4E8EA

Structural characterization of bombyx mori glutathione transferase bmgstd1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
216
structure length
216
Chain Sequence
HMPVQPIKLYYLPPSPPCRAVMMTARVLELDLHLITTNIMNGEHMTPEYLKMNPQHTIPTMDDNGFILWESRAIQTYLVNAYGKDDSLYPKNPRQRAIIDQRLNFDLGTLYLRYLNLYTPILFRGEAYDQEKADKFDEALGWLNTFLDGRPFVAGENMTVADITIVVTITNIDAFGYDFSSHENIAKWFERTKKMLEPYGYDEIDVTGAKMLASFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of Bombyx mori glutathione transferase BmGSTD1
rcsb
molecule keywords Glutathione S-transferase
molecule tags Transferase
source organism Bombyx mori
total genus 82
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4e8eA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4e8eA01
2O89A 4IELA 1FB0A 3FZ5A 1SJZA 3EWLA 4KSOA 3Q74A 5G1KA 2M72A 2H8LA 3APOA 5GAND 2H1GA 2PVQA 3CSHA 1XXUA 5E4WA 1SL0B 5DJMA 1XCCA 4GXZA 4YAPA 1FB6A 1ZYQB 2ZCTA 4AF2A 3VPQA 3CRTA 5AGYA 1PKWA 4HJMA 1SKRB 1Q4JA 3ERGA 1SL2B 1GULA 2I1UA 3M9JA 2VL3A 1XZOA 2X64A 2V32A 1EGRA 2V6OA 5ECRB 1BX9A 3GL3A 2B1LA 1XWBA 1V40A 1BAYA 2NVLA 2B5EA 4ID0A 2YANA 4OFNA 4FQUA 4MK3A 2C4JA 2E2GA 1QXHA 3UARA 3H93A 4MP4A 1GH2A 2HRAA 3OR5A 2E0QA 1PD21 3D4MA 3KMNA 1M99A 1C72A 1B9YC 4TKYA 4ZL8A 1Z6NA 5JCUA 1ERVA 1HNAA 1PX6A 1GTAA 1HD2A 3KEBA 5BMUA 4GTUA 5IMVA 4OD7A 4TW5A 3IA1A 2V1MA 3HXSA 4JZQA 2QKEA 1ERTA 2ALBA 6GSUA 2DMMA 2GS3A 2KP2A 3TJBA 1X9MB 2L6CA 1VF2A 1U3AA 1U6TA 2WCIA 3F3QA 4AGSA 5AIVA 4CDOA 4NV2A 1VF4A 2VLUA 10GSA 3APQA 3KIJA 2H75A 2I3YA 2DIYA 4JR6A 4WXTA 2RUFA 2VCVA 4HQSA 2K8SA 2JL4A 3L9SA 4DSSB 4K0NA 2YZUA 1AIUA 1TJDA 3R2QA 4TXVA 4Q5QA 4OFTA 4NHZA 1ZGNA 2C8UA 3K8NA 2JZTA 2CT6A 1WP0A 2DJ1A 3ZMLA 1YZXA 4KGIA 2JSYA 2OBKA 5B8AA 1SK1A 3KH7A 4GRFA 1O8XA 4ECIA 5JCWA 3GRXA 3U5RE 5AISA 2BJXA 2XC2A 1LBKA 3I69A 2GLRA 1W89A 3D5JA 3QAGA 3CXGA 5D73A 1K3YA 4HI7A 4NXIA 1HYUA 4HS1A 2F51A 2B7JA 5G5FA 2H30A 5INYA 2F9SA 2H1BA 3P7XA 1BEDA 1YJ6A 1OVNA 4GQCA 1H75A 4H86A 5KEJA 4ZB6A 2ES7A 4MA9A 1GL8A 3UJ1A 4MDCA 4POLA 4OCEA 2A2RA 1G6WA 4V1Ag 1SENA 2DJJA 3C8EA 3WYWA 4DEJA 3KCMA 1F3BA 4I2TA 4GF0A 4TRXA 22GSA 3ZFLA 2KUCA 2F3MA 1UVZA 4WF5A 4E8HA 2WGRA 3C71A 4XS1A 4GWRA 2YWOA 2LRCA 4LL1B 1N8JA 4EKZA 2QSIA 1FW1A 3FYGA 1DE2A 2HQTA 3U6VA 2PWJA 4HEA2 3D0ZA 2C1YA 3LEFA 4TOPA 2L4QA 4L8EA 4RI7A 3MNGA 3FR6A 1I5GA 2H1DA 2NTOA 5IMCA 4KDUA 3TRPA 5A4WA 4K6XA 1XW5A 3KTBA 2IMFA 4NV5A 1BG5A 3GHAA 1GUMA 3QR6A 3TKPA 2DMLA 2IFQB 3IC8A 5COHA 4JRRA 5EL8A 5F0GA 4E8EA 4D73A 5DDLA 3VI5A 1SJ6A 1AXDA 1V98A 4O7HA 4NPBA 1OE8A 3C1SA 3O3TA 1PRXA 2JZRA 5ECHB 1BQ7A 1GSQA 4HOJA 2X99A 3ISOA 3LFLA 2K6VA 1PSQA 2AJQB 1SK0A 4EL1A 5CO3A 2PVOC 2FHEA 2H66A 1T3BA 3GN3A 5DJLA 2E2MA 3LYPA 4F0CA 3CTGA 1RK4A 5CRDA 3GKNA 17GSA 3L0HA 2RUEA 5LCZA 1XPVA 1M9BA 2L57A 4HU9A 4PURA 3UOMA 1TU7A 3PH9A 2P5RA 3ZITA 2K9FA 4XHMA 1JFUA 3J7Yb 1HNBA 1TOFA 4Z7XA 2XPDA 2GQKA 4IQAA 1AC1A 2R37A 1PN9A 1MDIA 2YN1A 3H4KA 4ECJA 4RQRA 4MH3A 4K2DA 3KGKA 2VUPA 3GNJA 3VWVA 1KTEA 3ZVJD 4MF6A 3F9UA 3ERWA 3LQ7A 1RW1A 3IXRA 4ACSA 1LJRA 9GSSA 3H79A 2E7PA 1JZOA 1THOA 3Q6OA 4TR1A 5A4VA 1CQGA 2L5LA 1FHEA 3HJMA 5ABRA 4I8BA 1X5DA 4WBRD 4J57E 1GSSA 1EEJA 4POBA 4AJ6A 4NMUA 1DE1A 5GAPD 3VK9A 2G2QA 3HCZA 2HE3A 1OAZA 2LV3A 3AY8A 2XHFA 5AN1A 3TJKA 1QFNA 3RBTA 3HHVA 4XS6A 5KN1A 4HQZA 1JLWA 2HRKA 4F03A 1XWAA 1ACVA 2B6MA 3ME8A 3GTUB 4MCUA 2HZFA 3LGCA 1F6MC 3HA9A 3G7JA 2BTOT 3J7Yk 3KXOA 1M2BA 1WWJA 4ECCA 5KN0A 3TKSE 4RUVA 3CYNA 4OO5A 3DXBA 1GRXA 3KZQA 2LJRA 3VLNA 2LRTA 4HJ2A 3HVVA 4EF0A 3TKRA 1R5PA 2H0HA 2N5BA 2YNXA 3L9UA 1YDKA 3R3EA 2CAIA 5ECIB 4RI6A 5DALA 2YWNA 4MPGA 4FYUA 1M0UA 3SWLA 3VPTA 4IP1A 2FUG2 5LD0A 2LKUA 3FW2A 4MH2A 2M46A 3PPUA 3WT2A 1V58A 2DJ0A 2GZPA 2CZ3A 1OC9B 3UL3A 2LEGA 3DD3A 3RAZA 4ZXGA 4HZ4A 5J5NA 2F8FA 2HSMA 2AYTA 4AJ7A 2GDRA 1TK5B 2H76A 3DVXA 4V2LA 3FK8A 5A4UA 5EVOA 4OO4A 2WFCA 1WE0A 3A5WA 1GWCA 1EP7A 2IL3A 2VLTA 2RM5A 3IR4A 4IN0A 2CAQA 5FWGA 1TRUA 1PA3A 1PMTA 2FA8A 1OC8A 1RQMA 4MF7A 3ZRDA 3A2XA 4BL7B 2CV4A 3RPNA 1XOAA 2DJKA 1NHOA 1GNEA 4BVYA 2MMOA 5CRHA 4ECBA 2C3TA 3GURA 2YJ7A 1EZKA 5G2ZA 1X5EA 4TXOA 2VM2A 1O8WA 2FD3A 2I81A 2CX4A 2KP1A 1Q98A 2H72A 2PBJA 5HQPA 2AAWA 2LJKA 4PNFA 1X9WB 2NBSA 5JCGA 3WGEA 4EE0A 2GSSA 3LJRA 1S3DA 1SU9A 2L59A 4ZL7A 3GFKA 2K18A 4IW9A 16GSA 4IJIA 1MTCA 3EVIA 2WB9A 4V1Ap 5IMAA 13GSA 1AQXA 4N30A 3W8SA 4FIWA 2IJYA 1AAZA 1WJKA 4I5QA 1THXA 2DSAA 3HYPA 14GSA 4KNDA 1DUGA 3BCIA 1A2MA 3KP9A 3W8JA 2PMTA 4CW9A 3DMLA 4PNGA 3EC3A 1VF1A 5ECMB 3RPPA 5IMFA 1OC3A 1TXXA 1YY7A 3HZ4A 5C04A 3RHBA 1XVWA 5DCGA 2H6XA 2ON5A 3US3A 1B4QA 1HNCA 2X8HA 3F8UA 1Z6MA 2VL9A 1T4ZA 2VM1A 3VWUA 2H74A 3QDNA 5ECKB 4PGTA 1WOUA 2IMDA 1SD9A 4J56E 4GCIA 1EWXA 1ERUA 1O81A 4EXJA 1SK2A 3TOUA 2HT9A 4Q5FA 5D96A 4XRAA 2IMKA 4YAVA 1AQWA 3CRUA 3EE2A 1O6JA 2M80A 3UVTA 3TKQA 5IMDA 4O5RA 4PUFC 1SL1B 1T8EB 1ZOFA 3UVHA 2MYGA 3IDVA 1G7OA 2CX3A 3ZIVA 2XBIA 4PTSA 2L4CA 3MSZA 1J9BA 2VD1A 2YWIA 3E9JB 2B5XA 5J4UA 3L9VA 4RQXA 4ZILA 4ZBBA 3L4NA 3H1NA 1OKDA 4WR5A 4G19A 4JU5A 4FYCA 3HVSA 2OE1A 1TRSA 2K8VA 1GUHA 3P8WA 4IP6A 3GKKA 2FLSA 1Y6EA 1EV9A 2H19A 4NWYA 5HR3A 3WGXA 1GP1A 2DJ2A 4OFMA 1O73A 3VURA 3QFBC 3W6GA 3A2VA 3BJ5A 4ILFA 3WGDA 5G31A 2J9HA 3IOSA 1A2LA 4I97A 2CVBA 2FGXA 1A23A 2MZCA 5IPHA 1GTIA 2CA8A 4L0UA 4QL7A 3QOUA 2R3XA 2C0EA 2OBIA 2H70A 2GZZA 4JBBA 3QMXA 4POMA 2G0FA 4XS4A 1VF3A 2X8GA 3O6TA 2O7KA 4KDXA 2YOIA 4XIHA 3E3EA 3FRCA 4K8MA 5JWQB 2GTUA 3GX0A 2YZHA 4EVMA 3F6DA 3DIEA 1F37A 1X5CA 4MZBA 1W4VA 5D9VA 2KLXA 3QCPA 1YEXA 4EUYA 3GV1A 3KTLA 4JE1A 3TKSA 3GYKA 5A5KA 3KM6A 2VOCA 4N0ZA 4KH7A 5G5EA 4WR4A 4YQUA 2R2JA 4JR4A 4HZ2A 3EYTA 2O85A 2YJHA 3N5OA 19GSA 3FY7A 1H4OA 3DKSA 3G7YA 1SYXA 3Q19A 1XOBA 2RIIA 4FH8A 4G10A 1Y25A 3C73A 1YKAA 3C1RA 4V2MA 6GSYA 1VRSD 3DEXA 2PUKC 1VGLA 5IMZA 1KEBA 2C3QA 1FVJA 1ON4A 1SKSB 3P2AA 1TI1A 2HRFA 2VCXA 4EDYA 2PGTA 4GQFA 3F63A 1TK0B 1XW9A 5J3RA 3ZMKA 4G0LA 5F8BA 2MBTA 5IO2A 1EEMA 1ABAA 3TJGA 4HDEA 5DBQA 2CQ9A 1F2EA 4KUNA 1S3CA 3GIXA 4D73B 2TIRA 4TVEA 2R5GA 2B1KA 3PINA 5H5RA 1TW9A 2DBCA 3KH9A 4IHUA 1V9WA 2AV4A 1Z7RA 5EPFA 2IMEA 3TCOA 3EU3A 2O87A 3ZL5A 3FEUA 2Z9SA 1XVQA 2HZEA 5DAKA 3BOAA 3NIVA 7GSSA 5EY6A 4X0XA 3RDWA 3DWVA 4GSNA 1K3LA 4ZIJA 1HQOA 3FZ9A 1OYJA 5IQYA 2HI7A 2AB6A 2OACA 2YV7A 1JZWA 5B8BA 1IYIA 5ECLB 4QL9A 3ZIJA 1PQNA 3IK7A 4NHWA 4ZB9A 4LL4B 4BVXA 1ML6A 1K0MA 3ZZXA 4G2EA 2YP6A 5CYYA 4MABA 4MJEA 1A8LA 4X43A 4ML6A 3FZ4A 3KMOA 1CQHA 2LRNA 3HJPA 3HKRA 4TR4A 1T7PB 1OKTA 1QK8A 3GKMA 2AUVA 1MDKA 2VO4A 4TR1B 4IBPA 1ERWA 5LNKe 2GGTA 2I4AA 4N11A 1XIYA 4L5LA 2VAFA 1V2AA 4G0IA 4DSRA 1USBA 1PX7A 4N10A 2VCWA 2OADA 3LXZA 3CMIA 4F2IA 4GSSA 5D9XA 4TR0A 3LG6A 1V57A 1Z9HA 4I2UA 1NM3A 2PN8A 5IOXA 2D2ZA 5B6MA 4Q5NA 2HRKB 3FKFA 5ID2A 1MDJA 3HJOA 3LYKA 11GSA 4O32A 4OMVA 1QQ2A 4WEYA 4TN8A 2WJUA 2I9HA 5D93A 3D22A 3TDGA 3D21A 4IVFA 5DVBA 2YV9A 5H5SA 4DSQA 2TRCP 5HFKA 3I6AA 4K7NA 2P31A 3F4SA 5J9BA 1AQVA 1FG4A 1SKWB 1R7HA 1PL2A 4KAEA 2HYXA 2LNSA 2LNTA 5DALB 5L71A 3TB2A 1XWCA 3WD6A 1ZL9A 3TOTA 1WPIA 2IPAA 5ECSA 3TKSC 3CTFA 3CBUA 4I6XA 2DC5A 4V2NA 3VWWA 3EMPA 2ZUPA 2HFDA 2FWFA 2GSTA 1BJXA 1X9SB 1O7UA 3QFAC 2HSMB 4IS0A 3F0IA 1JZDA 5J41A 4YH2A 1TI3A 3ZLPA 4BA7A 3L78A 2MMAA 2KOKA 5IIZA 3QAVA 3TUEA 4MPFA 1QGVA 3EINA 4ML1A 5AIXA 5GSSA 3UBKA 3TGZA 4K0GA 3VWXA 1A24A 1Z7PA 3DYRA 2GT6A 3IAM2 1PL1A 3DVWA 1X0RA 2DLXA 3ERFA 2OJLA 3VI7A 1M9AA 2ON7A 2UZ8A 4EC0A 4CHSA 4PX1A 1G6YA 3G7IA 2GZYA 1S3AA 4BVYB 2VD0A 1GSDA 4QQ7A 4YQMA 1GSUA 4TXOB 1Z3EA 1GNWA 4IGJA 4IQ1A 2EIQA 3IHQA 3QPMA 3TRQA 4BPYA 3ZREA 5ELAA 3MAKA 3ED3A 2N5AA 4K1FA 1K0CA 3GA4A 3LWAA 1KNGA 5CAXA 2H1AA 1A8YA 2V41A 2J23A 5F05A 2C0GA 4F9ZA 3A2WA 2XBQA 3UMAA 4F82A 1B4PA 2H0GA 3A3TA 4OWYA 5C00A 2JU5A 2LTKA 3NOFA 1AUCA 2O8VB 4P3YB 1O85A 4MJBA 1I9DA 4ISDA 2WS2A 4USSA 2MMZA 3LORA 2LQQA 6GSXA 4K9ZA 5HFIA 1E2YA 4KCAA 1NHYA 3I43A 3M9KA 3GL5A 1YF0A 4L0WA 1YQ1A 5D9WA 2P5QA 4LA1A 4DSSA 2GT5A 4YQVA 1MD4A 4XRDA 4KW6A 3QD9A 2ZNMA 2FWGA 5DQSA 1UN2A 2C80A 4MZWA 3M1GA 2EC4A 5B6NA 4LLRA 2B5YA 1UA5A 2MMNA 1XWGA 2OA7A 1KBNA 3ZVJA 1OE7A 4KF9A 3GH9A 5HR0A 4PUAA 2PPTA 3FZAA 1B8XA 1ZMAA 1XW6A 1QUWA 4DVCA 5ECOB 1M7TA 3TJFA 4GLTA 2GQMA 2H6YA 1JZRA 2LUSA 3C7MA 2BMXA 1EGOA 1TTZA 2JACA 1ZCPA 4MJCA 3JCML 3N9JA 1WIKA 4OCFA 5E59A 1JLVA 2IWTA 6GSWA 5ECNB 1GTBA 1TRVA 4K7OA 3SBCA 1EV4A 2WDUA 1GLPA 2HSYA 4KE3A 5DCHA 5FT3A 3DRNA 1FOVA 1FO5A 1N2AA 4KDYA 2QGVA 5ENUA 3IAS2 3DGQA 4BWSA 5HR1A 1K0AA 4HUAA 3GUSA 2NDOA 2LSTA 1GSFA 1NSWA 3IPZA 2KHPA 5HFGA 2L6DA 3FR9A 2VL2C 3P90A 4LMWA 4F0BA 5IOWA 3Q18A 2WZ9A 5G1LA 18GSA 3UAPA 5ELGA 1B9XC 3IC4A 2WULA 1TP9A 1NW2A 3BCKA 3IE3A 1ZZYA 3PGTA 1URMA 5GSTA 3GH6A 1K0BA 3HY2A 3M3MA 5J9CA 1JHBA 3HD5A 1T00A 4PXOA 1EOHA 3M0FA 1UC7A 1ZYEA 3M8NA 2V2GA 1WRYA 5IO0A 3F6FA 4NAXA 3APSA 1YKCA 2VCZA 3WT1A 2LJAA 5F07A 1M2AA 4ZBAA 2CVDA 1XBSA 1GUKA 2IIYA 2WRTA 1F9MA 1GTUA 2IFQA 4MF5A 3NZNA 1T4YA 1Z5YE 3KP8A 1K3OA 4XS4B 1FVKA 1YEPA 2VIMA 2REMA 4TR3A 1SD8A 3ZYWA 2HRNA 2GSQA 3G9BA 5B7CA 4X1UA 1M2DA 1SJIA 