G0IA 2AN9A 3DEHA 1YMQA 2PSJA 4J6EA 5AUNB 1U5CA 4K6MA 1YRHA 2IH2A 2BMJA 4KCGA 3P0HA 4Q3NA 2M32A 3HEMA 3R3XA 2DJIA 1X13A 3C6BA 1J90A 4HPJB 3H9UA 2GLTA 1OBHA 3CCFA 4RVCA 5JCPA 5JXHA 1KYTA 2Q5LA 5JW6A 5GINE 1T91A 1KVTA 3AF3A 4JVNA 1XF1A 1Y89A 2PZLA 3FNBA 2FEKA 1YTLA 3GEHA 3U31A 3U3ZA 2JIBA 3ABOB 5G0SA 3ZUGA 4BZZA 1YVEI 1Y7HA 1UIMA 2D2VA 4G23A 3AUJB 2AD1A 3L4EA 5TEVA 2YS6A 3HV2A 3R8CA 3H04A 2W2KB 2VQDA 4BRZA 1MGPA 2WBLC 2HBZA 1RCFA 2JK0A 1G3RA 3LUDA 1G3UA 2L69A 2GEUA 3OIWA 3K8ZA 3SKXA 3R0JA 4GI1A 3DO8A 3F97A 5E6RA 5K0SA 1NVEA 4NZYA 1ORVA 1EB9A 2OYCA 4EJMA 3V7UA 2Q4DA 5HX7A 1IZ7A 3H2JA 3I1JA 3DT9A 5BPFA 3HMKA 1PWYE 4KHPB 2EGUA 4QYSA 3VHXB 4ZDJA 4ZOQI 3RBXA 1X1AA 1KMCA 1I1QB 3HN2A 3KOWA 4DREA 2YWFA 4YDSA 5A1JA 3W7BA 5L7TA 5JSYA 4M3NA 4OQMA 2IS4A 1XU4A 1O6ZA 1KE1A 1N9GA 1NBMA 1YR6A 4CEIB 3EGEA 4IQ0A 3HBFA 4XWAA 3LECA 2V0GA 6REQB 3PQFA 4X1OA 2OBMA 4KAAA 4RPGA 4L8YA 2OG2A 5F1KA 3TOZA 3DDZX 4J0CA 3K1ZA 3OEHD 1Y4DE 3WLFA 3HXKA 3UJHA 2XUJA 5DHTA 3WNVA 4ACAA 2VS1A 1FVOA 2R79A 4LXUA 4V02A 1KMMA 2R8RA 3TYXA 1LTHR 4AY4A 3ET4A 3SSAA 3DOUA 1TF2A 1ZH4A 1JU4A 3SKVA 4GGMX 1IPEA 1RWXA 4QLAA 1U4OA 2WYIA 2WF8A 3AC0A 4MVJG 4EG6A 1CF9A 2JCSA 1JFFA 5DYTA 5AIBA 2H85A 1DCKA 3VX4A 3PX2A 1T5HX 4WZ6A 4JBGA 3H8JA 4IV0A 3GH1A 3NWOA 3O75A 2BISA 5BN3A 5LYJA 3SYRA 3VZBA 1TVCA 4OI0A 1NXWA 4DVGA 3PWKA 1TDJA 4PAWA 4DV5B 1CRQA 4QE3A 2BD0A 2F1IA 1H8EA 3GAMA 4LYJA 3TCXB 3KKMA 3CZAA 3O03A 4X92A 2QYTA 4LYAA 3F7OA 2OECA 1UJMA 3VJMA 4P0PB 2C9OA 2CFOA 2I3DA 2HHLA 3KKQA 3TGPA 1B6TA 2V74B 3TTWA 3UMCA 4YGXB 1ITZA 3OZTA 3AEKA 3IUPA 3UFXA 4BMNA 5T3UA 2C3YA 3G23A 