4HU7A 1MD3A 2A2SA 3CSIA 1BYEA 1XWKA 4WBJA 3IBHA 4ULXA 1R4WA 4KA0A 3HDCA 2C0DA 4WF4A 4JEDA 2VCTA 3HZ8A 5ECPB 3IV4A 2YWMA 2HLSA 1EP8A 1T1VA 1EOGA 1GLQA 6GSSA 3TJJA 4BWQA 3H8QA 3E0UA 1B48A 3O76A 3GSSA 2PERA 4MZCA 5KN2A 1GSEA 4PQHA 2JSZA 2B7KA 4ZL9A 5JWOB 3FR3A 2GQLA 3MWHA 3LXTA 2TRXA 1MEKA 3IK9A 3ZTLA 5KN3A 2RLIA 4IKHA 2IMIA 3ZFBA 2IN3A 2N5FA 4PQIA 1K0DA 3F3RA 4FO5A 8GSSA 5CNWA 1U88A 4FYBA 4MMMA 3UIWA 3I9V2 2EIRA 4MJAA 2F8AA 2LQOA 1PGTA 2C0FA 3BD2A 3S9FA 3EU4A 4KSMA 2YPMA 3MDKA 1AW9A 3F4RA 4J2FA 2VCQA 3UEMA 2CVKA 1R26A 3D4TA 4POKA 12GSA 1TDIA 6GSVA 4AJ8A 2EIOA 1XFLA 3UBLA 4XCSA 3KD0A 3LSZA 2X8CA 1YF1A 5DQYA 4KX4A 2HZEB 2H6ZA 3PR8A 5DAKB 2RM6A 5IPGA 2LS5A 3V1WA 3GTUA 2PU9C 4KB3A 5F06A 2R4VA 2XPEA 2H71A 2A4VA 5ECQB 4XTSA 3TRXA 2HSHA 5D9TA 2OE0A 2VLVA 3VFIA 1E6BA 2HSNB 2FNOA 1TU8A 3D6IA 3FHKA 5IM9A 4G9HA 4EO3A 4Q5RA 1J0FA 4BVXB 3BBYA 2R6KA 4G0KA 5JWRB 2C3NA 2JZSA 2V6KA 2CZ2A 2NPBA 3EMXA 1GSYA 2FCHA 3QAWA 3HVXA 1OC9A 2DIZA 2GVPA 4KCEA 4IJ3A 1F3AA 2HNLA 1J08A 2QC7A 4O92A 4LMVA 1K0NA 4WKWA 5D8IA 20GSA 2B3SA 2FWEA 1A0FA 1G7EA 5CRWA 3GSTA 5GZZB 4MLYA 2YCDA 5CRGA 1IYHA 6GSTA 3GX8A 1U3IA 4N0VA 5CREA 2FA4A 2H01A 3IRAA 2P0GA 3CSJA 4GSTA 3EURA 5ID2B 2AHEA 1A2JA 3RHCA 2H73A 1DSBA 4L5OA 3GKXA 4WETA 2GSRA 1A0RP 4BL7A 2JADA 4ZBDA 1TRWA 5H5QA 2OKAA 1QMVA 2VL2A 4K7IA 1WMJA 3F4TA 1ST9A 2L5OA 4EDZA 1PKZA 1U87A 5FHIA 2DJ3A 5HR2A 1K0OA 3KJYA 5CP1A 4ZB8A 1SYRA 1DBYA 1FAAA 1R5AA 2FY6A 2MBSA 3GMFA 1LU4A 2HXKA 1ILOA 1TK8B 2FWHA 2H0IA 1G0TA 1TKDB 3ME7A 4PQ1A 5G30A 2OE3A
chains in the Genus database with same CATH superfamily
2O89A 4IELA 1FB0A 3FZ5A 1SJZA 3EWLA 4KSOA 3Q74A 5G1KA 2M72A 2H8LA 3APOA 5GAND 2H1GA 2PVQA 3CSHA 1XXUA 5E4WA 1SL0B 5DJMA 2OT3A 1XCCA 4GXZA 4YAPA 4G01A 1FB6A 1ZYQB 2ZCTA 4AF2A 3VPQA 3CRTA 5AGYA 1PKWA 4HJMA 1SKRB 1Q4JA 3ERGA 1SL2B 1GULA 2I1UA 3M9JA 2VL3A 1XZOA 2X64A 2V32A 1EGRA 2V6OA 5ECRB 1BX9A 3GL3A 2B1LA 1XWBA 1V40A 1BAYA 2NVLA 2B5EA 4ID0A 2YANA 2EFCA 4FQUA 4OFNA 4MK3A 2C4JA 2E2GA 1QXHA 1S3RA 3UARA 3H93A 4MP4A 1GH2A 2HRAA 4CY8A 3OR5A 2E0QA 5A5HA 1PD21 3D4MA 3KMNA 1M99A 1C72A 1B9YC 4TKYA 4ZL8A 1Z6NA 3FMWA 5JCUA 1ERVA 1HNAA 1PX6A 1GTAA 1HD2A 3KEBA 5BMUA 4GTUA 5IMVA 4OD7A 4TW5A 3IA1A 2V1MA 3HXSA 4JZQA 2QKEA 1ERTA 2ALBA 6GSUA 2DMMA 2GS3A 2KP2A 3TJBA 1X9MB 2L6CA 5A5HB 1VF2A 1U3AA 1U6TA 2WCIA 3F3QA 4AGSA 5AIVA 4CDOA 4NV2A 1VF4A 2VLUA 10GSA 3APQA 3KIJA 2H75A 2I3YA 2DIYA 4JR6A 4WXTA 2RUFA 2VCVA 4HQSA 2K8SA 2JL4A 3L9SA 4DSSB 4K0NA 2YZUA 1AIUA 1TJDA 3R2QA 4TXVA 4Q5QA 4OFTA 4NHZA 1ZGNA 2C8UA 3K8NA 2JZTA 2CT6A 1WP0A 2DJ1A 3ZMLA 1YZXA 4KGIA 2JSYA 2OBKA 5B8AA 2VKZG 1SK1A 3KH7A 4GRFA 1O8XA 4ECIA 5JCWA 3GRXA 3U5RE 5AISA 2BJXA 2XC2A 1LBKA 3I69A 2GLRA 1W89A 3D5JA 3QAGA 3CXGA 5D73A 1K3YA 4HI7A 4NXIA 1HYUA 4HS1A 2F51A 2B7JA 5G5FA 2WVXA 2H30A 5INYA 2F9SA 2H1BA 3P7XA 1BEDA 1YJ6A 1OVNA 4GQCA 1H75A 1M3JA 3IHGA 4H86A 5KEJA 4ZB6A 4AKHA 2ES7A 4MA9A 1GL8A 4PI0C 3UJ1A 2WW1A 4MDCA 4POLA 4OCEA 2A2RA 3CWGA 1G6WA 4V1Ag 1SENA 2DJJA 3C8EA 3WYWA 4DEJA 3KCMA 1F3BA 4I2TA 4GF0A 4TRXA 2DKHA 22GSA 3ZFLA 2KUCA 2F3MA 1UVZA 4WF5A 4E8HA 2WGRA 3C71A 4XS1A 4GWRA 2YWOA 2LRCA 5A34B 4LL1B 1N8JA 4EKZA 2QSIA 1FW1A 3FYGA 1DE2A 2HQTA 3U6VA 2PWJA 4HEA2 3D0ZA 2C1YA 3LEFA 4TOPA 2L4QA 4L8EA 4RI7A 3MNGA 3FR6A 1I5GA 2H1DA 2NTOA 5IMCA 4KDUA 3TRPA 5A4WA 4K6XA 1XW5A 3KTBA 2IMFA 4NV5A 1BG5A 3GHAA 1GUMA 3QR6A 3TKPA 1SVOA 2DMLA 2IFQB 3IC8A 5COHA 3EPTA 4JRRA 5EL8A 5F0GA 4E8EA 4AI6A 4D73A 5DDLA 3VI5A 1SJ6A 1AXDA 1V98A 4O7HA 4NPBA 1OE8A 3C1SA 3O3TA 1PRXA 2JZRA 5ECHB 1BQ7A 1GSQA 4K5SA 4HOJA 2X99A 3ISOA 3LFLA 2K6VA 1PSQA 2AJQB 1SK0A 4EL1A 5CO3A 2PVOC 2FHEA 2H66A 1T3BA 3GN3A 5DJLA 2E2MA 3LYPA 4F0CA 3CTGA 1RK4A 5CRDA 3GKNA 17GSA 3L0HA 2RUEA 5LCZA 1XPVA 1M9BA 2L57A 4HU9A 4PURA 3UOMA 4AKGA 1TU7A 3PH9A 2P5RA 3ZITA 2K9FA 4XHMA 1JFUA 3J7Yb 1HNBA 1TOFA 4Z7XA 2XPDA 2GQKA 4IQAA 1AC1A 2R37A 1PN9A 1MDIA 2YN1A 3H4KA 4ECJA 4RQRA 4MH3A 4K2DA 3KGKA 2VUPA 3GNJA 3VWVA 1KTEA 3ZVJD 4MF6A 3F9UA 3ERWA 3LQ7A 1RW1A 3IXRA 4ACSA 1LJRA 9GSSA 3H79A 2O5VA 2E7PA 1JZOA 1THOA 3Q6OA 4TR1A 5A4VA 1CQGA 2L5LA 1FHEA 3HJMA 5ABRA 4I8BA 1X5DA 4WBRD 4J57E 1GSSA 1EEJA 4POBA 4AJ6A 4NMUA 1DE1A 5BRTA 5GAPD 3VK9A 2G2QA 3HCZA 2HE3A 1OAZA 2LV3A 3AY8A 2XHFA 2WZSA 5AN1A 3TJKA 1QFNA 3RBTA 3HHVA 4XS6A 5KN1A 4HQZA 1JLWA 2HRKA 4F03A 1XWAA 1ACVA 2B6MA 3ME8A 3GTUB 3HMJG 4MCUA 2HZFA 3LGCA 1F6MC 3HA9A 3G7JA 2BTOT 4O5UA 3J7Yk 3KXOA 5A1NA 1M2BA 1WWJA 1PFOA 4ECCA 5KN0A 3TKSE 4RUVA 4Z2TA 3CYNA 4OO5A 3DXBA 1GRXA 3KZQA 2LJRA 3VLNA 2LRTA 4HJ2A 3HVVA 4EF0A 3TKRA 1R5PA 2H0HA 2N5BA 2YNXA 3L9UA 1YDKA 3R3EA 2CAIA 5ECIB 4RI6A 5DALA 2YWNA 4MPGA 4FYUA 1M0UA 3SWLA 3VPTA 4Z2UA 4IP1A 2FUG2 5LD0A 2LKUA 3FW2A 4MH2A 2M46A 3PPUA 3WT2A 4K2XA 1V58A 2DJ0A 2GZPA 2CZ3A 1OC9B 3UL3A 2LEGA 3DD3A 3RAZA 4ZXGA 4HZ4A 5J5NA 2F8FA 2HSMA 2AYTA 4AJ7A 2GDRA 1TK5B 2H76A 3DVXA 4V2LA 3FK8A 5A4UA 5EVOA 4OO4A 2WFCA 1WE0A 3A5WA 1GWCA 1EP7A 2IL3A 2VLTA 2RM5A 3IR4A 1PN0A 4IN0A 2CAQA 5FWGA 1TRUA 1PA3A 1PMTA 2FA8A 1OC8A 1RQMA 4MF7A 3ZRDA 3A2XA 4BL7B 2CV4A 3RPNA 1XOAA 5J40A 2DJKA 1NHOA 1GNEA 4ZB7A 4BVYA 2MMOA 5CRHA 4ECBA 2C3TA 3GURA 2YJ7A 1EZKA 5G2ZA 1X5EA 4TXOA 2VM2A 1O8WA 2FD3A 2I81A 2H1LA 2CX4A 2KP1A 1Q98A 2H72A 2PBJA 5HQPA 2AAWA 2LJKA 4PNFA 1X9WB 2NBSA 5JCGA 3WGEA 4EE0A 2GSSA 3LJRA 1S3DA 1SU9A 2L59A 4ZL7A 3GFKA 2K18A 4IW9A 16GSA 4IJIA 1MTCA 4CY6A 3EVIA 2WB9A 4V1Ap 5IMAA 13GSA 1AQXA 4N30A 3W8SA 4FIWA 2IJYA 1AAZA 1WJKA 4I5QA 1THXA 2DSAA 3HYPA 14GSA 4KNDA 1DUGA 3BCIA 1A2MA 3KP9A 3W8JA 2PMTA 4CW9A 3DMLA 4PNGA 3EC3A 1VF1A 5ECMB 3RPPA 5IMFA 1OC3A 1TXXA 1YY7A 3HZ4A 5C04A 3RHBA 1XVWA 4EIPA 5DCGA 2H6XA 2R0PA 2ON5A 3US3A 1B4QA 4MNNA 1HNCA 2X8HA 3F8UA 1Z6MA 4PHZC 2VL9A 1T4ZA 2VM1A 3VWUA 2H74A 3QDNA 5ECKB 4PGTA 1WOUA 2IMDA 2R0GA 1SD9A 4J56E 4GCIA 1EWXA 1ERUA 1O81A 4EXJA 1SK2A 3TOUA 2HT9A 4Q5FA 5D96A 4XRAA 2IMKA 3RFRC 4YAVA 1AQWA 3CRUA 3EE2A 5BMUB 1O6JA 2M80A 3HVNA 3UVTA 3TKQA 5IMDA 4O5RA 1M3IA 4PUFC 1SL1B 2O36A 1T8EB 1ZOFA 3UVHA 2MYGA 3IDVA 1G7OA 2CX3A 3ZIVA 2XBIA 4PTSA 2L4CA 3MSZA 1J9BA 2VD1A 2YWIA 3E9JB 5J47A 2B5XA 5J4UA 3L9VA 4RQXA 4ZILA 4ZBBA 3L4NA 2R0CA 3H1NA 1OKDA 4WR5A 4G19A 4FYCA 4JU5A 3HVSA 2OE1A 1TRSA 2K8VA 1GUHA 3P8WA 4IP6A 1BG1A 3GKKA 2FLSA 1Y6EA 1EV9A 2WW3A 2H19A 4NWYA 5HR3A 4YKFA 3WGXA 1GP1A 2DJ2A 4GDFA 4OFMA 1O73A 3VURA 3QFBC 3W6GA 3A2VA 3BJ5A 4ILFA 3WGDA 5G31A 2J9HA 3IOSA 1A2LA 4I97A 2CVBA 2FGXA 1A23A 2WVZA 2MZCA 5IPHA 1GTIA 2CA8A 4L0UA 4QL7A 3QOUA 2R3XA 2C0EA 2OBIA 2H70A 2GZZA 4JBBA 3QMXA 4POMA 2WVXB 2G0FA 4XS4A 1VF3A 2X8GA 3O6TA 2O7KA 4KDXA 2YOIA 4XIHA 3E3EA 3FRCA 4K8MA 5JWQB 2GTUA 3GX0A 2YZHA 4EVMA 3F6DA 3DIEA 1F37A 1X5CA 4MZBA 1W4VA 5D9VA 2KLXA 3QCPA 1YEXA 4EUYA 3GV1A 5J4YA 3KTLA 4JE1A 3TKSA 3GYKA 5A5KA 3KM6A 2VOCA 4N0ZA 2X49A 4KH7A 5G5EA 4WR4A 4YQUA 2R2JA 4JR4A 4HZ2A 3EYTA 2O85A 2YJHA 3N5OA 19GSA 3FY7A 1H4OA 3DKSA 3G7YA 1SYXA 3Q19A 1XOBA 2RIIA 4FH8A 4G10A 1Y25A 2EFHA 3C73A 1YKAA 3C1RA 4V2MA 6GSYA 1VRSD 3DEXA 2PUKC 1VGLA 5IMZA 1KEBA 2C3QA 1FVJA 1ON4A 1SKSB 3P2AA 1TI1A 2HRFA 4O5QA 2VCXA 4EDYA 2PGTA 4GQFA 3F63A 1TK0B 1XW9A 5J3RA 3ZMKA 2A2PA 4G0LA 5F8BA 2MBTA 5IO2A 1EEMA 1ABAA 3TJGA 4HDEA 5DBQA 2CQ9A 1F2EA 4KUNA 3MIXA 1S3CA 3GIXA 4D73B 2TIRA 4TVEA 2R5GA 2B1KA 3PINA 5H5RA 1TW9A 4X4JA 2DBCA 3KH9A 4IHUA 1V9WA 2AV4A 1Z7RA 5EPFA 2IMEA 3TCOA 3EU3A 2O87A 3ZL5A 3FEUA 2Z9SA 1XVQA 4E68A 2HZEA 5DAKA 3BOAA 3NIVA 7GSSA 5EY6A 4X0XA 3RDWA 3DWVA 4GSNA 1K3LA 4ZIJA 1HQOA 3FZ9A 1OYJA 5IQYA 2HI7A 2AB6A 2OACA 2YV7A 1JZWA 5B8BA 1IYIA 2HSNA 5ECLB 4QL9A 3ZIJA 1PQNA 4A5PA 3IK7A 4NHWA 4ZB9A 4LL4B 4BVXA 1ML6A 1K0MA 3ZZXA 4G2EA 2YP6A 5CYYA 4MABA 4MJEA 1A8LA 4X43A 4ML6A 3FZ4A 3KMOA 1CQHA 2LRNA 3HJPA 3HKRA 4TR4A 1T7PB 1OKTA 1QK8A 3GKMA 2AUVA 1MDKA 2VO4A 4TR1B 4IBPA 1ERWA 5LNKe 2GGTA 2I4AA 4N11A 1BF5A 1XIYA 4L5LA 2VAFA 1V2AA 4G0IA 4DSRA 1USBA 2X4AA 1PX7A 4N10A 2VCWA 2OADA 3LXZA 3CMIA 4F2IA 4GSSA 5D9XA 4TR0A 3LG6A 1V57A 1Z9HA 1NM3A 2PN8A 4I2UA 5IOXA 2D2ZA 5B6MA 4Q5NA 2HRKB 3FKFA 5ID2A 1MDJA 3HJOA 3LYKA 11GSA 4O32A 3CHXC 4OMVA 1QQ2A 4WEYA 4TN8A 2WJUA 2I9HA 5D93A 3D22A 3TDGA 5A1NB 3D21A 4IVFA 5DVBA 2YV9A 5H5SA 4DSQA 2TRCP 5HFKA 3I6AA 4K7NA 2P31A 3F4SA 5J9BA 1AQVA 5J4VA 1FG4A 1SKWB 1R7HA 1PL2A 4KAEA 2HYXA 4BIKA 2LNSA 2LNTA 5DALB 5L71A 3TB2A 1XWCA 3WD6A 1ZL9A 3TOTA 1WPIA 2IPAA 5ECSA 3TKSC 3CTFA 3CBUA 4I6XA 2DC5A 4V2NA 3VWWA 3EMPA 2ZUPA 2HFDA 2FWFA 2GSTA 1BJXA 1X9SB 1O7UA 3QFAC 2HSMB 4IS0A 3F0IA 1JZDA 5J41A 4YH2A 1TI3A 3ZLPA 4BA7A 3L78A 2MMAA 2KOKA 5IIZA 3QAVA 3TUEA 4ICYA 4MPFA 1QGVA 3EINA 3MYDA 4ML1A 5AIXA 5GSSA 3UBKA 3TGZA 2EFEA 4K0GA 3VWXA 1A24A 1Z7PA 3DYRA 2GT6A 3IAM2 1PL1A 3DVWA 1X0RA 2DLXA 3ERFA 2OJLA 3VI7A 1M9AA 2ON7A 2UZ8A 4EC0A 4CHSA 4PX1A 1G6YA 3G7IA 2GZYA 1S3AA 4BVYB 2VD0A 1GSDA 4QQ7A 4YQMA 1GSUA 4TXOB 1Z3EA 1GNWA 2DKIA 4IGJA 4IQ1A 2EIQA 3IHQA 2EFDA 3QPMA 3TRQA 4BPYA 3ZREA 5ELAA 3MAKA 3ED3A 2N5AA 4K1FA 1K0CA 3GA4A 3LWAA 1KNGA 5CAXA 2H1AA 1A8YA 2V41A 2J23A 5F05A 2C0GA 4HSCX 4F9ZA 3A2WA 2XBQA 3UMAA 4F82A 1B4PA 2H0GA 3A3TA 4OWYA 5C00A 2JU5A 4PI2C 2LTKA 3NOFA 1AUCA 2O8VB 4P3YB 3TU3B 1O85A 5KOWA 4MJBA 2O3EA 1I9DA 4ISDA 2WS2A 4USSA 2MMZA 2LQQA 3LORA 6GSXA 4K9ZA 5HFIA 1E2YA 4KCAA 1NHYA 3I43A 3M9KA 3GL5A 1YF0A 4L0WA 1YQ1A 1TXUA 5D9WA 2P5QA 4LA1A 4DSSA 2GT5A 4W66A 2UV8G 4YQVA 1MD4A 4XRDA 4KW6A 3QD9A 2ZNMA 2FWGA 5DQSA 1UN2A 2C80A 4MZWA 3M1GA 2EC4A 5B6NA 4LLRA 2B5YA 1UA5A 2MMNA 1XWGA 2OA7A 1KBNA 3ZVJA 1OE7A 4KF9A 3GH9A 5HR0A 4PUAA 2PPTA 3FZAA 1B8XA 1ZMAA 1XW6A 1ZYNA 1QUWA 4DVCA 5ECOB 1M7TA 3TJFA 4GLTA 2GQMA 2H6YA 1JZRA 2LUSA 3C7MA 2BMXA 1EGOA 1TTZA 2JACA 1ZCPA 4MJCA 3JCML 3N9JA 1WIKA 4OCFA 5E59A 1JLVA 2IWTA 6GSWA 5ECNB 1GTBA 1TRVA 4K7OA 3SBCA 1EV4A 2WDUA 1GLPA 2HSYA 4KE3A 5DCHA 5FT3A 3DRNA 1FOVA 1FO5A 1N2AA 4KDYA 2QGVA 5ENUA 3IAS2 3DGQA 4BWSA 5HR1A 3LW9A 1K0AA 4HUAA 3GUSA 2NDOA 2LSTA 1GSFA 1NSWA 2QA2A 3IPZA 2KHPA 5HFGA 2L6DA 3FR9A 2VL2C 3P90A 4LMWA 4F0BA 5IOWA 3Q18A 2WZ9A 5G1LA 18GSA 3RGBC 3UAPA 5ELGA 1B9XC 3IC4A 2WULA 1TP9A 1NW2A 3BCKA 3IE3A 1ZZYA 1YVLA 1FOHA 3PGTA 4FXYP 5A34A 1URMA 5GSTA 3GH6A 1K0BA 3HY2A 3M3MA 5J9CA 1JHBA 3HD5A 1T00A 4PXOA 1EOHA 3M0FA 4YKGA 1UC7A 1ZYEA 3M8NA 2V2GA 1WRYA 1SVLA 5IO0A 3F6FA 4NAXA 3APSA 1YKCA 2VCZA 4QMKA 3WT1A 2LJAA 5F07A 1M2AA 4ZBAA 2CVDA 1XBSA 1GUKA 2IIYA 2WRTA 1F9MA 1GTUA 2IFQA 4MF5A 3NZNA 1T4YA 1Z5YE 3KP8A 1K3OA 4XS4B 5KOXA 1FVKA 4K5RA 1YEPA 2VIMA 1N25A 2REMA 4TR3A 1SD8A 3ZYWA 2HRNA 2GSQA 3G9BA 5B7CA 4X1UA 1M2DA 1SJIA 4HU7A 1MD3A 2A2SA 3CSIA 1BYEA 1XWKA 4WBJA 3IBHA 4ULXA 1R4WA 4KA0A 3HDCA 3A5IA 2C0DA 4WF4A 4JEDA 2VCTA 3HZ8A 2WVYA 5ECPB 3IV4A 2YWMA 2HLSA 2WW2A 1EP8A 1T1VA 1EOGA 4AKXB 1GLQA 6GSSA 3TJJA 1XG8A 4BWQA 3H8QA 3E0UA 1B48A 3O76A 3GSSA 2PERA 1Y1UA 4MZCA 5KN2A 1GSEA 4PQHA 2JSZA 2B7KA 4ZL9A 5JWOB 3FR3A 2GQLA 3MWHA 1S4BP 3LXTA 2TRXA 1MEKA 3IK9A 3ZTLA 5KN3A 2RLIA 4IKHA 2IMIA 3ZFBA 2IN3A 2N5FA 4PQIA 1K0DA 3F3RA 4FO5A 2A4HA 8GSSA 5CNWA 1U88A 4FYBA 4MMMA 3UIWA 3I9V2 2EIRA 4MJAA 2F8AA 2LQOA 1PGTA 2C0FA 3BD2A 3S9FA 3EU4A 4KSMA 2YPMA 3MDKA 1AW9A 3F4RA 4J2FA 2VCQA 3UEMA 2CVKA 1R26A 1SVMA 3D4TA 4POKA 12GSA 1TDIA 6GSVA 4AJ8A 2EIOA 1XFLA 3UBLA 4XCSA 3KD0A 4N3ZA 3LSZA 2X8CA 1YF1A 5DQYA 4KX4A 2HZEB 2H6ZA 3PR8A 5DAKB 2RM6A 5IPGA 2LS5A 3V1WA 3GTUA 2PU9C 4KB3A 5F06A 2R4VA 2XPEA 2H71A 2A4VA 5ECQB 2QA1A 4XTSA 3TRXA 2HSHA 5D9TA 4AKIA 2OE0A 2VLVA 3VFIA 1E6BA 2HSNB 2FNOA 1TU8A 3D6IA 3FHKA 5IM9A 4G9HA 4EO3A 4Q5RA 1J0FA 4BVXB 3BBYA 2R6KA 4G0KA 5JWRB 2C3NA 2JZSA 2V6KA 2CZ2A 2NPBA 1ZYPA 3EMXA 1GSYA 2FCHA 3HVXA 3QAWA 1OC9A 2DIZA 2GVPA 4KCEA 1F3AA 4IJ3A 2HNLA 1J08A 2QC7A 4O92A 4LMVA 1K0NA 4WKWA 5D8IA 20GSA 2B3SA 2FWEA 1A0FA 2WW0A 1G7EA 5CRWA 3GSTA 5GZZB 4MLYA 2YCDA 5CRGA 1IYHA 6GSTA 1YEWC 3GX8A 1U3IA 4N0VA 5CREA 2FA4A 2H01A 3IRAA 2P0GA 3CSJA 4GSTA 3EURA 5ID2B 2AHEA 1A2JA 3RHCA 2H73A 1DSBA 4L5OA 3GKXA 4Z2RA 4WETA 2GSRA 1A0RP 3CQFA 4BL7A 2JADA 4ZBDA 1TRWA 5H5QA 2OKAA 1QMVA 2VL2A 4K7IA 1WMJA 3F4TA 1ST9A 2L5OA 4EIQA 4EDZA 1PKZA 1U87A 5FHIA 2DJ3A 5HR2A 1K0OA 3KJYA 5CP1A 4ZB8A 1SYRA 1DBYA 1FAAA 1R5AA 2FY6A 2MBSA 3GMFA 1LU4A 2HXKA 1ILOA 1TK8B 2FWHA 2H0IA 1G0TA 1I1IP 1TKDB 3ME7A 4PQ1A 5G30A 2OE3A
chains in the Genus database with same CATH topology
2O89A 4IELA 1FB0A 3FZ5A 1SJZA 3EWLA 4KSOA 3Q74A 5G1KA 2M72A 2H8LA 3APOA 5GAND 2H1GA 2PVQA 3CSHA 1XXUA 5E4WA 1SL0B 5DJMA 2OT3A 1XCCA 4GXZA 4YAPA 4G01A 1FB6A 1ZYQB 2ZCTA 4AF2A 3VPQA 3CRTA 5AGYA 1PKWA 4HJMA 1SKRB 1Q4JA 3ERGA 1SL2B 1GULA 2I1UA 3M9JA 2VL3A 1XZOA 2X64A 2V32A 1EGRA 2V6OA 5ECRB 1BX9A 3GL3A 2B1LA 1XWBA 1V40A 1BAYA 2NVLA 2B5EA 4ID0A 2YANA 2EFCA 4FQUA 4OFNA 4MK3A 2C4JA 2E2GA 1QXHA 3UARA 3H93A 4MP4A 1GH2A 2HRAA 4CY8A 3OR5A 2E0QA 5A5HA 1PD21 3D4MA 3KMNA 1M99A 1C72A 1B9YC 4TKYA 4ZL8A 1Z6NA 3FMWA 5JCUA 1ERVA 1HNAA 1PX6A 1GTAA 1HD2A 3KEBA 5BMUA 4GTUA 5IMVA 4OD7A 4TW5A 3IA1A 2V1MA 3HXSA 4JZQA 2QKEA 1ERTA 2ALBA 6GSUA 2DMMA 2GS3A 2KP2A 3TJBA 1X9MB 2L6CA 5A5HB 1VF2A 1U3AA 1U6TA 2WCIA 3F3QA 4AGSA 5AIVA 4CDOA 4NV2A 1VF4A 2VLUA 10GSA 3APQA 3KIJA 2H75A 2I3YA 2DIYA 4JR6A 4WXTA 2RUFA 2VCVA 4HQSA 2K8SA 2JL4A 3L9SA 4DSSB 4K0NA 2YZUA 1AIUA 1TJDA 3R2QA 4TXVA 4Q5QA 4OFTA 4NHZA 1ZGNA 2C8UA 3K8NA 2JZTA 2CT6A 1WP0A 2DJ1A 3ZMLA 1YZXA 4KGIA 2JSYA 2OBKA 5B8AA 2VKZG 1SK1A 3KH7A 4GRFA 1O8XA 4ECIA 5JCWA 3GRXA 3U5RE 5AISA 2BJXA 2XC2A 1LBKA 3I69A 2GLRA 1W89A 3D5JA 3QAGA 3CXGA 5D73A 1K3YA 4HI7A 4NXIA 1HYUA 4HS1A 2F51A 2B7JA 5G5FA 2H30A 5INYA 2F9SA 2H1BA 3P7XA 1BEDA 1YJ6A 1OVNA 4GQCA 1H75A 3IHGA 4H86A 5KEJA 4ZB6A 4AKHA 2ES7A 4MA9A 1GL8A 3UJ1A 4MDCA 4POLA 4OCEA 2A2RA 3CWGA 1G6WA 4V1Ag 1SENA 2DJJA 3C8EA 3WYWA 4DEJA 3KCMA 1F3BA 4I2TA 4GF0A 4TRXA 2DKHA 22GSA 3ZFLA 2KUCA 2F3MA 1UVZA 4WF5A 4E8HA 2WGRA 3C71A 4XS1A 4GWRA 2YWOA 2LRCA 5A34B 4LL1B 1N8JA 4EKZA 2QSIA 1FW1A 3FYGA 1DE2A 2HQTA 3U6VA 2PWJA 4HEA2 3D0ZA 3LEFA 2C1YA 4TOPA 2L4QA 4L8EA 4RI7A 3MNGA 3FR6A 1I5GA 2H1DA 2NTOA 5IMCA 4KDUA 3TRPA 5A4WA 4K6XA 1XW5A 3KTBA 2IMFA 4NV5A 1BG5A 3GHAA 1GUMA 3QR6A 3TKPA 1SVOA 2DMLA 2IFQB 3IC8A 5COHA 3EPTA 4JRRA 5EL8A 5F0GA 4E8EA 4AI6A 4D73A 5DDLA 3VI5A 1SJ6A 1AXDA 1V98A 4O7HA 4NPBA 1OE8A 3C1SA 3O3TA 1PRXA 2JZRA 5ECHB 1BQ7A 1GSQA 4K5SA 4HOJA 2X99A 3ISOA 3LFLA 2K6VA 1PSQA 2AJQB 1SK0A 4EL1A 5CO3A 2PVOC 2FHEA 2H66A 1T3BA 3GN3A 5DJLA 2E2MA 3LYPA 4F0CA 3CTGA 1RK4A 5CRDA 3GKNA 17GSA 3L0HA 2RUEA 5LCZA 1XPVA 1M9BA 2L57A 4HU9A 4PURA 3UOMA 4AKGA 1TU7A 3PH9A 2P5RA 3ZITA 2K9FA 4XHMA 1JFUA 3J7Yb 1HNBA 1TOFA 4Z7XA 2XPDA 2GQKA 4IQAA 1AC1A 2R37A 1PN9A 1MDIA 2YN1A 3H4KA 4ECJA 4RQRA 4MH3A 4K2DA 3KGKA 2VUPA 3GNJA 3VWVA 1KTEA 3ZVJD 4MF6A 3F9UA 3ERWA 3LQ7A 1RW1A 3IXRA 4ACSA 1LJRA 9GSSA 3H79A 2O5VA 2E7PA 1JZOA 1THOA 3Q6OA 4TR1A 5A4VA 1CQGA 2L5LA 1FHEA 3HJMA 5ABRA 4I8BA 1X5DA 4WBRD 4J57E 1GSSA 1EEJA 4POBA 4AJ6A 4NMUA 1DE1A 5BRTA 5GAPD 3VK9A 2G2QA 3HCZA 2HE3A 1OAZA 2LV3A 3AY8A 2XHFA 5AN1A 3TJKA 1QFNA 3RBTA 3HHVA 4XS6A 5KN1A 4HQZA 1JLWA 2HRKA 4F03A 1XWAA 1ACVA 2B6MA 3ME8A 3GTUB 3HMJG 4MCUA 2HZFA 3LGCA 1F6MC 3HA9A 3G7JA 2BTOT 4O5UA 3J7Yk 3KXOA 5A1NA 1M2BA 1WWJA 4ECCA 5KN0A 3TKSE 4RUVA 4Z2TA 3CYNA 4OO5A 3DXBA 1GRXA 3KZQA 2LJRA 3VLNA 2LRTA 4HJ2A 3HVVA 4EF0A 3TKRA 1R5PA 2H0HA 2N5BA 2YNXA 3L9UA 1YDKA 3R3EA 2CAIA 5ECIB 4RI6A 5DALA 2YWNA 4MPGA 4FYUA 1M0UA 3SWLA 3VPTA 4Z2UA 4IP1A 2FUG2 5LD0A 2LKUA 3FW2A 4MH2A 2M46A 3PPUA 3WT2A 4K2XA 1V58A 2DJ0A 2GZPA 2CZ3A 1OC9B 3UL3A 2LEGA 3DD3A 3RAZA 4ZXGA 4HZ4A 5J5NA 2F8FA 2HSMA 2AYTA 4AJ7A 2GDRA 1TK5B 2H76A 3DVXA 4V2LA 3FK8A 5A4UA 5EVOA 4OO4A 2WFCA 1WE0A 3A5WA 1GWCA 1EP7A 2IL3A 2VLTA 2RM5A 3IR4A 1PN0A 4IN0A 2CAQA 5FWGA 1TRUA 1PA3A 1PMTA 2FA8A 1OC8A 1RQMA 4MF7A 3ZRDA 3A2XA 4BL7B 2CV4A 3RPNA 1XOAA 5J40A 2DJKA 1NHOA 1GNEA 4ZB7A 4BVYA 2MMOA 5CRHA 4ECBA 2C3TA 3GURA 2YJ7A 1EZKA 5G2ZA 1X5EA 4TXOA 2VM2A 1O8WA 2FD3A 2I81A 2H1LA 2CX4A 2KP1A 1Q98A 2H72A 2PBJA 5HQPA 2AAWA 2LJKA 4PNFA 1X9WB 2NBSA 5JCGA 3WGEA 4EE0A 2GSSA 3LJRA 1S3DA 1SU9A 2L59A 4ZL7A 3GFKA 2K18A 4IW9A 16GSA 4IJIA 1MTCA 4CY6A 3EVIA 2WB9A 4V1Ap 5IMAA 13GSA 1AQXA 4N30A 3W8SA 4FIWA 2IJYA 1AAZA 1WJKA 4I5QA 1THXA 2DSAA 3HYPA 14GSA 4KNDA 1DUGA 3BCIA 1A2MA 3KP9A 3W8JA 2PMTA 4CW9A 3DMLA 4PNGA 3EC3A 1VF1A 5ECMB 3RPPA 5IMFA 1OC3A 1TXXA 1YY7A 3HZ4A 5C04A 3RHBA 1XVWA 4EIPA 5DCGA 2H6XA 2R0PA 2ON5A 3US3A 1B4QA 4MNNA 1HNCA 2X8HA 3F8UA 1Z6MA 2VL9A 1T4ZA 2VM1A 3VWUA 2H74A 3QDNA 5ECKB 4PGTA 1WOUA 2IMDA 2R0GA 1SD9A 4J56E 4GCIA 1EWXA 1ERUA 1O81A 4EXJA 1SK2A 3TOUA 2HT9A 4Q5FA 5D96A 4XRAA 2IMKA 4YAVA 1AQWA 3CRUA 3EE2A 5BMUB 1O6JA 2M80A 3UVTA 3TKQA 5IMDA 4O5RA 4PUFC 1SL1B 1T8EB 1ZOFA 3UVHA 2MYGA 3IDVA 1G7OA 2CX3A 3ZIVA 2XBIA 4PTSA 2L4CA 3MSZA 1J9BA 2VD1A 2YWIA 3E9JB 5J47A 2B5XA 5J4UA 3L9VA 4RQXA 4ZILA 4ZBBA 3L4NA 2R0CA 3H1NA 1OKDA 4WR5A 4G19A 4FYCA 4JU5A 3HVSA 2OE1A 1TRSA 2K8VA 1GUHA 3P8WA 4IP6A 1BG1A 3GKKA 2FLSA 1Y6EA 1EV9A 2H19A 4NWYA 5HR3A 4YKFA 3WGXA 1GP1A 2DJ2A 4GDFA 4OFMA 1O73A 3VURA 3QFBC 3W6GA 3A2VA 3BJ5A 4ILFA 3WGDA 5G31A 2J9HA 3IOSA 1A2LA 4I97A 2CVBA 2FGXA 1A23A 2MZCA 5IPHA 1GTIA 2CA8A 4L0UA 4QL7A 3QOUA 2R3XA 2C0EA 2OBIA 2H70A 2GZZA 4JBBA 3QMXA 4POMA 2G0FA 4XS4A 1VF3A 2X8GA 3O6TA 2O7KA 4KDXA 2YOIA 4XIHA 3E3EA 3FRCA 4K8MA 5JWQB 2GTUA 3GX0A 2YZHA 4EVMA 3F6DA 3DIEA 1F37A 1X5CA 4MZBA 1W4VA 5D9VA 2KLXA 3QCPA 1YEXA 4EUYA 3GV1A 5J4YA 3KTLA 4JE1A 3TKSA 3GYKA 5A5KA 3KM6A 2VOCA 4N0ZA 2X49A 4KH7A 5G5EA 4WR4A 4YQUA 2R2JA 4JR4A 4HZ2A 3EYTA 2O85A 2YJHA 3N5OA 19GSA 3FY7A 1H4OA 3DKSA 3G7YA 1SYXA 3Q19A 1XOBA 2RIIA 4FH8A 4G10A 1Y25A 2EFHA 3C73A 1YKAA 3C1RA 4V2MA 6GSYA 1VRSD 3DEXA 2PUKC 1VGLA 5IMZA 1KEBA 2C3QA 1FVJA 1ON4A 1SKSB 3P2AA 1TI1A 2HRFA 4O5QA 2VCXA 4EDYA 2PGTA 4GQFA 3F63A 1TK0B 1XW9A 5J3RA 3ZMKA 2A2PA 4G0LA 5F8BA 2MBTA 5IO2A 1EEMA 1ABAA 3TJGA 4HDEA 5DBQA 2CQ9A 1F2EA 4KUNA 3MIXA 1S3CA 3GIXA 4D73B 2TIRA 4TVEA 2R5GA 2B1KA 3PINA 5H5RA 1TW9A 4X4JA 2DBCA 3KH9A 4IHUA 1V9WA 2AV4A 1Z7RA 5EPFA 2IMEA 3TCOA 3EU3A 2O87A 3ZL5A 3FEUA 2Z9SA 1XVQA 4E68A 2HZEA 5DAKA 3BOAA 3NIVA 7GSSA 5EY6A 4X0XA 3RDWA 3DWVA 4GSNA 1K3LA 4ZIJA 1HQOA 3FZ9A 1OYJA 5IQYA 2HI7A 2AB6A 