1K7YA 3UBMA 5CA1B 3IMCA 2Q2QA 4PEVA 2WWVD 4AW9A 5HVNA 4CU2A 1YZVA 4YK7A 5BO5A 1PYOA 3IR6A 4OHBA 2FAXA 3ZI0A 2F90A 1TTPB 4YRMA 1M2FA 1OLUB 1V9SA 4KN8A 5ALZA 1CEEA 2B1GA 3HSSA 2P2YA 2MYUA 5E4TA 1IG3A 1H4QA 5AKYA 4PX3A 4JJKA 2WI8A 3E22A 4FLMA 2QZSA 4DG9A 3UW3A 4X66B 3PPWA 3TBFA 3WBBA 3L8YA 4GXTA 3EBLA 1CC1S 2PKRA 4BCCA 1XQ9A 5JCOC 4CUJA 2QSYA 2QB5A 4X61A 1DS6A 4XB1A 1GFSA 4ZDIA 4D3DA 2PMBA 4HLDA 4JL8A 4PX9A 3V3KA 4TXNA 1RSZA 4IHJA 5ALGA 5BW4A 3DBHB 3HZOA 4XVQA 4QDJA 3UUGA 5CYPA 2VPWA 3TZHA 2R8EA 1KI6B 3M34A 1VCOA 2W6PA 2Q1YA 5EHNA 2FLWA 2JGFA 2V7QA 3LLUA 2ZTHA 2C7RA 1EVIA 3B6IA 4JBNA 2JIRA 5EQDA 4BNUA 4UTRA 1KZYC 4DT1B 5T3YA 3HU1A 4OA5A 4EKGA 1NXTA 2BFEB 3K70D 2F64A 4NZOA 5DNCA 4G24A 2CFIA 3OJWA 5A3SA 4LJRA 1NXQA 1W4LA 4M76B 4NPAA 4ZVSA 4RTMA 1LZKA 4HBGA 3DS8A 3AJRA 2XSZD 5BWCA 4CLRA 1T2CA 2MMGA 1OXSC 3NHLA 3P71T 3L04A 1EWYA 5CVUA 1C8VB 3LO5A 2CNDA 5DXFA 2QX4A 2UV8A 3MLBA 2YWRA 5EGSA 2GFHA 3I01M 4MB0A 4DM4A 1DXQA 1SU8A 1Q1EA 4RHYA 1MO2A 1EVEA 1EMDA 4FGZA 4XLTA 1K9VF 1HC7A 4UAJA 4MWZA 2O8EB 2P79A 4JJ6A 2AR0A 4ZTBA 4RZSA 1RNLA 5INTA 3UF0A 2BJHA 3DFUA 3D6MA 1QQ7A 1D5CA 1FB5A 3WQBA 5JZVA 3EJ6A 3V8QA 3A3PA 2HF7A 2GESA 1KA9H 3PHIA 4RAQA 5CAEA 1V45E 1QO7A 2XMCA 3HPRA 1WCYA 1BYUA 4F46A 2LW7A 4TUYB 3PFKA 2Y4OA 2I4NA 2FDRA 2VF8A 1IJFA 1Q84A 4QTZA 5AXAA 5IS2A 4C0QC 2G71A 2EYQA 2G8LA 1ZGAA 3AINA 3DXYA 3OTQA 1AKEA 1M9NA 2GRJA 4FS3A 4H2DA 4Q4HB 2B7LA 4OQXA 1J5PA 2FSFA 1R0KA 3NP7A 2UZ0A 2HBYA 5AVTA 4ZK6A 4RVDA 2ALJA 1BVHA 5LA6B 2GRUA 2FZ4A 2QR3A 2VWPA 1K0UA 1MKYA 2Y05A 4IS3A 4HGQA 4KE6A 3PUXA 3T5TA 3IMKA 2IITA 1DQNA 2CL7X 3RT7A 2UUBB 