2OACA 2YV7A 1JZWA 5B8BA 1IYIA 2HSNA 5ECLB 4QL9A 3ZIJA 1PQNA 4A5PA 3IK7A 4NHWA 4ZB9A 4LL4B 4BVXA 1ML6A 1K0MA 3ZZXA 4G2EA 2YP6A 5CYYA 4MABA 4MJEA 1A8LA 4X43A 4ML6A 3FZ4A 3KMOA 1CQHA 2LRNA 3HJPA 3HKRA 4TR4A 1T7PB 1OKTA 1QK8A 3GKMA 2AUVA 1MDKA 2VO4A 4TR1B 4IBPA 1ERWA 5LNKe 2GGTA 2I4AA 4N11A 1BF5A 1XIYA 4L5LA 2VAFA 1V2AA 4G0IA 4DSRA 1USBA 2X4AA 1PX7A 4N10A 2VCWA 2OADA 3LXZA 3CMIA 4F2IA 4GSSA 5D9XA 4TR0A 3LG6A 1V57A 1Z9HA 1NM3A 2PN8A 4I2UA 5IOXA 2D2ZA 5B6MA 4Q5NA 2HRKB 3FKFA 5ID2A 1MDJA 3HJOA 3LYKA 11GSA 4O32A 4OMVA 1QQ2A 4WEYA 4TN8A 2WJUA 2I9HA 5D93A 3D22A 3TDGA 5A1NB 3D21A 4IVFA 5DVBA 2YV9A 5H5SA 4DSQA 2TRCP 5HFKA 3I6AA 4K7NA 2P31A 3F4SA 5J9BA 1AQVA 5J4VA 1FG4A 1SKWB 1R7HA 1PL2A 4KAEA 2HYXA 2LNSA 2LNTA 5DALB 5L71A 3TB2A 1XWCA 3WD6A 1ZL9A 3TOTA 1WPIA 2IPAA 5ECSA 3TKSC 3CTFA 3CBUA 4I6XA 2DC5A 4V2NA 3VWWA 3EMPA 2ZUPA 2HFDA 2FWFA 2GSTA 1BJXA 1X9SB 1O7UA 3QFAC 2HSMB 4IS0A 3F0IA 1JZDA 5J41A 4YH2A 1TI3A 3ZLPA 4BA7A 3L78A 2MMAA 2KOKA 5IIZA 3QAVA 3TUEA 4ICYA 4MPFA 1QGVA 3EINA 3MYDA 4ML1A 5AIXA 5GSSA 3UBKA 3TGZA 2EFEA 4K0GA 3VWXA 1A24A 1Z7PA 3DYRA 2GT6A 3IAM2 1PL1A 3DVWA 1X0RA 2DLXA 3ERFA 2OJLA 3VI7A 1M9AA 2ON7A 2UZ8A 4EC0A 4CHSA 4PX1A 1G6YA 3G7IA 2GZYA 1S3AA 4BVYB 2VD0A 1GSDA 4QQ7A 4YQMA 1GSUA 4TXOB 1Z3EA 1GNWA 2DKIA 4IGJA 4IQ1A 2EIQA 3IHQA 2EFDA 3QPMA 3TRQA 4BPYA 3ZREA 5ELAA 3MAKA 3ED3A 2N5AA 4K1FA 1K0CA 3GA4A 3LWAA 1KNGA 5CAXA 2H1AA 1A8YA 2V41A 2J23A 5F05A 2C0GA 4F9ZA 3A2WA 2XBQA 3UMAA 4F82A 1B4PA 2H0GA 3A3TA 4OWYA 5C00A 2JU5A 2LTKA 3NOFA 1AUCA 2O8VB 4P3YB 3TU3B 1O85A 5KOWA 4MJBA 1I9DA 4ISDA 2WS2A 4USSA 2MMZA 3LORA 2LQQA 6GSXA 4K9ZA 5HFIA 1E2YA 4KCAA 1NHYA 3I43A 3M9KA 3GL5A 1YF0A 4L0WA 1YQ1A 1TXUA 5D9WA 2P5QA 4LA1A 4DSSA 2GT5A 4W66A 2UV8G 4YQVA 1MD4A 4XRDA 4KW6A 3QD9A 2ZNMA 2FWGA 5DQSA 1UN2A 2C80A 4MZWA 3M1GA 2EC4A 5B6NA 4LLRA 2B5YA 1UA5A 2MMNA 1XWGA 2OA7A 1KBNA 3ZVJA 1OE7A 4KF9A 3GH9A 5HR0A 4PUAA 2PPTA 3FZAA 1B8XA 1ZMAA 1XW6A 1ZYNA 1QUWA 4DVCA 5ECOB 1M7TA 3TJFA 4GLTA 2GQMA 2H6YA 1JZRA 2LUSA 3C7MA 2BMXA 1EGOA 1TTZA 2JACA 1ZCPA 4MJCA 3JCML 3N9JA 1WIKA 4OCFA 5E59A 1JLVA 2IWTA 6GSWA 5ECNB 1GTBA 1TRVA 4K7OA 3SBCA 1EV4A 2WDUA 1GLPA 2HSYA 4KE3A 5DCHA 5FT3A 3DRNA 1FOVA 1FO5A 1N2AA 4KDYA 2QGVA 5ENUA 3IAS2 3DGQA 4BWSA 5HR1A 3LW9A 1K0AA 4HUAA 3GUSA 2NDOA 2LSTA 1GSFA 1NSWA 2QA2A 3IPZA 2KHPA 5HFGA 2L6DA 3FR9A 2VL2C 3P90A 4LMWA 4F0BA 5IOWA 3Q18A 2WZ9A 5G1LA 18GSA 3UAPA 5ELGA 1B9XC 3IC4A 2WULA 1TP9A 1NW2A 3BCKA 3IE3A 1ZZYA 1YVLA 1FOHA 3PGTA 5A34A 1URMA 5GSTA 3GH6A 1K0BA 3HY2A 3M3MA 5J9CA 1JHBA 3HD5A 1T00A 4PXOA 1EOHA 3M0FA 4YKGA 1UC7A 1ZYEA 3M8NA 2V2GA 1WRYA 1SVLA 5IO0A 3F6FA 4NAXA 3APSA 1YKCA 2VCZA 4QMKA 3WT1A 2LJAA 5F07A 1M2AA 4ZBAA 2CVDA 1XBSA 1GUKA 2IIYA 2WRTA 1F9MA 1GTUA 2IFQA 4MF5A 3NZNA 1T4YA 1Z5YE 3KP8A 1K3OA 4XS4B 5KOXA 1FVKA 4K5RA 1YEPA 2VIMA 1N25A 2REMA 4TR3A 1SD8A 3ZYWA 2HRNA 2GSQA 3G9BA 5B7CA 4X1UA 1M2DA 1SJIA 4HU7A 1MD3A 2A2SA 3CSIA 1BYEA 1XWKA 4WBJA 3IBHA 4ULXA 1R4WA 4KA0A 3HDCA 3A5IA 2C0DA 4WF4A 4JEDA 2VCTA 3HZ8A 5ECPB 3IV4A 2YWMA 2HLSA 1EP8A 1T1VA 1EOGA 4AKXB 1GLQA 6GSSA 3TJJA 4BWQA 3H8QA 3E0UA 1B48A 3O76A 3GSSA 2PERA 1Y1UA 4MZCA 5KN2A 1GSEA 4PQHA 2JSZA 2B7KA 4ZL9A 5JWOB 3FR3A 2GQLA 3MWHA 3LXTA 2TRXA 1MEKA 3IK9A 3ZTLA 5KN3A 2RLIA 4IKHA 2IMIA 3ZFBA 2IN3A 2N5FA 4PQIA 1K0DA 3F3RA 4FO5A 2A4HA 8GSSA 5CNWA 1U88A 4FYBA 4MMMA 3UIWA 3I9V2 2EIRA 4MJAA 2F8AA 2LQOA 1PGTA 2C0FA 3BD2A 3S9FA 3EU4A 4KSMA 2YPMA 3MDKA 1AW9A 3F4RA 4J2FA 2VCQA 3UEMA 2CVKA 1R26A 1SVMA 3D4TA 4POKA 12GSA 1TDIA 6GSVA 4AJ8A 2EIOA 1XFLA 3UBLA 4XCSA 3KD0A 4N3ZA 3LSZA 2X8CA 1YF1A 5DQYA 4KX4A 2HZEB 2H6ZA 3PR8A 5DAKB 2RM6A 5IPGA 2LS5A 3V1WA 3GTUA 2PU9C 4KB3A 5F06A 2R4VA 2XPEA 2H71A 2A4VA 5ECQB 2QA1A 4XTSA 3TRXA 2HSHA 5D9TA 4AKIA 2OE0A 2VLVA 3VFIA 1E6BA 2HSNB 2FNOA 1TU8A 3D6IA 3FHKA 5IM9A 4G9HA 4EO3A 4Q5RA 1J0FA 4BVXB 3BBYA 2R6KA 4G0KA 5JWRB 2C3NA 2JZSA 2V6KA 2CZ2A 2NPBA 1ZYPA 3EMXA 1GSYA 2FCHA 3HVXA 3QAWA 1OC9A 2DIZA 2GVPA 4KCEA 1F3AA 4IJ3A 2HNLA 1J08A 2QC7A 4O92A 4LMVA 1K0NA 4WKWA 5D8IA 20GSA 2B3SA 2FWEA 1A0FA 1G7EA 5CRWA 3GSTA 5GZZB 4MLYA 2YCDA 5CRGA 1IYHA 6GSTA 3GX8A 1U3IA 4N0VA 5CREA 2FA4A 2H01A 3IRAA 2P0GA 3CSJA 4GSTA 3EURA 5ID2B 2AHEA 1A2JA 3RHCA 2H73A 1DSBA 4L5OA 3GKXA 4Z2RA 4WETA 2GSRA 1A0RP 4BL7A 2JADA 4ZBDA 1TRWA 5H5QA 2OKAA 1QMVA 2VL2A 4K7IA 1WMJA 3F4TA 1ST9A 2L5OA 4EIQA 4EDZA 1PKZA 1U87A 5FHIA 2DJ3A 5HR2A 1K0OA 3KJYA 5CP1A 4ZB8A 1SYRA 1DBYA 1FAAA 1R5AA 2FY6A 2MBSA 3GMFA 1LU4A 2HXKA 1ILOA 1TK8B 2FWHA 2H0IA 1G0TA 1TKDB 3ME7A 4PQ1A 5G30A 2OE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O89 A;  4IEL A;  1FB0 A;  3FZ5 A;  1SJZ A;  3EWL A;  4KSO A;  3Q74 A;  5G1K A;  2M72 A;  2H8L A;  3APO A;  5GAN D;  2H1G A;  2PVQ A;  3CSH A;  1XXU A;  5E4W A;  1SL0 B;  5DJM A;  1XCC A;  4GXZ A;  4YAP A;  1FB6 A;  1ZYQ B;  2ZCT A;  4AF2 A;  3VPQ A;  3CRT A;  5AGY A;  1PKW A;  4HJM A;  1SKR B;  1Q4J A;  3ERG A;  1SL2 B;  1GUL A;  2I1U A;  3M9J A;  2VL3 A;  1XZO A;  2X64 A;  2V32 A;  1EGR A;  2V6O A;  5ECR B;  1BX9 A;  3GL3 A;  2B1L A;  1XWB A;  1V40 A;  1BAY A;  2NVL A;  2B5E A;  4ID0 A;  2YAN A;  4OFN A;  4FQU A;  4MK3 A;  2C4J A;  2E2G A;  1QXH A;  3UAR A;  3H93 A;  4MP4 A;  1GH2 A;  2HRA A;  3OR5 A;  2E0Q A;  1PD2 1;  3D4M A;  3KMN A;  1M99 A;  1C72 A;  1B9Y C;  4TKY A;  4ZL8 A;  1Z6N A;  5JCU A;  1ERV A;  1HNA A;  1PX6 A;  1GTA A;  1HD2 A;  3KEB A;  5BMU A;  4GTU A;  5IMV A;  4OD7 A;  4TW5 A;  3IA1 A;  2V1M A;  3HXS A;  4JZQ A;  2QKE A;  1ERT A;  2ALB A;  6GSU A;  2DMM A;  2GS3 A;  2KP2 A;  3TJB A;  1X9M B;  2L6C A;  1VF2 A;  1U3A A;  1U6T A;  2WCI A;  3F3Q A;  4AGS A;  5AIV A;  4CDO A;  4NV2 A;  1VF4 A;  2VLU A;  10GS A;  3APQ A;  3KIJ A;  2H75 A;  2I3Y A;  2DIY A;  4JR6 A;  4WXT A;  2RUF A;  2VCV A;  4HQS A;  2K8S A;  2JL4 A;  3L9S A;  4DSS B;  4K0N A;  2YZU A;  1AIU A;  1TJD A;  3R2Q A;  4TXV A;  4Q5Q A;  4OFT A;  4NHZ A;  1ZGN A;  2C8U A;  3K8N A;  2JZT A;  2CT6 A;  1WP0 A;  2DJ1 A;  3ZML A;  1YZX A;  4KGI A;  2JSY A;  2OBK A;  5B8A A;  1SK1 A;  3KH7 A;  4GRF A;  1O8X A;  4ECI A;  5JCW A;  3GRX A;  3U5R E;  5AIS A;  2BJX A;  2XC2 A;  1LBK A;  3I69 A;  2GLR A;  1W89 A;  3D5J A;  3QAG A;  3CXG A;  5D73 A;  1K3Y A;  4HI7 A;  4NXI A;  1HYU A;  4HS1 A;  2F51 A;  2B7J A;  5G5F A;  2H30 A;  5INY A;  2F9S A;  2H1B A;  3P7X A;  1BED A;  1YJ6 A;  1OVN A;  4GQC A;  1H75 A;  4H86 A;  5KEJ A;  4ZB6 A;  2ES7 A;  4MA9 A;  1GL8 A;  3UJ1 A;  4MDC A;  4POL A;  4OCE A;  2A2R A;  1G6W A;  4V1A g;  1SEN A;  2DJJ A;  3C8E A;  3WYW A;  4DEJ A;  3KCM A;  1F3B A;  4I2T A;  4GF0 A;  4TRX A;  22GS A;  3ZFL A;  2KUC A;  2F3M A;  1UVZ A;  4WF5 A;  4E8H A;  2WGR A;  3C71 A;  4XS1 A;  4GWR A;  2YWO A;  2LRC A;  4LL1 B;  1N8J A;  4EKZ A;  2QSI A;  1FW1 A;  3FYG A;  1DE2 A;  2HQT A;  3U6V A;  2PWJ A;  4HEA 2;  3D0Z A;  2C1Y A;  3LEF A;  4TOP A;  2L4Q A;  4L8E A;  4RI7 A;  3MNG A;  3FR6 A;  1I5G A;  2H1D A;  2NTO A;  5IMC A;  4KDU A;  3TRP A;  5A4W A;  4K6X A;  1XW5 A;  3KTB A;  2IMF A;  4NV5 A;  1BG5 A;  3GHA A;  1GUM A;  3QR6 A;  3TKP A;  2DML A;  2IFQ B;  3IC8 A;  5COH A;  4JRR A;  5EL8 A;  5F0G A;  4E8E A;  4D73 A;  5DDL A;  3VI5 A;  1SJ6 A;  1AXD A;  1V98 A;  4O7H A;  4NPB A;  1OE8 A;  3C1S A;  3O3T A;  1PRX A;  2JZR A;  5ECH B;  1BQ7 A;  1GSQ A;  4HOJ A;  2X99 A;  3ISO A;  3LFL A;  2K6V A;  1PSQ A;  2AJQ B;  1SK0 A;  4EL1 A;  5CO3 A;  2PVO C;  2FHE A;  2H66 A;  1T3B A;  3GN3 A;  5DJL A;  2E2M A;  3LYP A;  4F0C A;  3CTG A;  1RK4 A;  5CRD A;  3GKN A;  17GS A;  3L0H A;  2RUE A;  5LCZ A;  1XPV A;  1M9B A;  2L57 A;  4HU9 A;  4PUR A;  3UOM A;  1TU7 A;  3PH9 A;  2P5R A;  3ZIT A;  2K9F A;  4XHM A;  1JFU A;  3J7Y b;  1HNB A;  1TOF A;  4Z7X A;  2XPD A;  2GQK A;  4IQA A;  1AC1 A;  2R37 A;  1PN9 A;  1MDI A;  2YN1 A;  3H4K A;  4ECJ A;  4RQR A;  4MH3 A;  4K2D A;  3KGK A;  2VUP A;  3GNJ A;  3VWV A;  1KTE A;  3ZVJ D;  4MF6 A;  3F9U A;  3ERW A;  3LQ7 A;  1RW1 A;  3IXR A;  4ACS A;  1LJR A;  9GSS A;  3H79 A;  2E7P A;  1JZO A;  1THO A;  3Q6O A;  4TR1 A;  5A4V A;  1CQG A;  2L5L A;  1FHE A;  3HJM A;  5ABR A;  4I8B A;  1X5D A;  4WBR D;  4J57 E;  1GSS A;  1EEJ A;  4POB A;  4AJ6 A;  4NMU A;  1DE1 A;  5GAP D;  3VK9 A;  2G2Q A;  3HCZ A;  2HE3 A;  1OAZ A;  2LV3 A;  3AY8 A;  2XHF A;  5AN1 A;  3TJK A;  1QFN A;  3RBT A;  3HHV A;  4XS6 A;  5KN1 A;  4HQZ A;  1JLW A;  2HRK A;  4F03 A;  1XWA A;  1ACV A;  2B6M A;  3ME8 A;  3GTU B;  4MCU A;  2HZF A;  3LGC A;  1F6M C;  3HA9 A;  3G7J A;  2BTO T;  3J7Y k;  3KXO A;  1M2B A;  1WWJ A;  4ECC A;  5KN0 A;  3TKS E;  4RUV A;  3CYN A;  4OO5 A;  3DXB A;  1GRX A;  3KZQ A;  2LJR A;  3VLN A;  2LRT A;  4HJ2 A;  3HVV A;  4EF0 A;  3TKR A;  1R5P A;  2H0H A;  2N5B A;  2YNX A;  3L9U A;  1YDK A;  3R3E A;  2CAI A;  5ECI B;  4RI6 A;  5DAL A;  2YWN A;  4MPG A;  4FYU A;  1M0U A;  3SWL A;  3VPT A;  4IP1 A;  2FUG 2;  5LD0 A;  2LKU A;  3FW2 A;  4MH2 A;  2M46 A;  3PPU A;  3WT2 A;  1V58 A;  2DJ0 A;  2GZP A;  2CZ3 A;  1OC9 B;  3UL3 A;  2LEG A;  3DD3 A;  3RAZ A;  4ZXG A;  4HZ4 A;  5J5N A;  2F8F A;  2HSM A;  2AYT A;  4AJ7 A;  2GDR A;  1TK5 B;  2H76 A;  3DVX A;  4V2L A;  3FK8 A;  5A4U A;  5EVO A;  4OO4 A;  2WFC A;  1WE0 A;  3A5W A;  1GWC A;  1EP7 A;  2IL3 A;  2VLT A;  2RM5 A;  3IR4 A;  4IN0 A;  2CAQ A;  5FWG A;  1TRU A;  1PA3 A;  1PMT A;  2FA8 A;  1OC8 A;  1RQM A;  4MF7 A;  3ZRD A;  3A2X A;  4BL7 B;  2CV4 A;  3RPN A;  1XOA A;  2DJK A;  1NHO A;  1GNE A;  4BVY A;  2MMO A;  5CRH A;  4ECB A;  2C3T A;  3GUR A;  2YJ7 A;  1EZK A;  5G2Z A;  1X5E A;  4TXO A;  2VM2 A;  1O8W A;  2FD3 A;  2I81 A;  2CX4 A;  2KP1 A;  1Q98 A;  2H72 A;  2PBJ A;  5HQP A;  2AAW A;  2LJK A;  4PNF A;  1X9W B;  2NBS A;  5JCG A;  3WGE A;  4EE0 A;  2GSS A;  3LJR A;  1S3D A;  1SU9 A;  2L59 A;  4ZL7 A;  3GFK A;  2K18 A;  4IW9 A;  16GS A;  4IJI A;  1MTC A;  3EVI A;  2WB9 A;  4V1A p;  5IMA A;  13GS A;  1AQX A;  4N30 A;  3W8S A;  4FIW A;  2IJY A;  1AAZ A;  1WJK A;  4I5Q A;  1THX A;  2DSA A;  3HYP A;  14GS A;  4KND A;  1DUG A;  3BCI A;  1A2M A;  3KP9 A;  3W8J A;  2PMT A;  4CW9 A;  3DML A;  4PNG A;  3EC3 A;  1VF1 A;  5ECM B;  3RPP A;  5IMF A;  1OC3 A;  1TXX A;  1YY7 A;  3HZ4 A;  5C04 A;  3RHB A;  1XVW A;  5DCG A;  2H6X A;  2ON5 A;  3US3 A;  1B4Q A;  1HNC A;  2X8H A;  3F8U A;  1Z6M A;  2VL9 A;  1T4Z A;  2VM1 A;  3VWU A;  2H74 A;  3QDN A;  5ECK B;  4PGT A;  1WOU A;  2IMD A;  1SD9 A;  4J56 E;  4GCI A;  1EWX A;  1ERU A;  1O81 A;  4EXJ A;  1SK2 A;  3TOU A;  2HT9 A;  4Q5F A;  5D96 A;  4XRA A;  2IMK A;  4YAV A;  1AQW A;  3CRU A;  3EE2 A;  1O6J A;  2M80 A;  3UVT A;  3TKQ A;  5IMD A;  4O5R A;  4PUF C;  1SL1 B;  1T8E B;  1ZOF A;  3UVH A;  2MYG A;  3IDV A;  1G7O A;  2CX3 A;  3ZIV A;  2XBI A;  4PTS A;  2L4C A;  3MSZ A;  1J9B A;  2VD1 A;  2YWI A;  3E9J B;  2B5X A;  5J4U A;  3L9V A;  4RQX A;  4ZIL A;  4ZBB A;  3L4N A;  3H1N A;  1OKD A;  4WR5 A;  4G19 A;  4JU5 A;  4FYC A;  3HVS A;  2OE1 A;  1TRS A;  2K8V A;  1GUH A;  3P8W A;  4IP6 A;  3GKK A;  2FLS A;  1Y6E A;  1EV9 A;  2H19 A;  4NWY A;  5HR3 A;  3WGX A;  1GP1 A;  2DJ2 A;  4OFM A;  1O73 A;  3VUR A;  3QFB C;  3W6G A;  3A2V A;  3BJ5 A;  4ILF A;  3WGD A;  5G31 A;  2J9H A;  3IOS A;  1A2L A;  4I97 A;  2CVB A;  2FGX A;  1A23 A;  2MZC A;  5IPH A;  1GTI A;  2CA8 A;  4L0U A;  4QL7 A;  3QOU A;  2R3X A;  2C0E A;  2OBI A;  2H70 A;  2GZZ A;  4JBB A;  3QMX A;  4POM A;  2G0F A;  4XS4 A;  1VF3 A;  2X8G A;  3O6T A;  2O7K A;  4KDX A;  2YOI A;  4XIH A;  3E3E A;  3FRC A;  4K8M A;  5JWQ B;  2GTU A;  3GX0 A;  2YZH A;  4EVM A;  3F6D A;  3DIE A;  1F37 A;  1X5C A;  4MZB A;  1W4V A;  5D9V A;  2KLX A;  3QCP A;  1YEX A;  4EUY A;  3GV1 A;  3KTL A;  4JE1 A;  3TKS A;  3GYK A;  5A5K A;  3KM6 A;  2VOC A;  4N0Z A;  4KH7 A;  5G5E A;  4WR4 A;  4YQU A;  2R2J A;  4JR4 A;  4HZ2 A;  3EYT A;  2O85 A;  2YJH A;  3N5O A;  19GS A;  3FY7 A;  1H4O A;  3DKS A;  3G7Y A;  1SYX A;  3Q19 A;  1XOB A;  2RII A;  4FH8 A;  4G10 A;  1Y25 A;  3C73 A;  1YKA A;  3C1R A;  4V2M A;  6GSY A;  1VRS D;  3DEX A;  2PUK C;  1VGL A;  5IMZ A;  1KEB A;  2C3Q A;  1FVJ A;  1ON4 A;  1SKS B;  3P2A A;  1TI1 A;  2HRF A;  2VCX A;  4EDY A;  2PGT A;  4GQF A;  3F63 A;  1TK0 B;  1XW9 A;  5J3R A;  3ZMK A;  4G0L A;  5F8B A;  2MBT A;  5IO2 A;  1EEM A;  1ABA A;  3TJG A;  4HDE A;  5DBQ A;  2CQ9 A;  1F2E A;  4KUN A;  1S3C A;  3GIX A;  4D73 B;  2TIR A;  4TVE A;  2R5G A;  2B1K A;  3PIN A;  5H5R A;  1TW9 A;  2DBC A;  3KH9 A;  4IHU A;  1V9W A;  2AV4 A;  1Z7R A;  5EPF A;  2IME A;  3TCO A;  3EU3 A;  2O87 A;  3ZL5 A;  3FEU A;  2Z9S A;  1XVQ A;  2HZE A;  5DAK A;  3BOA A;  3NIV A;  7GSS A;  5EY6 A;  4X0X A;  3RDW A;  3DWV A;  4GSN A;  1K3L A;  4ZIJ A;  1HQO A;  3FZ9 A;  1OYJ A;  5IQY A;  2HI7 A;  2AB6 A;  2OAC A;  2YV7 A;  1JZW A;  5B8B A;  1IYI A;  5ECL B;  4QL9 A;  3ZIJ A;  1PQN A;  3IK7 A;  4NHW A;  4ZB9 A;  4LL4 B;  4BVX A;  1ML6 A;  1K0M A;  3ZZX A;  4G2E A;  2YP6 A;  5CYY A;  4MAB A;  4MJE A;  1A8L A;  4X43 A;  4ML6 A;  3FZ4 A;  3KMO A;  1CQH A;  2LRN A;  3HJP A;  3HKR A;  4TR4 A;  1T7P B;  1OKT A;  1QK8 A;  3GKM A;  2AUV A;  1MDK A;  2VO4 A;  4TR1 B;  4IBP A;  1ERW A;  5LNK e;  2GGT A;  2I4A A;  4N11 A;  1XIY A;  4L5L A;  2VAF A;  1V2A A;  4G0I A;  4DSR A;  1USB A;  1PX7 A;  4N10 A;  2VCW A;  2OAD A;  3LXZ A;  3CMI A;  4F2I A;  4GSS A;  5D9X A;  4TR0 A;  3LG6 A;  1V57 A;  1Z9H A;  4I2U A;  1NM3 A;  2PN8 A;  5IOX A;  2D2Z A;  5B6M A;  4Q5N A;  2HRK B;  3FKF A;  5ID2 A;  1MDJ A;  3HJO A;  3LYK A;  11GS A;  4O32 A;  4OMV A;  1QQ2 A;  4WEY A;  4TN8 A;  2WJU A;  2I9H A;  5D93 A;  3D22 A;  3TDG A;  3D21 A;  4IVF A;  5DVB A;  2YV9 A;  5H5S A;  4DSQ A;  2TRC P;  5HFK A;  3I6A A;  4K7N A;  2P31 A;  3F4S A;  5J9B A;  1AQV A;  1FG4 A;  1SKW B;  1R7H A;  1PL2 A;  4KAE A;  2HYX A;  2LNS A;  2LNT A;  5DAL B;  5L71 A;  3TB2 A;  1XWC A;  3WD6 A;  1ZL9 A;  3TOT A;  1WPI A;  2IPA A;  5ECS A;  3TKS C;  3CTF A;  3CBU A;  4I6X A;  2DC5 A;  4V2N A;  3VWW A;  3EMP A;  2ZUP A;  2HFD A;  2FWF A;  2GST A;  1BJX A;  1X9S B;  1O7U A;  3QFA C;  2HSM B;  4IS0 A;  3F0I A;  1JZD A;  5J41 A;  4YH2 A;  1TI3 A;  3ZLP A;  4BA7 A;  3L78 A;  2MMA A;  2KOK A;  5IIZ A;  3QAV A;  3TUE A;  4MPF A;  1QGV A;  3EIN A;  4ML1 A;  5AIX A;  5GSS A;  3UBK A;  3TGZ A;  4K0G A;  3VWX A;  1A24 A;  1Z7P A;  3DYR A;  2GT6 A;  3IAM 2;  1PL1 A;  3DVW A;  1X0R A;  2DLX A;  3ERF A;  2OJL A;  3VI7 A;  1M9A A;  2ON7 A;  2UZ8 A;  4EC0 A;  4CHS A;  4PX1 A;  1G6Y A;  3G7I A;  2GZY A;  1S3A A;  4BVY B;  2VD0 A;  1GSD A;  4QQ7 A;  4YQM A;  1GSU A;  4TXO B;  1Z3E A;  1GNW A;  4IGJ A;  4IQ1 A;  2EIQ A;  3IHQ A;  3QPM A;  3TRQ A;  4BPY A;  3ZRE A;  5ELA A;  3MAK A;  3ED3 A;  2N5A A;  4K1F A;  1K0C A;  3GA4 A;  3LWA A;  1KNG A;  5CAX A;  2H1A A;  1A8Y A;  2V41 A;  2J23 A;  5F05 A;  2C0G A;  4F9Z A;  3A2W A;  2XBQ A;  3UMA A;  4F82 A;  1B4P A;  2H0G A;  3A3T A;  4OWY A;  5C00 A;  2JU5 A;  2LTK A;  3NOF A;  1AUC A;  2O8V B;  4P3Y B;  1O85 A;  4MJB A;  1I9D A;  4ISD A;  2WS2 A;  4USS A;  2MMZ A;  3LOR A;  2LQQ A;  6GSX A;  4K9Z A;  5HFI A;  1E2Y A;  4KCA A;  1NHY A;  3I43 A;  3M9K A;  3GL5 A;  1YF0 A;  4L0W A;  1YQ1 A;  5D9W A;  2P5Q A;  4LA1 A;  4DSS A;  2GT5 A;  4YQV A;  1MD4 A;  4XRD A;  4KW6 A;  3QD9 A;  2ZNM A;  2FWG A;  5DQS A;  1UN2 A;  2C80 A;  4MZW A;  3M1G A;  2EC4 A;  5B6N A;  4LLR A;  2B5Y A;  1UA5 A;  2MMN A;  1XWG A;  2OA7 A;  1KBN A;  3ZVJ A;  1OE7 A;  4KF9 A;  3GH9 A;  5HR0 A;  4PUA A;  2PPT A;  3FZA A;  1B8X A;  1ZMA A;  1XW6 A;  1QUW A;  4DVC A;  5ECO B;  1M7T A;  3TJF A;  4GLT A;  2GQM A;  2H6Y A;  1JZR A;  2LUS A;  3C7M A;  2BMX A;  1EGO A;  1TTZ A;  2JAC A;  1ZCP A;  4MJC A;  3JCM L;  3N9J A;  1WIK A;  4OCF A;  5E59 A;  1JLV A;  2IWT A;  6GSW A;  5ECN B;  1GTB A;  1TRV A;  4K7O A;  3SBC A;  1EV4 A;  2WDU A;  1GLP A;  2HSY A;  4KE3 A;  5DCH A;  5FT3 A;  3DRN A;  1FOV A;  1FO5 A;  1N2A A;  4KDY A;  2QGV A;  5ENU A;  3IAS 2;  3DGQ A;  4BWS A;  5HR1 A;  1K0A A;  4HUA A;  3GUS A;  2NDO A;  2LST A;  1GSF A;  1NSW A;  3IPZ A;  2KHP A;  5HFG A;  2L6D A;  3FR9 A;  2VL2 C;  3P90 A;  4LMW A;  4F0B A;  5IOW A;  3Q18 A;  2WZ9 A;  5G1L A;  18GS A;  3UAP A;  5ELG A;  1B9X C;  3IC4 A;  2WUL A;  1TP9 A;  1NW2 A;  3BCK A;  3IE3 A;  1ZZY A;  3PGT A;  1URM A;  5GST A;  3GH6 A;  1K0B A;  3HY2 A;  3M3M A;  5J9C A;  1JHB A;  3HD5 A;  1T00 A;  4PXO A;  1EOH A;  3M0F A;  1UC7 A;  1ZYE A;  3M8N A;  2V2G A;  1WRY A;  5IO0 A;  3F6F A;  4NAX A;  3APS A;  1YKC A;  2VCZ A;  3WT1 A;  2LJA A;  5F07 A;  1M2A A;  4ZBA A;  2CVD A;  1XBS A;  1GUK A;  2IIY A;  2WRT A;  1F9M A;  1GTU A;  2IFQ A;  4MF5 A;  3NZN A;  1T4Y A;  1Z5Y E;  3KP8 A;  1K3O A;  4XS4 B;  1FVK A;  1YEP A;  2VIM A;  2REM A;  4TR3 A;  1SD8 A;  3ZYW A;  2HRN A;  2GSQ A;  3G9B A;  5B7C A;  4X1U A;  1M2D A;  1SJI A;  4HU7 A;  1MD3 A;  2A2S A;  3CSI A;  1BYE A;  1XWK A;  4WBJ A;  3IBH A;  4ULX A;  1R4W A;  4KA0 A;  3HDC A;  2C0D A;  4WF4 A;  4JED A;  2VCT A;  3HZ8 A;  5ECP B;  3IV4 A;  2YWM A;  2HLS A;  1EP8 A;  1T1V A;  1EOG A;  1GLQ A;  6GSS A;  3TJJ A;  4BWQ A;  3H8Q A;  3E0U A;  1B48 A;  3O76 A;  3GSS A;  2PER A;  4MZC A;  5KN2 A;  1GSE A;  4PQH A;  2JSZ A;  2B7K A;  4ZL9 A;  5JWO B;  3FR3 A;  2GQL A;  3MWH A;  3LXT A;  2TRX A;  1MEK A;  3IK9 A;  3ZTL A;  5KN3 A;  2RLI A;  4IKH A;  2IMI A;  3ZFB A;  2IN3 A;  2N5F A;  4PQI A;  1K0D A;  3F3R A;  4FO5 A;  8GSS A;  5CNW A;  1U88 A;  4FYB A;  4MMM A;  3UIW A;  3I9V 2;  2EIR A;  4MJA A;  2F8A A;  2LQO A;  1PGT A;  2C0F A;  3BD2 A;  3S9F A;  3EU4 A;  4KSM A;  2YPM A;  3MDK A;  1AW9 A;  3F4R A;  4J2F A;  2VCQ A;  3UEM A;  2CVK A;  1R26 A;  3D4T A;  4POK A;  12GS A;  1TDI A;  6GSV A;  4AJ8 A;  2EIO A;  1XFL A;  3UBL A;  4XCS A;  3KD0 A;  3LSZ A;  2X8C A;  1YF1 A;  5DQY A;  4KX4 A;  2HZE B;  2H6Z A;  3PR8 A;  5DAK B;  2RM6 A;  5IPG A;  2LS5 A;  3V1W A;  3GTU A;  2PU9 C;  4KB3 A;  5F06 A;  2R4V A;  2XPE A;  2H71 A;  2A4V A;  5ECQ B;  4XTS A;  3TRX A;  2HSH A;  5D9T A;  2OE0 A;  2VLV A;  3VFI A;  1E6B A;  2HSN B;  2FNO A;  1TU8 A;  3D6I A;  3FHK A;  5IM9 A;  4G9H A;  4EO3 A;  4Q5R A;  1J0F A;  4BVX B;  3BBY A;  2R6K A;  4G0K A;  5JWR B;  2C3N A;  2JZS A;  2V6K A;  2CZ2 A;  2NPB A;  3EMX A;  1GSY A;  2FCH A;  3QAW A;  3HVX A;  1OC9 A;  2DIZ A;  2GVP A;  4KCE A;  4IJ3 A;  1F3A A;  2HNL A;  1J08 A;  2QC7 A;  4O92 A;  4LMV A;  1K0N A;  4WKW A;  5D8I A;  20GS A;  2B3S A;  2FWE A;  1A0F A;  1G7E A;  5CRW A;  3GST A;  5GZZ B;  4MLY A;  2YCD A;  5CRG A;  1IYH A;  6GST A;  3GX8 A;  1U3I A;  4N0V A;  5CRE A;  2FA4 A;  2H01 A;  3IRA A;  2P0G A;  3CSJ A;  4GST A;  3EUR A;  5ID2 B;  2AHE A;  1A2J A;  3RHC A;  2H73 A;  1DSB A;  4L5O A;  3GKX A;  4WET A;  2GSR A;  1A0R P;  4BL7 A;  2JAD A;  4ZBD A;  1TRW A;  5H5Q A;  2OKA A;  1QMV A;  2VL2 A;  4K7I A;  1WMJ A;  3F4T A;  1ST9 A;  2L5O A;  4EDZ A;  1PKZ A;  1U87 A;  5FHI A;  2DJ3 A;  5HR2 A;  1K0O A;  3KJY A;  5CP1 A;  4ZB8 A;  1SYR A;  1DBY A;  1FAA A;  1R5A A;  2FY6 A;  2MBS A;  3GMF A;  1LU4 A;  2HXK A;  1ILO A;  1TK8 B;  2FWH A;  2H0I A;  1G0T A;  1TKD B;  3ME7 A;  4PQ1 A;  5G30 A;  2OE3 A; 