1BOOA 1QPZA 1LNZA 2J46A 2QM0A 3E9QA 4IIXA 1LLQA 1ONOA 2AZTA 6GPBA 4BPRA 1NVUQ 2BZ1A 2G0NA 3PA6A 4ZV7A 1VIMA 4CV0A 3L8MA 4F92B 1ILEA 1SEPA 3GRZA 3S68A 4G4GA 5K7SA 1T3HA 2GEKA 4J0KA 3LTEA 4L5AA 4R01A 1DLJA 1Z2CA 3FETA 4OK5A 1ARZA 4Q3DA 3ZWBA 2QQGA 4IO0A 5JNUA 1S2NA 4BMDA 4HAXA 4BVEA 2B2XA 4MRAA 5EJ8A 1CEYA 1EE2A 3Q1LA 5JSZB 4WQMA 2NVOA 2ZWIA 2A9FA 4RU1A 3CISA 4YP1A 4EEXA 1G21E 2H59A 1R0SA 3RS7A 3DTVD 1Q16A 3K9GA 3IIKA 3D0OA 5KNDA 1NP6A 3SQXA 2ZITA 4EY3A 3VR0A 3WNDA 1P1CA 1M8JA 4RXMA 2OK8A 4RANA 1M6HA 4C20A 2OXTA 1OY1A 1QHHB 3QEMB 4XIFA 5AIAA 1DIGA 1VBKA 1OFHA 4X63A 1GTRA 1U5AA 4RA6B 1YO6A 3B36A 1XDBA 3UA4A 4NC9A 3WL5A 2BEUB 4LYDA 1TYDE 1NQOA 3H1BA 3HO8A 3CBGA 1R88A 3DZJA 3MTIA 1U9JA 4WOPA 5KQMA 1T36A 2A9PA 1IK6A 1H4SA 1WMEA 3OLVA 3GJTA 4P82A 1RJ9B 2A88A 1W5SA 3KEOA 2VNHA 1Q7EA 5FOXA 5TF0A 4WL0A 2EZTA 4FGJA 4JJ4A 1P17A 3H86A 1OYYA 2P1DA 3AXTA 3VR5D 2GPBA 3PXXA 4IGEA 3UM9A 1GPAA 2XIQA 5FP0A 3LGXA 2Y99A 1ZM4A 3AJ9A 3U81A 1N0IA 2XQIA 3BT7A 4P58A 1XRRA 2ORVA 2PUWA 3WLHA 3CURA 2FXVA 2NW6A 1OFUX 2H4WA 2CMDA 5JZ9A 4W6QA 3L18A 1K86A 3FRJA 2LR0A 1GTSA 4W1PA 2NSDA 2XUHA 1B3BA 1E8DA 3HNOA 3KJNA 4GNRA 1JQAA 5BXYA 3L7MA 2V3VA 1RQPA 2YZNA 2Y1XA 5JS1A 1HZZC 1X9GA 2G06A 1YS1X 1ZW1A 3K2EA 3NJRA 4KPGA 4IVRA 2BMEA 2RBEA 1YFKA 4DAEA 3EA5A 2YOFA 1U02A 2ODQA 1BU5A 5C8VA 2XZLA 3C5CA 4OP3A 4IINA 5K99A 4D0LB 2Z56A 1XTUA 5F3RA 4E6EA 2QRZA 3KXIA 1IM2A 3T99A 3ZQ4A 2ILTA 1Z83A 1E2UA 1MA3A 4DY6A 1FSGA 1NU6A 2ZI6A 1KKUA 2VF7A 3MUOA 3OJCA 1HDCA 4M0PA 2M6SA 2AYYA 2QAJA 4WBXC 3HB7A 1CIJA 4J7CA 3PCXA 4WX2B 2GGSA 2JAOA 5DXAA 5BMVB 3CHYA 3GLQA 1F0YA 