#chains in the Genus database with same CATH topology
 2O89 A;  4IEL A;  1FB0 A;  3FZ5 A;  1SJZ A;  3EWL A;  4KSO A;  3Q74 A;  5G1K A;  2M72 A;  2H8L A;  3APO A;  5GAN D;  2H1G A;  2PVQ A;  3CSH A;  1XXU A;  5E4W A;  1SL0 B;  5DJM A;  2OT3 A;  1XCC A;  4GXZ A;  4YAP A;  4G01 A;  1FB6 A;  1ZYQ B;  2ZCT A;  4AF2 A;  3VPQ A;  3CRT A;  5AGY A;  1PKW A;  4HJM A;  1SKR B;  1Q4J A;  3ERG A;  1SL2 B;  1GUL A;  2I1U A;  3M9J A;  2VL3 A;  1XZO A;  2X64 A;  2V32 A;  1EGR A;  2V6O A;  5ECR B;  1BX9 A;  3GL3 A;  2B1L A;  1XWB A;  1V40 A;  1BAY A;  2NVL A;  2B5E A;  4ID0 A;  2YAN A;  2EFC A;  4FQU A;  4OFN A;  4MK3 A;  2C4J A;  2E2G A;  1QXH A;  1S3R A;  3UAR A;  3H93 A;  4MP4 A;  1GH2 A;  2HRA A;  4CY8 A;  3OR5 A;  2E0Q A;  5A5H A;  1PD2 1;  3D4M A;  3KMN A;  1M99 A;  1C72 A;  1B9Y C;  4TKY A;  4ZL8 A;  1Z6N A;  3FMW A;  5JCU A;  1ERV A;  1HNA A;  1PX6 A;  1GTA A;  1HD2 A;  3KEB A;  5BMU A;  4GTU A;  5IMV A;  4OD7 A;  4TW5 A;  3IA1 A;  2V1M A;  3HXS A;  4JZQ A;  2QKE A;  1ERT A;  2ALB A;  6GSU A;  2DMM A;  2GS3 A;  2KP2 A;  3TJB A;  1X9M B;  2L6C A;  5A5H B;  1VF2 A;  1U3A A;  1U6T A;  2WCI A;  3F3Q A;  4AGS A;  5AIV A;  4CDO A;  4NV2 A;  1VF4 A;  2VLU A;  10GS A;  3APQ A;  3KIJ A;  2H75 A;  2I3Y A;  2DIY A;  4JR6 A;  4WXT A;  2RUF A;  2VCV A;  4HQS A;  2K8S A;  2JL4 A;  3L9S A;  4DSS B;  4K0N A;  2YZU A;  1AIU A;  1TJD A;  3R2Q A;  4TXV A;  4Q5Q A;  4OFT A;  4NHZ A;  1ZGN A;  2C8U A;  3K8N A;  2JZT A;  2CT6 A;  1WP0 A;  2DJ1 A;  3ZML A;  1YZX A;  4KGI A;  2JSY A;  2OBK A;  5B8A A;  2VKZ G;  1SK1 A;  3KH7 A;  4GRF A;  1O8X A;  4ECI A;  5JCW A;  3GRX A;  3U5R E;  5AIS A;  2BJX A;  2XC2 A;  1LBK A;  3I69 A;  2GLR A;  1W89 A;  3D5J A;  3QAG A;  3CXG A;  5D73 A;  1K3Y A;  4HI7 A;  4NXI A;  1HYU A;  4HS1 A;  2F51 A;  2B7J A;  5G5F A;  2WVX A;  2H30 A;  5INY A;  2F9S A;  2H1B A;  3P7X A;  1BED A;  1YJ6 A;  1OVN A;  4GQC A;  1H75 A;  1M3J A;  3IHG A;  4H86 A;  5KEJ A;  4ZB6 A;  4AKH A;  2ES7 A;  4MA9 A;  1GL8 A;  4PI0 C;  3UJ1 A;  2WW1 A;  4MDC A;  4POL A;  4OCE A;  2A2R A;  3CWG A;  1G6W A;  4V1A g;  1SEN A;  2DJJ A;  3C8E A;  3WYW A;  4DEJ A;  3KCM A;  1F3B A;  4I2T A;  4GF0 A;  4TRX A;  2DKH A;  22GS A;  3ZFL A;  2KUC A;  2F3M A;  1UVZ A;  4WF5 A;  4E8H A;  2WGR A;  3C71 A;  4XS1 A;  4GWR A;  2YWO A;  2LRC A;  5A34 B;  4LL1 B;  1N8J A;  4EKZ A;  2QSI A;  1FW1 A;  3FYG A;  1DE2 A;  2HQT A;  3U6V A;  2PWJ A;  4HEA 2;  3D0Z A;  2C1Y A;  3LEF A;  4TOP A;  2L4Q A;  4L8E A;  4RI7 A;  3MNG A;  3FR6 A;  1I5G A;  2H1D A;  2NTO A;  5IMC A;  4KDU A;  3TRP A;  5A4W A;  4K6X A;  1XW5 A;  3KTB A;  2IMF A;  4NV5 A;  1BG5 A;  3GHA A;  1GUM A;  3QR6 A;  3TKP A;  1SVO A;  2DML A;  2IFQ B;  3IC8 A;  5COH A;  3EPT A;  4JRR A;  5EL8 A;  5F0G A;  4E8E A;  4AI6 A;  4D73 A;  5DDL A;  3VI5 A;  1SJ6 A;  1AXD A;  1V98 A;  4O7H A;  4NPB A;  1OE8 A;  3C1S A;  3O3T A;  1PRX A;  2JZR A;  5ECH B;  1BQ7 A;  1GSQ A;  4K5S A;  4HOJ A;  2X99 A;  3ISO A;  3LFL A;  2K6V A;  1PSQ A;  2AJQ B;  1SK0 A;  4EL1 A;  5CO3 A;  2PVO C;  2FHE A;  2H66 A;  1T3B A;  3GN3 A;  5DJL A;  2E2M A;  3LYP A;  4F0C A;  3CTG A;  1RK4 A;  5CRD A;  3GKN A;  17GS A;  3L0H A;  2RUE A;  5LCZ A;  1XPV A;  1M9B A;  2L57 A;  4HU9 A;  4PUR A;  3UOM A;  4AKG A;  1TU7 A;  3PH9 A;  2P5R A;  3ZIT A;  2K9F A;  4XHM A;  1JFU A;  3J7Y b;  1HNB A;  1TOF A;  4Z7X A;  2XPD A;  2GQK A;  4IQA A;  1AC1 A;  2R37 A;  1PN9 A;  1MDI A;  2YN1 A;  3H4K A;  4ECJ A;  4RQR A;  4MH3 A;  4K2D A;  3KGK A;  2VUP A;  3GNJ A;  3VWV A;  1KTE A;  3ZVJ D;  4MF6 A;  3F9U A;  3ERW A;  3LQ7 A;  1RW1 A;  3IXR A;  4ACS A;  1LJR A;  9GSS A;  3H79 A;  2O5V A;  2E7P A;  1JZO A;  1THO A;  3Q6O A;  4TR1 A;  5A4V A;  1CQG A;  2L5L A;  1FHE A;  3HJM A;  5ABR A;  4I8B A;  1X5D A;  4WBR D;  4J57 E;  1GSS A;  1EEJ A;  4POB A;  4AJ6 A;  4NMU A;  1DE1 A;  5BRT A;  5GAP D;  3VK9 A;  2G2Q A;  3HCZ A;  2HE3 A;  1OAZ A;  2LV3 A;  3AY8 A;  2XHF A;  2WZS A;  5AN1 A;  3TJK A;  1QFN A;  3RBT A;  3HHV A;  4XS6 A;  5KN1 A;  4HQZ A;  1JLW A;  2HRK A;  4F03 A;  1XWA A;  1ACV A;  2B6M A;  3ME8 A;  3GTU B;  3HMJ G;  4MCU A;  2HZF A;  3LGC A;  1F6M C;  3HA9 A;  3G7J A;  2BTO T;  4O5U A;  3J7Y k;  3KXO A;  5A1N A;  1M2B A;  1WWJ A;  1PFO A;  4ECC A;  5KN0 A;  3TKS E;  4RUV A;  4Z2T A;  3CYN A;  4OO5 A;  3DXB A;  1GRX A;  3KZQ A;  2LJR A;  3VLN A;  2LRT A;  4HJ2 A;  3HVV A;  4EF0 A;  3TKR A;  1R5P A;  2H0H A;  2N5B A;  2YNX A;  3L9U A;  1YDK A;  3R3E A;  2CAI A;  5ECI B;  4RI6 A;  5DAL A;  2YWN A;  4MPG A;  4FYU A;  1M0U A;  3SWL A;  3VPT A;  4Z2U A;  4IP1 A;  2FUG 2;  5LD0 A;  2LKU A;  3FW2 A;  4MH2 A;  2M46 A;  3PPU A;  3WT2 A;  4K2X A;  1V58 A;  2DJ0 A;  2GZP A;  2CZ3 A;  1OC9 B;  3UL3 A;  2LEG A;  3DD3 A;  3RAZ A;  4ZXG A;  4HZ4 A;  5J5N A;  2F8F A;  2HSM A;  2AYT A;  4AJ7 A;  2GDR A;  1TK5 B;  2H76 A;  3DVX A;  4V2L A;  3FK8 A;  5A4U A;  5EVO A;  4OO4 A;  2WFC A;  1WE0 A;  3A5W A;  1GWC A;  1EP7 A;  2IL3 A;  2VLT A;  2RM5 A;  3IR4 A;  1PN0 A;  4IN0 A;  2CAQ A;  5FWG A;  1TRU A;  1PA3 A;  1PMT A;  2FA8 A;  1OC8 A;  1RQM A;  4MF7 A;  3ZRD A;  3A2X A;  4BL7 B;  2CV4 A;  3RPN A;  1XOA A;  5J40 A;  2DJK A;  1NHO A;  1GNE A;  4ZB7 A;  4BVY A;  2MMO A;  5CRH A;  4ECB A;  2C3T A;  3GUR A;  2YJ7 A;  1EZK A;  5G2Z A;  1X5E A;  4TXO A;  2VM2 A;  1O8W A;  2FD3 A;  2I81 A;  2H1L A;  2CX4 A;  2KP1 A;  1Q98 A;  2H72 A;  2PBJ A;  5HQP A;  2AAW A;  2LJK A;  4PNF A;  1X9W B;  2NBS A;  5JCG A;  3WGE A;  4EE0 A;  2GSS A;  3LJR A;  1S3D A;  1SU9 A;  2L59 A;  4ZL7 A;  3GFK A;  2K18 A;  4IW9 A;  16GS A;  4IJI A;  1MTC A;  4CY6 A;  3EVI A;  2WB9 A;  4V1A p;  5IMA A;  13GS A;  1AQX A;  4N30 A;  3W8S A;  4FIW A;  2IJY A;  1AAZ A;  1WJK A;  4I5Q A;  1THX A;  2DSA A;  3HYP A;  14GS A;  4KND A;  1DUG A;  3BCI A;  1A2M A;  3KP9 A;  3W8J A;  2PMT A;  4CW9 A;  3DML A;  4PNG A;  3EC3 A;  1VF1 A;  5ECM B;  3RPP A;  5IMF A;  1OC3 A;  1TXX A;  1YY7 A;  3HZ4 A;  5C04 A;  3RHB A;  1XVW A;  4EIP A;  5DCG A;  2H6X A;  2R0P A;  2ON5 A;  3US3 A;  1B4Q A;  4MNN A;  1HNC A;  2X8H A;  3F8U A;  1Z6M A;  4PHZ C;  2VL9 A;  1T4Z A;  2VM1 A;  3VWU A;  2H74 A;  3QDN A;  5ECK B;  4PGT A;  1WOU A;  2IMD A;  2R0G A;  1SD9 A;  4J56 E;  4GCI A;  1EWX A;  1ERU A;  1O81 A;  4EXJ A;  1SK2 A;  3TOU A;  2HT9 A;  4Q5F A;  5D96 A;  4XRA A;  2IMK A;  3RFR C;  4YAV A;  1AQW A;  3CRU A;  3EE2 A;  5BMU B;  1O6J A;  2M80 A;  3HVN A;  3UVT A;  3TKQ A;  5IMD A;  4O5R A;  1M3I A;  4PUF C;  1SL1 B;  2O36 A;  1T8E B;  1ZOF A;  3UVH A;  2MYG A;  3IDV A;  1G7O A;  2CX3 A;  3ZIV A;  2XBI A;  4PTS A;  2L4C A;  3MSZ A;  1J9B A;  2VD1 A;  2YWI A;  3E9J B;  5J47 A;  2B5X A;  5J4U A;  3L9V A;  4RQX A;  4ZIL A;  4ZBB A;  3L4N A;  2R0C A;  3H1N A;  1OKD A;  4WR5 A;  4G19 A;  4FYC A;  4JU5 A;  3HVS A;  2OE1 A;  1TRS A;  2K8V A;  1GUH A;  3P8W A;  4IP6 A;  1BG1 A;  3GKK A;  2FLS A;  1Y6E A;  1EV9 A;  2WW3 A;  2H19 A;  4NWY A;  5HR3 A;  4YKF A;  3WGX A;  1GP1 A;  2DJ2 A;  4GDF A;  4OFM A;  1O73 A;  3VUR A;  3QFB C;  3W6G A;  3A2V A;  3BJ5 A;  4ILF A;  3WGD A;  5G31 A;  2J9H A;  3IOS A;  1A2L A;  4I97 A;  2CVB A;  2FGX A;  1A23 A;  2WVZ A;  2MZC A;  5IPH A;  1GTI A;  2CA8 A;  4L0U A;  4QL7 A;  3QOU A;  2R3X A;  2C0E A;  2OBI A;  2H70 A;  2GZZ A;  4JBB A;  3QMX A;  4POM A;  2WVX B;  2G0F A;  4XS4 A;  1VF3 A;  2X8G A;  3O6T A;  2O7K A;  4KDX A;  2YOI A;  4XIH A;  3E3E A;  3FRC A;  4K8M A;  5JWQ B;  2GTU A;  3GX0 A;  2YZH A;  4EVM A;  3F6D A;  3DIE A;  1F37 A;  1X5C A;  4MZB A;  1W4V A;  5D9V A;  2KLX A;  3QCP A;  1YEX A;  4EUY A;  3GV1 A;  5J4Y A;  3KTL A;  4JE1 A;  3TKS A;  3GYK A;  5A5K A;  3KM6 A;  2VOC A;  4N0Z A;  2X49 A;  4KH7 A;  5G5E A;  4WR4 A;  4YQU A;  2R2J A;  4JR4 A;  4HZ2 A;  3EYT A;  2O85 A;  2YJH A;  3N5O A;  19GS A;  3FY7 A;  1H4O A;  3DKS A;  3G7Y A;  1SYX A;  3Q19 A;  1XOB A;  2RII A;  4FH8 A;  4G10 A;  1Y25 A;  2EFH A;  3C73 A;  1YKA A;  3C1R A;  4V2M A;  6GSY A;  1VRS D;  3DEX A;  2PUK C;  1VGL A;  5IMZ A;  1KEB A;  2C3Q A;  1FVJ A;  1ON4 A;  1SKS B;  3P2A A;  1TI1 A;  2HRF A;  4O5Q A;  2VCX A;  4EDY A;  2PGT A;  4GQF A;  3F63 A;  1TK0 B;  1XW9 A;  5J3R A;  3ZMK A;  2A2P A;  4G0L A;  5F8B A;  2MBT A;  5IO2 A;  1EEM A;  1ABA A;  3TJG A;  4HDE A;  5DBQ A;  2CQ9 A;  1F2E A;  4KUN A;  3MIX A;  1S3C A;  3GIX A;  4D73 B;  2TIR A;  4TVE A;  2R5G A;  2B1K A;  3PIN A;  5H5R A;  1TW9 A;  4X4J A;  2DBC A;  3KH9 A;  4IHU A;  1V9W A;  2AV4 A;  1Z7R A;  5EPF A;  2IME A;  3TCO A;  3EU3 A;  2O87 A;  3ZL5 A;  3FEU A;  2Z9S A;  1XVQ A;  4E68 A;  2HZE A;  5DAK A;  3BOA A;  3NIV A;  7GSS A;  5EY6 A;  4X0X A;  3RDW A;  3DWV A;  4GSN A;  1K3L A;  4ZIJ A;  1HQO A;  3FZ9 A;  1OYJ A;  5IQY A;  2HI7 A;  2AB6 A;  2OAC A;  2YV7 A;  1JZW A;  5B8B A;  1IYI A;  2HSN A;  5ECL B;  4QL9 A;  3ZIJ A;  1PQN A;  4A5P A;  3IK7 A;  4NHW A;  4ZB9 A;  4LL4 B;  4BVX A;  1ML6 A;  1K0M A;  3ZZX A;  4G2E A;  2YP6 A;  5CYY A;  4MAB A;  4MJE A;  1A8L A;  4X43 A;  4ML6 A;  3FZ4 A;  3KMO A;  1CQH A;  2LRN A;  3HJP A;  3HKR A;  4TR4 A;  1T7P B;  1OKT A;  1QK8 A;  3GKM A;  2AUV A;  1MDK A;  2VO4 A;  4TR1 B;  4IBP A;  1ERW A;  5LNK e;  2GGT A;  2I4A A;  4N11 A;  1BF5 A;  1XIY A;  4L5L A;  2VAF A;  1V2A A;  4G0I A;  4DSR A;  1USB A;  2X4A A;  1PX7 A;  4N10 A;  2VCW A;  2OAD A;  3LXZ A;  3CMI A;  4F2I A;  4GSS A;  5D9X A;  4TR0 A;  3LG6 A;  1V57 A;  1Z9H A;  1NM3 A;  2PN8 A;  4I2U A;  5IOX A;  2D2Z A;  5B6M A;  4Q5N A;  2HRK B;  3FKF A;  5ID2 A;  1MDJ A;  3HJO A;  3LYK A;  11GS A;  4O32 A;  3CHX C;  4OMV A;  1QQ2 A;  4WEY A;  4TN8 A;  2WJU A;  2I9H A;  5D93 A;  3D22 A;  3TDG A;  5A1N B;  3D21 A;  4IVF A;  5DVB A;  2YV9 A;  5H5S A;  4DSQ A;  2TRC P;  5HFK A;  3I6A A;  4K7N A;  2P31 A;  3F4S A;  5J9B A;  1AQV A;  5J4V A;  1FG4 A;  1SKW B;  1R7H A;  1PL2 A;  4KAE A;  2HYX A;  4BIK A;  2LNS A;  2LNT A;  5DAL B;  5L71 A;  3TB2 A;  1XWC A;  3WD6 A;  1ZL9 A;  3TOT A;  1WPI A;  2IPA A;  5ECS A;  3TKS C;  3CTF A;  3CBU A;  4I6X A;  2DC5 A;  4V2N A;  3VWW A;  3EMP A;  2ZUP A;  2HFD A;  2FWF A;  2GST A;  1BJX A;  1X9S B;  1O7U A;  3QFA C;  2HSM B;  4IS0 A;  3F0I A;  1JZD A;  5J41 A;  4YH2 A;  1TI3 A;  3ZLP A;  4BA7 A;  3L78 A;  2MMA A;  2KOK A;  5IIZ A;  3QAV A;  3TUE A;  4ICY A;  4MPF A;  1QGV A;  3EIN A;  3MYD A;  4ML1 A;  5AIX A;  5GSS A;  3UBK A;  3TGZ A;  2EFE A;  4K0G A;  3VWX A;  1A24 A;  1Z7P A;  3DYR A;  2GT6 A;  3IAM 2;  1PL1 A;  3DVW A;  1X0R A;  2DLX A;  3ERF A;  2OJL A;  3VI7 A;  1M9A A;  2ON7 A;  2UZ8 A;  4EC0 A;  4CHS A;  4PX1 A;  1G6Y A;  3G7I A;  2GZY A;  1S3A A;  4BVY B;  2VD0 A;  1GSD A;  4QQ7 A;  4YQM A;  1GSU A;  4TXO B;  1Z3E A;  1GNW A;  2DKI A;  4IGJ A;  4IQ1 A;  2EIQ A;  3IHQ A;  2EFD A;  3QPM A;  3TRQ A;  4BPY A;  3ZRE A;  5ELA A;  3MAK A;  3ED3 A;  2N5A A;  4K1F A;  1K0C A;  3GA4 A;  3LWA A;  1KNG A;  5CAX A;  2H1A A;  1A8Y A;  2V41 A;  2J23 A;  5F05 A;  2C0G A;  4HSC X;  4F9Z A;  3A2W A;  2XBQ A;  3UMA A;  4F82 A;  1B4P A;  2H0G A;  3A3T A;  4OWY A;  5C00 A;  2JU5 A;  4PI2 C;  2LTK A;  3NOF A;  1AUC A;  2O8V B;  4P3Y B;  3TU3 B;  1O85 A;  5KOW A;  4MJB A;  2O3E A;  1I9D A;  4ISD A;  2WS2 A;  4USS A;  2MMZ A;  2LQQ A;  3LOR A;  6GSX A;  4K9Z A;  5HFI A;  1E2Y A;  4KCA A;  1NHY A;  3I43 A;  3M9K A;  3GL5 A;  1YF0 A;  4L0W A;  1YQ1 A;  1TXU A;  5D9W A;  2P5Q A;  4LA1 A;  4DSS A;  2GT5 A;  4W66 A;  2UV8 G;  4YQV A;  1MD4 A;  4XRD A;  4KW6 A;  3QD9 A;  2ZNM A;  2FWG A;  5DQS A;  1UN2 A;  2C80 A;  4MZW A;  3M1G A;  2EC4 A;  5B6N A;  4LLR A;  2B5Y A;  1UA5 A;  2MMN A;  1XWG A;  2OA7 A;  1KBN A;  3ZVJ A;  1OE7 A;  4KF9 A;  3GH9 A;  5HR0 A;  4PUA A;  2PPT A;  3FZA A;  1B8X A;  1ZMA A;  1XW6 A;  1ZYN A;  1QUW A;  4DVC A;  5ECO B;  1M7T A;  3TJF A;  4GLT A;  2GQM A;  2H6Y A;  1JZR A;  2LUS A;  3C7M A;  2BMX A;  1EGO A;  1TTZ A;  2JAC A;  1ZCP A;  4MJC A;  3JCM L;  3N9J A;  1WIK A;  4OCF A;  5E59 A;  1JLV A;  2IWT A;  6GSW A;  5ECN B;  1GTB A;  1TRV A;  4K7O A;  3SBC A;  1EV4 A;  2WDU A;  1GLP A;  2HSY A;  4KE3 A;  5DCH A;  5FT3 A;  3DRN A;  1FOV A;  1FO5 A;  1N2A A;  4KDY A;  2QGV A;  5ENU A;  3IAS 2;  3DGQ A;  4BWS A;  5HR1 A;  3LW9 A;  1K0A A;  4HUA A;  3GUS A;  2NDO A;  2LST A;  1GSF A;  1NSW A;  2QA2 A;  3IPZ A;  2KHP A;  5HFG A;  2L6D A;  3FR9 A;  2VL2 C;  3P90 A;  4LMW A;  4F0B A;  5IOW A;  3Q18 A;  2WZ9 A;  5G1L A;  18GS A;  3RGB C;  3UAP A;  5ELG A;  1B9X C;  3IC4 A;  2WUL A;  1TP9 A;  1NW2 A;  3BCK A;  3IE3 A;  1ZZY A;  1YVL A;  1FOH A;  3PGT A;  4FXY P;  5A34 A;  1URM A;  5GST A;  3GH6 A;  1K0B A;  3HY2 A;  3M3M A;  5J9C A;  1JHB A;  3HD5 A;  1T00 A;  4PXO A;  1EOH A;  3M0F A;  4YKG A;  1UC7 A;  1ZYE A;  3M8N A;  2V2G A;  1WRY A;  1SVL A;  5IO0 A;  3F6F A;  4NAX A;  3APS A;  1YKC A;  2VCZ A;  4QMK A;  3WT1 A;  2LJA A;  5F07 A;  1M2A A;  4ZBA A;  2CVD A;  1XBS A;  1GUK A;  2IIY A;  2WRT A;  1F9M A;  1GTU A;  2IFQ A;  4MF5 A;  3NZN A;  1T4Y A;  1Z5Y E;  3KP8 A;  1K3O A;  4XS4 B;  5KOX A;  1FVK A;  4K5R A;  1YEP A;  2VIM A;  1N25 A;  2REM A;  4TR3 A;  1SD8 A;  3ZYW A;  2HRN A;  2GSQ A;  3G9B A;  5B7C A;  4X1U A;  1M2D A;  1SJI A;  4HU7 A;  1MD3 A;  2A2S A;  3CSI A;  1BYE A;  1XWK A;  4WBJ A;  3IBH A;  4ULX A;  1R4W A;  4KA0 A;  3HDC A;  3A5I A;  2C0D A;  4WF4 A;  4JED A;  2VCT A;  3HZ8 A;  2WVY A;  5ECP B;  3IV4 A;  2YWM A;  2HLS A;  2WW2 A;  1EP8 A;  1T1V A;  1EOG A;  4AKX B;  1GLQ A;  6GSS A;  3TJJ A;  1XG8 A;  4BWQ A;  3H8Q A;  3E0U A;  1B48 A;  3O76 A;  3GSS A;  2PER A;  1Y1U A;  4MZC A;  5KN2 A;  1GSE A;  4PQH A;  2JSZ A;  2B7K A;  4ZL9 A;  5JWO B;  3FR3 A;  2GQL A;  3MWH A;  1S4B P;  3LXT A;  2TRX A;  1MEK A;  3IK9 A;  3ZTL A;  5KN3 A;  2RLI A;  4IKH A;  2IMI A;  3ZFB A;  2IN3 A;  2N5F A;  4PQI A;  1K0D A;  3F3R A;  4FO5 A;  2A4H A;  8GSS A;  5CNW A;  1U88 A;  4FYB A;  4MMM A;  3UIW A;  3I9V 2;  2EIR A;  4MJA A;  2F8A A;  2LQO A;  1PGT A;  2C0F A;  3BD2 A;  3S9F A;  3EU4 A;  4KSM A;  2YPM A;  3MDK A;  1AW9 A;  3F4R A;  4J2F A;  2VCQ A;  3UEM A;  2CVK A;  1R26 A;  1SVM A;  3D4T A;  4POK A;  12GS A;  1TDI A;  6GSV A;  4AJ8 A;  2EIO A;  1XFL A;  3UBL A;  4XCS A;  3KD0 A;  4N3Z A;  3LSZ A;  2X8C A;  1YF1 A;  5DQY A;  4KX4 A;  2HZE B;  2H6Z A;  3PR8 A;  5DAK B;  2RM6 A;  5IPG A;  2LS5 A;  3V1W A;  3GTU A;  2PU9 C;  4KB3 A;  5F06 A;  2R4V A;  2XPE A;  2H71 A;  2A4V A;  5ECQ B;  2QA1 A;  4XTS A;  3TRX A;  2HSH A;  5D9T A;  4AKI A;  2OE0 A;  2VLV A;  3VFI A;  1E6B A;  2HSN B;  2FNO A;  1TU8 A;  3D6I A;  3FHK A;  5IM9 A;  4G9H A;  4EO3 A;  4Q5R A;  1J0F A;  4BVX B;  3BBY A;  2R6K A;  4G0K A;  5JWR B;  2C3N A;  2JZS A;  2V6K A;  2CZ2 A;  2NPB A;  1ZYP A;  3EMX A;  1GSY A;  2FCH A;  3HVX A;  3QAW A;  1OC9 A;  2DIZ A;  2GVP A;  4KCE A;  1F3A A;  4IJ3 A;  2HNL A;  1J08 A;  2QC7 A;  4O92 A;  4LMV A;  1K0N A;  4WKW A;  5D8I A;  20GS A;  2B3S A;  2FWE A;  1A0F A;  2WW0 A;  1G7E A;  5CRW A;  3GST A;  5GZZ B;  4MLY A;  2YCD A;  5CRG A;  1IYH A;  6GST A;  1YEW C;  3GX8 A;  1U3I A;  4N0V A;  5CRE A;  2FA4 A;  2H01 A;  3IRA A;  2P0G A;  3CSJ A;  4GST A;  3EUR A;  5ID2 B;  2AHE A;  1A2J A;  3RHC A;  2H73 A;  1DSB A;  4L5O A;  3GKX A;  4Z2R A;  4WET A;  2GSR A;  1A0R P;  3CQF A;  4BL7 A;  2JAD A;  4ZBD A;  1TRW A;  5H5Q A;  2OKA A;  1QMV A;  2VL2 A;  4K7I A;  1WMJ A;  3F4T A;  1ST9 A;  2L5O A;  4EIQ A;  4EDZ A;  1PKZ A;  1U87 A;  5FHI A;  2DJ3 A;  5HR2 A;  1K0O A;  3KJY A;  5CP1 A;  4ZB8 A;  1SYR A;  1DBY A;  1FAA A;  1R5A A;  2FY6 A;  2MBS A;  3GMF A;  1LU4 A;  2HXK A;  1ILO A;  1TK8 B;  2FWH A;  2H0I A;  1G0T A;  1I1I P;  1TKD B;  3ME7 A;  4PQ1 A;  5G30 A;  2OE3 A; 
#chains in the Genus database with same CATH homology