3PZRA 4ZK2A 1MIHA 2ZP1A 1AUXA 2DUNA 1XMJA 2F9LA 2FPXA 1DUIA 4IIBA 1DCMA 2AG1A 3T3OA 3EXEB 1AKWA 3OM9A 2FSGA 5B3LA 3EXHA 3FAKA 2HNAA 3G2HA 3QVUA 1PR9A 4CKEB 3DBRA 4Y2HA 3S2EA 1SUIA 5LXTA 4E3ZA 5CM2Z 3FZGA 5CCXA 4OGGA 5F9HA 2C3UA 1TMGE 2XCSB 4ZTZB 1ZESA 2P5UA 4YP6A 5BW6B 1J7KA 2XLBA 3PXBA 2GPJA 2Q62A 1BFDA 2XYGA 2EKPA 3E9NA 4MMXB 5E9AA 4EO4A 2DLCX 2YYSA 4R2WA 3BWYA 2HPHA 4KC0A 2V58A 4DJDC 1VCNA 2F6RA 3EDMA 4H6VA 4BQIA 4ZCRA 3OQVA 4CIAA 4CL2A 3PVSA 2PUBA 3A9UA 5AVVA 1XZQA 4JBWA 4D3YA 3F5DA 4LV8B 4C6TB 1XQ6A 1XL0A 1Z39A 3PU6A 5KBYA 2W11A 3NVMB 3UMJA 4JI0B 2ZTLA 1N78A 1XCLA 1RE0A 3L1KA 4TV9F 5CHYA 2QJFA 1Z25A 3D7KA 3ZGXA 4EF5A 3REQA 1C1DA 1OI2A 2I65A 2QX6A 2WAAA 3GU3A 1E3LA 2QL9A 3HSKA 1U31A 1P1HA 1VKZA 4RSHA 3V8BA 5KKCA 1NRIA 5HMLA 2G5PA 1VSUA 4NMXB 1MXHA 4MQBA 3CLTD 2P8JA 3HFGA 4ZT7A 3ECCA 1NOIA 3NWBA 5BN5B 3WLSA 5KHOC 5LDDC 2BGRA 3ERCA 2XGJA 2Z8ZA 1ZNZA 2H4XA 3O7MA 1VPEA 4B4VA 1OC2A 4J1NA 2YV5A 4JVOA 1L5HA 4EHJA 4RULA 2JD1A 3N2EA 4WZZA 3KYCA 4KQHA 1F1BA 3B85A 2P9ZA 3C8HA 4BCBA 4DCPA 5HGJA 1FBTA 3OOYA 4J7XA 5DGXA 1ZCBA 2AUNA 5H80A 3ZJTA 4BBJA 3VR5H 4AICA 2R48A 5LB2A 4WBNF 1FFHA 3QG5A 1E2DA 2FX3A 3DDSA 2EG9A 3EXIA 3TNLA 3L77A 3VO2A 4M1ZA 4RH0A 5I9IA 3DMDA 4M0EA 3KXDA 4KMRA 1HYBA 1A50B 4G0ZA 3SFZA 3V4PB 1ZUHA 3OF3A 4E5YA 1F0KA 1QIMA 1WXQA 1A04A 1ZP6A 4H77A 3IJEB 1G60A 4ME6A 4NJMA 4AJPA 1VJ5A 1ZH2A 3O84A 1NQ5A 1XZKA 4OLAA 2B36A 3D7SA 4GP9A 4MIKA 2PYDA 1U1CA 3W5HA 1KQGA 4XKJA 3Q8MA 3ADDA 4J2TA 1BGWA 4B3XA 4K5QA 2FFBA 1ZVKA 1D4FA 1KORA 4KRGA 2C03A 3WLKX 2J7KA 1C3XA 2XNDA 4WLVA 4WVFA 4X3OA 5E1MA 3ZCRA 1WXWA 1JG4A 4FB5A 4JUBA 2FFQA 1OR8A 5EIXA 3NATA 2H2HA 4WUTA 3RJMA 5JDIA 2BFNA 1MW8X 4LOJA 1G2OA 5CG2A 2SNIE 3RFCA 3EMBA 2ZJ1A 1WW2A 3Q9UA 1U3DA 4BLOA 1QKIA 3K09C 2PFSA 3CNLA 1NG1A 1B7GO 1D2HA 3NHZA 5EKUA 3SLGA 4CUKA 2BYTA 1GZ5A 1C0LA 1U2PA 3PQ3A 1W4RA 3QNMA 4UDOA 6PFKA 2AYXA 2TS1A 5T4HA 3DD1A 1DKPA 1B26A 1WHTB 1DXOA 1NDQA 1JPJA 1WJGA 2J5XA 3CWZA 3U4HA 3A1EA 4H7KA 3HBAA 1PDWA 3NXKA 5HF6A 4NYJQ 1T2EA 2JFOA 3CLHA 4Y2TA 2IH5A 2WUEA 1VE9A 3H5OA 2J9GA 2IBMA 2ZRHA 4RA9A 1NVBA 4DSUA 1ACLA 3G2NA 2AQHA 2FR1A 3LT0A 4OHMA 1Y1QA 1KSFX 4TL7A 1LDBA 3ZHCA 1PW7A 4IM7A 3KWMA 2VEDA 4NCKA 2ORWA 2VUSA 2V97A 3VYSB 1MPXA 2Z30A 1PS0A 3IPLA 2UYHA 1MTZA 1Z7EA 3VDNB 4G9BA 3IB6A 4GHWA 1GAXA 1GGNA 1RZRA 1GU1A 5IEBA 3U9TA 3J80A 4MHSA 5A3VA 4QQRA 1G0OA 3LT1A 3LFHA 4L9AA 1BXRB 3LNTA 3M9XA 1I3KA 2Q0QA 4LEIA 2B99A 3EFBA 5AXBA 2D6FA 2CLOB 4O2AA 5KMGA 2BSQA 1GSIA 3ZJYA 2NTYC 2NPOA 2OHVA 1RLOA 3VZCA 1IZ9A 2GT1A 2TECE 1YQ9A 2E1RA 4ZJYA 4RLSA 3M1IA 3EYAA 4BLRA 4YRKA 1UBLS 4DBLC 3OT1A 4HUJA 2XNJA 4AWAA 1XTJA 2EX1A 1FDIA 4H59A 3RFUA 4UVEA 2YJNA 3C3MA 3CW2A 5LFAA 3N59A 2XOEA 3OZCA 2JIPA 4NU5A 5FOSA 3R5TA 3VBCA 2C4KA 2O8NA 3ZU5A 4NYJR 1XQVA 4QRDA 1Y4UA 1YA8A 2I4LA 2BGIA 1TK3A 1J9GA 1KQ3A 2YCLA 1GKIA 1U8ZA 4HRYA 4QOIA 4DJJA 4X65B 1LJ8A 1AX9A 3OJEA 3R3SA 1F5SA 4WIAA 1N1MA 1ZD1A 3LRTA 5DSZA 1QYXA 2O20A 4TSFA 1YZFA 5EWLB 1NJ6A 3CRRA 1KZ9A 1SKBA 2W98A 2W6QA 1SVMA 1Z88A 4TZKA 4IDGA 3BC1A 5IDWA 3IIIA 1M76A 1Z2DA 3UICA 1EZ4A 2YX1A 4P7JA 2J3LA 1O5IA 4U2BA 4GM4A 3QXHA 1DWUA 4J16A 5JAPA 3Q7RA 2QWXA 4IDNA 4BBPA 2YIDA 1NBOA 2WHPA 1CLEA 5KCMA 1RAEA 3IOBA 1APBA 1NUPA 3P4XA 4LWZA 4XIGS 1M72A 3FFWA 1G5IA 2B94A 2EFJA 2QLTA 3ONDA 5BWLA 5E6RB 4O3MA 1KMQA 5JEEA 1GQ2A 1V6AA 4FGLA 1ZN2A 3D8SA 3Q72A 4QT4A 3GV0A 2WUDA 4INJA 4G3XA 1W4BA 3BTSA 3DUFA 2Z3ZA 2ZRMA 3AV3A 2B6HA 2G76A 3PRJA 4LRSB 2F59A 3WZMA 1QAMA 2OZEA 4KWCA 5EZYB 3CZ4A 3ULKA 4A5OA 4RZXA 2XF2A 1EE9A 3AF5A 1M75A 3WNCA 4HOYA 3USES 1U7ZA 2JFVA 3W1WA 1HI9A 3UMSA 4JJZA 3ZXXA 1HE2A 3A58B 3FUUA 2I4RA 1CTQA 3DFIA 4U9HS 5KVCA 5BN4A 1TRKA 1G9TA 3NDPA 5C4MA 5AH0A 2IYZA 3M4ZA 3KQWA 3C97A 3AF6A 3Q6MA 1YDWA 3AK4A 3B8HA 4IIJA 4ARZB 3H4MA 3SYTA 4DCGA 3MVEA 4I6GA 2IUTA 4PQGA 5JNTA 1V5GA 4DWVA 3UXMA 2G1AA 2E5WA 4BMZA 1DC5A 2GZSA 3BQMB 3F5MA 4H0FA 5K4AA 4BZXA 3PJFA 4IIVA 2XYQA 3IMEA 1C1XA 4RABA 1VKRA 4JYBA 3ZQ6A 4EQ6B 2VP6A 3ZHUA 3P9YA 4B3RB 5CUQA 2C96A 5ALLA 3N7AA 2QVZX 1CJVC 3MWDA 1H8HD 2O2YA 1OA0A 2GDJA 1U1GA 3AVPA 3JYLA 3LUGA 4JYPA 5SZJA 3USCS 4BNFA 3AU9A 2WHEA 4E14A 3D6TB 3FHCB 2YN0A 4HQLA 4F06A 1XEFA 4WGFA 1TO1E 1Z8DA 4FW9A 1Z36A 1QWSA 3LUBA 2IWRA 4ZZ3A 3LT5A 3O8OA 5JT1A 1YZ3A 4TLAA 4BNYA 5CDHA 5THQA 1KS2A 4AZTA 5F5XA 3HA5A 1QX3A 1UBUS 4ZVKA 1ZH0A 2XDAA 4IFEA 2IY8A 4A6XA 1MBZA 1P0MA 4LC0A 3TNJA 2PVPA 4EATA 1DFIA 2CJWA 3DZKA 1CZRA 2JAWA 2L18A 3ISJA 2FVXA 5AR1A 4FFBA 1OAAA 2XBLA 1ORDA 3DNFA 4ZU3A 4HF7A 2PUVA 2BCGY 1TM1E 1J0XO 3T7SA 4LOHA 4BO1A 4FM9A 3V4RA 2XZDA 3PVZA 3OM8A 1TMYA 3PEEA 3A4VA 1PQUA 3HKBA 4YNBA 3BB3A 3UJ3X 2UYQA 1MENA 1LPAB 1NASA 2EP5A 1CUAA 1R7RA 3BK2A 2EFDB 4MS4B 3E22B 5GADl 3IVGA 4DRXB 4OQLA 2HCRA 4YN3A 4MKHA 4Z4IA 3O3OB 2I6UA 3N7UA 2HMYB 1PNTA 1Q3TA 3AVWA 3QIVA 4FMCB 3EMVA 3UWKA 5IVKA 4O2LA 3WDSA 4IX9A 3JD3A 1OLSB 4ZYLA 1SXJE 3FSGA 3RWMB 3WMGA 4QXOA 2BVNA 3EVGA 1NX6A 2PH3A 4KWEA 2VHXA 1BN7A 2TSYB 1WKVA 2CNBA 3EDOA 3N2IA 1KK0A 4QA9A 4PV7A 5IW8A 2ZAYA 1O08A 3DV0B 2WIJA 3DZGA 1UBNA 3ANTA 3W04A 3EN0A 4DMLA 1UQRA 1PVOA 3A0UA 4NWIA 3BL5A 3AO0B 4YR9A 3W1VA 2IQ5A 4UFNA 2XRMA 1KAMA 5B2FA 2ETXA 1CUJA 1S96A 3E5HA 3EEIA 1AMNA 2YYZA 4GX0A 4J0GA 5ECDA 4ENWA 1Q83A 2FP4B 1QCCA 4NX2A 1TPYA 3LWZA 5FULA 2LIVA 4CLRB 2VDNB 4V3CA 3VKUA 3CLSD 3KSBC 2AH5A 4MA4A 4TKZA 4ZU6X 1FP1D 5HIIA 1PYGA 4JT4A 4ZEXA 4G2TA 1G1MA 1Z5PA 1WS6A 3PNBA 3WL4A 2ACVA 5L51A 5MFZA 2QE7D 1XZEA 3U4MA 1C9KA 2UVQA 2R97A 5I4CA 4GBGA 1T2NA 1Q19A 4CNQA 2ESRA 3ENQA 2VHTA 4AN1A 3P2YA 4C7KA 2C54A 2CLDX 1FDRA 3BK1A 3PNOA 5BT8A 2VLBA 3HH8A 1ODIA 2JRLA 4I6EA 4KQ9A 2ZRPA 3QYJA 5DM0A 1OTYA 1PLJA 3D8UA 4Q19A 2O2IA 4NFHA 2PUDA 4WKNA 4LDQA 1C81A 1OFTA 2WUWE 3TJMA 4E3WA 2HLDA 3KEGA 1YIOA 5CAEB 5CLIA 1SU4A 1NVXQ 2WLTA 5JQWA 4M1YA 5DMHA 1M10A 4PHCA 4LPSA 1CF4A 1VYTA 2ZPUA 4KRXA 1ADJA 3FHTA 3IUEA 4TZ0A 3HFSA 4UCQA 2YWJA 4HX2A 1FLVA 1RRPA 2P3QA 4BLTA 3FR7A 3WKDA 2NTJA 3PDCA 3PR3A 3KQYA 3EMKA 2GF9A 3GT4A 3IR7A 4IJ5A 3U3OA 4UXJA 1A7KA 4BNHA 3KPJA 2QSZA 4CM9A 1SY7A 2FQYA 4JLKA 3U37A 4S2UA 1Y82A 2JZCA 1KYQA 2FX2A 2IW3A 3H1FA 4YAKA 3T95A 4M0FA 3MUFA 3L8FA 1LGYA 2X3FA 1OXKB 4ID3A 1CRPA 1E1LA 1LSSA 1GZDA 4P53A 4X95A 3IO3A 4AMVA 1MRNA 2GI4A 1SU6A 4K2HA 4LF4B 4D2IA 4ENSA 2XUGA 2R68A 4JYMA 1VGQA 2RGXA 3U48A 2VJBA 3LUPA 3MWYW 4AG3A 1FYVA 2QTMA 4PIVA 3VFDA 4E03A 4HADA 3R1IA 1B1CA 3D6JA 1QRSA 3L6OO 3F6EX 4HPWA 4QO7A 4BV9A 5EE1A 3DMNA 2P6RA 4QNMA 5K1ZA 2ZXUA 2BTEA 3PTZA 2IYPA 2HRQA 1H9AA 2IEBA 4X8OA 3UOWA 2QUZA 3H1AA 3LT4A 2CXHA 7MDHA