 2O89 A;  4IEL A;  1FB0 A;  3FZ5 A;  1SJZ A;  3EWL A;  4KSO A;  3Q74 A;  5G1K A;  2M72 A;  2H8L A;  3APO A;  5GAN D;  2H1G A;  2PVQ A;  3CSH A;  1XXU A;  5E4W A;  1SL0 B;  5DJM A;  2OT3 A;  1XCC A;  4GXZ A;  4YAP A;  4G01 A;  1FB6 A;  1ZYQ B;  2ZCT A;  4AF2 A;  3VPQ A;  3CRT A;  5AGY A;  1PKW A;  4HJM A;  1SKR B;  1Q4J A;  3ERG A;  1SL2 B;  1GUL A;  2I1U A;  3M9J A;  2VL3 A;  1XZO A;  2X64 A;  2V32 A;  1EGR A;  2V6O A;  5ECR B;  1BX9 A;  3GL3 A;  2B1L A;  1XWB A;  1V40 A;  1BAY A;  2NVL A;  2B5E A;  4ID0 A;  2YAN A;  2EFC A;  4FQU A;  4OFN A;  4MK3 A;  2C4J A;  2E2G A;  1QXH A;  3UAR A;  3H93 A;  4MP4 A;  1GH2 A;  2HRA A;  4CY8 A;  3OR5 A;  2E0Q A;  5A5H A;  1PD2 1;  3D4M A;  3KMN A;  1M99 A;  1C72 A;  1B9Y C;  4TKY A;  4ZL8 A;  1Z6N A;  3FMW A;  5JCU A;  1ERV A;  1HNA A;  1PX6 A;  1GTA A;  1HD2 A;  3KEB A;  5BMU A;  4GTU A;  5IMV A;  4OD7 A;  4TW5 A;  3IA1 A;  2V1M A;  3HXS A;  4JZQ A;  2QKE A;  1ERT A;  2ALB A;  6GSU A;  2DMM A;  2GS3 A;  2KP2 A;  3TJB A;  1X9M B;  2L6C A;  5A5H B;  1VF2 A;  1U3A A;  1U6T A;  2WCI A;  3F3Q A;  4AGS A;  5AIV A;  4CDO A;  4NV2 A;  1VF4 A;  2VLU A;  10GS A;  3APQ A;  3KIJ A;  2H75 A;  2I3Y A;  2DIY A;  4JR6 A;  4WXT A;  2RUF A;  2VCV A;  4HQS A;  2K8S A;  2JL4 A;  3L9S A;  4DSS B;  4K0N A;  2YZU A;  1AIU A;  1TJD A;  3R2Q A;  4TXV A;  4Q5Q A;  4OFT A;  4NHZ A;  1ZGN A;  2C8U A;  3K8N A;  2JZT A;  2CT6 A;  1WP0 A;  2DJ1 A;  3ZML A;  1YZX A;  4KGI A;  2JSY A;  2OBK A;  5B8A A;  2VKZ G;  1SK1 A;  3KH7 A;  4GRF A;  1O8X A;  4ECI A;  5JCW A;  3GRX A;  3U5R E;  5AIS A;  2BJX A;  2XC2 A;  1LBK A;  3I69 A;  2GLR A;  1W89 A;  3D5J A;  3QAG A;  3CXG A;  5D73 A;  1K3Y A;  4HI7 A;  4NXI A;  1HYU A;  4HS1 A;  2F51 A;  2B7J A;  5G5F A;  2H30 A;  5INY A;  2F9S A;  2H1B A;  3P7X A;  1BED A;  1YJ6 A;  1OVN A;  4GQC A;  1H75 A;  3IHG A;  4H86 A;  5KEJ A;  4ZB6 A;  4AKH A;  2ES7 A;  4MA9 A;  1GL8 A;  3UJ1 A;  4MDC A;  4POL A;  4OCE A;  2A2R A;  3CWG A;  1G6W A;  4V1A g;  1SEN A;  2DJJ A;  3C8E A;  3WYW A;  4DEJ A;  3KCM A;  1F3B A;  4I2T A;  4GF0 A;  4TRX A;  2DKH A;  22GS A;  3ZFL A;  2KUC A;  2F3M A;  1UVZ A;  4WF5 A;  4E8H A;  2WGR A;  3C71 A;  4XS1 A;  4GWR A;  2YWO A;  2LRC A;  5A34 B;  4LL1 B;  1N8J A;  4EKZ A;  2QSI A;  1FW1 A;  3FYG A;  1DE2 A;  2HQT A;  3U6V A;  2PWJ A;  4HEA 2;  3D0Z A;  3LEF A;  2C1Y A;  4TOP A;  2L4Q A;  4L8E A;  4RI7 A;  3MNG A;  3FR6 A;  1I5G A;  2H1D A;  2NTO A;  5IMC A;  4KDU A;  3TRP A;  5A4W A;  4K6X A;  1XW5 A;  3KTB A;  2IMF A;  4NV5 A;  1BG5 A;  3GHA A;  1GUM A;  3QR6 A;  3TKP A;  1SVO A;  2DML A;  2IFQ B;  3IC8 A;  5COH A;  3EPT A;  4JRR A;  5EL8 A;  5F0G A;  4E8E A;  4AI6 A;  4D73 A;  5DDL A;  3VI5 A;  1SJ6 A;  1AXD A;  1V98 A;  4O7H A;  4NPB A;  1OE8 A;  3C1S A;  3O3T A;  1PRX A;  2JZR A;  5ECH B;  1BQ7 A;  1GSQ A;  4K5S A;  4HOJ A;  2X99 A;  3ISO A;  3LFL A;  2K6V A;  1PSQ A;  2AJQ B;  1SK0 A;  4EL1 A;  5CO3 A;  2PVO C;  2FHE A;  2H66 A;  1T3B A;  3GN3 A;  5DJL A;  2E2M A;  3LYP A;  4F0C A;  3CTG A;  1RK4 A;  5CRD A;  3GKN A;  17GS A;  3L0H A;  2RUE A;  5LCZ A;  1XPV A;  1M9B A;  2L57 A;  4HU9 A;  4PUR A;  3UOM A;  4AKG A;  1TU7 A;  3PH9 A;  2P5R A;  3ZIT A;  2K9F A;  4XHM A;  1JFU A;  3J7Y b;  1HNB A;  1TOF A;  4Z7X A;  2XPD A;  2GQK A;  4IQA A;  1AC1 A;  2R37 A;  1PN9 A;  1MDI A;  2YN1 A;  3H4K A;  4ECJ A;  4RQR A;  4MH3 A;  4K2D A;  3KGK A;  2VUP A;  3GNJ A;  3VWV A;  1KTE A;  3ZVJ D;  4MF6 A;  3F9U A;  3ERW A;  3LQ7 A;  1RW1 A;  3IXR A;  4ACS A;  1LJR A;  9GSS A;  3H79 A;  2O5V A;  2E7P A;  1JZO A;  1THO A;  3Q6O A;  4TR1 A;  5A4V A;  1CQG A;  2L5L A;  1FHE A;  3HJM A;  5ABR A;  4I8B A;  1X5D A;  4WBR D;  4J57 E;  1GSS A;  1EEJ A;  4POB A;  4AJ6 A;  4NMU A;  1DE1 A;  5BRT A;  5GAP D;  3VK9 A;  2G2Q A;  3HCZ A;  2HE3 A;  1OAZ A;  2LV3 A;  3AY8 A;  2XHF A;  5AN1 A;  3TJK A;  1QFN A;  3RBT A;  3HHV A;  4XS6 A;  5KN1 A;  4HQZ A;  1JLW A;  2HRK A;  4F03 A;  1XWA A;  1ACV A;  2B6M A;  3ME8 A;  3GTU B;  3HMJ G;  4MCU A;  2HZF A;  3LGC A;  1F6M C;  3HA9 A;  3G7J A;  2BTO T;  4O5U A;  3J7Y k;  3KXO A;  5A1N A;  1M2B A;  1WWJ A;  4ECC A;  5KN0 A;  3TKS E;  4RUV A;  4Z2T A;  3CYN A;  4OO5 A;  3DXB A;  1GRX A;  3KZQ A;  2LJR A;  3VLN A;  2LRT A;  4HJ2 A;  3HVV A;  4EF0 A;  3TKR A;  1R5P A;  2H0H A;  2N5B A;  2YNX A;  3L9U A;  1YDK A;  3R3E A;  2CAI A;  5ECI B;  4RI6 A;  5DAL A;  2YWN A;  4MPG A;  4FYU A;  1M0U A;  3SWL A;  3VPT A;  4Z2U A;  4IP1 A;  2FUG 2;  5LD0 A;  2LKU A;  3FW2 A;  4MH2 A;  2M46 A;  3PPU A;  3WT2 A;  4K2X A;  1V58 A;  2DJ0 A;  2GZP A;  2CZ3 A;  1OC9 B;  3UL3 A;  2LEG A;  3DD3 A;  3RAZ A;  4ZXG A;  4HZ4 A;  5J5N A;  2F8F A;  2HSM A;  2AYT A;  4AJ7 A;  2GDR A;  1TK5 B;  2H76 A;  3DVX A;  4V2L A;  3FK8 A;  5A4U A;  5EVO A;  4OO4 A;  2WFC A;  1WE0 A;  3A5W A;  1GWC A;  1EP7 A;  2IL3 A;  2VLT A;  2RM5 A;  3IR4 A;  1PN0 A;  4IN0 A;  2CAQ A;  5FWG A;  1TRU A;  1PA3 A;  1PMT A;  2FA8 A;  1OC8 A;  1RQM A;  4MF7 A;  3ZRD A;  3A2X A;  4BL7 B;  2CV4 A;  3RPN A;  1XOA A;  5J40 A;  2DJK A;  1NHO A;  1GNE A;  4ZB7 A;  4BVY A;  2MMO A;  5CRH A;  4ECB A;  2C3T A;  3GUR A;  2YJ7 A;  1EZK A;  5G2Z A;  1X5E A;  4TXO A;  2VM2 A;  1O8W A;  2FD3 A;  2I81 A;  2H1L A;  2CX4 A;  2KP1 A;  1Q98 A;  2H72 A;  2PBJ A;  5HQP A;  2AAW A;  2LJK A;  4PNF A;  1X9W B;  2NBS A;  5JCG A;  3WGE A;  4EE0 A;  2GSS A;  3LJR A;  1S3D A;  1SU9 A;  2L59 A;  4ZL7 A;  3GFK A;  2K18 A;  4IW9 A;  16GS A;  4IJI A;  1MTC A;  4CY6 A;  3EVI A;  2WB9 A;  4V1A p;  5IMA A;  13GS A;  1AQX A;  4N30 A;  3W8S A;  4FIW A;  2IJY A;  1AAZ A;  1WJK A;  4I5Q A;  1THX A;  2DSA A;  3HYP A;  14GS A;  4KND A;  1DUG A;  3BCI A;  1A2M A;  3KP9 A;  3W8J A;  2PMT A;  4CW9 A;  3DML A;  4PNG A;  3EC3 A;  1VF1 A;  5ECM B;  3RPP A;  5IMF A;  1OC3 A;  1TXX A;  1YY7 A;  3HZ4 A;  5C04 A;  3RHB A;  1XVW A;  4EIP A;  5DCG A;  2H6X A;  2R0P A;  2ON5 A;  3US3 A;  1B4Q A;  4MNN A;  1HNC A;  2X8H A;  3F8U A;  1Z6M A;  2VL9 A;  1T4Z A;  2VM1 A;  3VWU A;  2H74 A;  3QDN A;  5ECK B;  4PGT A;  1WOU A;  2IMD A;  2R0G A;  1SD9 A;  4J56 E;  4GCI A;  1EWX A;  1ERU A;  1O81 A;  4EXJ A;  1SK2 A;  3TOU A;  2HT9 A;  4Q5F A;  5D96 A;  4XRA A;  2IMK A;  4YAV A;  1AQW A;  3CRU A;  3EE2 A;  5BMU B;  1O6J A;  2M80 A;  3UVT A;  3TKQ A;  5IMD A;  4O5R A;  4PUF C;  1SL1 B;  1T8E B;  1ZOF A;  3UVH A;  2MYG A;  3IDV A;  1G7O A;  2CX3 A;  3ZIV A;  2XBI A;  4PTS A;  2L4C A;  3MSZ A;  1J9B A;  2VD1 A;  2YWI A;  3E9J B;  5J47 A;  2B5X A;  5J4U A;  3L9V A;  4RQX A;  4ZIL A;  4ZBB A;  3L4N A;  2R0C A;  3H1N A;  1OKD A;  4WR5 A;  4G19 A;  4FYC A;  4JU5 A;  3HVS A;  2OE1 A;  1TRS A;  2K8V A;  1GUH A;  3P8W A;  4IP6 A;  1BG1 A;  3GKK A;  2FLS A;  1Y6E A;  1EV9 A;  2H19 A;  4NWY A;  5HR3 A;  4YKF A;  3WGX A;  1GP1 A;  2DJ2 A;  4GDF A;  4OFM A;  1O73 A;  3VUR A;  3QFB C;  3W6G A;  3A2V A;  3BJ5 A;  4ILF A;  3WGD A;  5G31 A;  2J9H A;  3IOS A;  1A2L A;  4I97 A;  2CVB A;  2FGX A;  1A23 A;  2MZC A;  5IPH A;  1GTI A;  2CA8 A;  4L0U A;  4QL7 A;  3QOU A;  2R3X A;  2C0E A;  2OBI A;  2H70 A;  2GZZ A;  4JBB A;  3QMX A;  4POM A;  2G0F A;  4XS4 A;  1VF3 A;  2X8G A;  3O6T A;  2O7K A;  4KDX A;  2YOI A;  4XIH A;  3E3E A;  3FRC A;  4K8M A;  5JWQ B;  2GTU A;  3GX0 A;  2YZH A;  4EVM A;  3F6D A;  3DIE A;  1F37 A;  1X5C A;  4MZB A;  1W4V A;  5D9V A;  2KLX A;  3QCP A;  1YEX A;  4EUY A;  3GV1 A;  5J4Y A;  3KTL A;  4JE1 A;  3TKS A;  3GYK A;  5A5K A;  3KM6 A;  2VOC A;  4N0Z A;  2X49 A;  4KH7 A;  5G5E A;  4WR4 A;  4YQU A;  2R2J A;  4JR4 A;  4HZ2 A;  3EYT A;  2O85 A;  2YJH A;  3N5O A;  19GS A;  3FY7 A;  1H4O A;  3DKS A;  3G7Y A;  1SYX A;  3Q19 A;  1XOB A;  2RII A;  4FH8 A;  4G10 A;  1Y25 A;  2EFH A;  3C73 A;  1YKA A;  3C1R A;  4V2M A;  6GSY A;  1VRS D;  3DEX A;  2PUK C;  1VGL A;  5IMZ A;  1KEB A;  2C3Q A;  1FVJ A;  1ON4 A;  1SKS B;  3P2A A;  1TI1 A;  2HRF A;  4O5Q A;  2VCX A;  4EDY A;  2PGT A;  4GQF A;  3F63 A;  1TK0 B;  1XW9 A;  5J3R A;  3ZMK A;  2A2P A;  4G0L A;  5F8B A;  2MBT A;  5IO2 A;  1EEM A;  1ABA A;  3TJG A;  4HDE A;  5DBQ A;  2CQ9 A;  1F2E A;  4KUN A;  3MIX A;  1S3C A;  3GIX A;  4D73 B;  2TIR A;  4TVE A;  2R5G A;  2B1K A;  3PIN A;  5H5R A;  1TW9 A;  4X4J A;  2DBC A;  3KH9 A;  4IHU A;  1V9W A;  2AV4 A;  1Z7R A;  5EPF A;  2IME A;  3TCO A;  3EU3 A;  2O87 A;  3ZL5 A;  3FEU A;  2Z9S A;  1XVQ A;  4E68 A;  2HZE A;  5DAK A;  3BOA A;  3NIV A;  7GSS A;  5EY6 A;  4X0X A;  3RDW A;  3DWV A;  4GSN A;  1K3L A;  4ZIJ A;  1HQO A;  3FZ9 A;  1OYJ A;  5IQY A;  2HI7 A;  2AB6 A;  2OAC A;  2YV7 A;  1JZW A;  5B8B A;  1IYI A;  2HSN A;  5ECL B;  4QL9 A;  3ZIJ A;  1PQN A;  4A5P A;  3IK7 A;  4NHW A;  4ZB9 A;  4LL4 B;  4BVX A;  1ML6 A;  1K0M A;  3ZZX A;  4G2E A;  2YP6 A;  5CYY A;  4MAB A;  4MJE A;  1A8L A;  4X43 A;  4ML6 A;  3FZ4 A;  3KMO A;  1CQH A;  2LRN A;  3HJP A;  3HKR A;  4TR4 A;  1T7P B;  1OKT A;  1QK8 A;  3GKM A;  2AUV A;  1MDK A;  2VO4 A;  4TR1 B;  4IBP A;  1ERW A;  5LNK e;  2GGT A;  2I4A A;  4N11 A;  1BF5 A;  1XIY A;  4L5L A;  2VAF A;  1V2A A;  4G0I A;  4DSR A;  1USB A;  2X4A A;  1PX7 A;  4N10 A;  2VCW A;  2OAD A;  3LXZ A;  3CMI A;  4F2I A;  4GSS A;  5D9X A;  4TR0 A;  3LG6 A;  1V57 A;  1Z9H A;  1NM3 A;  2PN8 A;  4I2U A;  5IOX A;  2D2Z A;  5B6M A;  4Q5N A;  2HRK B;  3FKF A;  5ID2 A;  1MDJ A;  3HJO A;  3LYK A;  11GS A;  4O32 A;  4OMV A;  1QQ2 A;  4WEY A;  4TN8 A;  2WJU A;  2I9H A;  5D93 A;  3D22 A;  3TDG A;  5A1N B;  3D21 A;  4IVF A;  5DVB A;  2YV9 A;  5H5S A;  4DSQ A;  2TRC P;  5HFK A;  3I6A A;  4K7N A;  2P31 A;  3F4S A;  5J9B A;  1AQV A;  5J4V A;  1FG4 A;  1SKW B;  1R7H A;  1PL2 A;  4KAE A;  2HYX A;  2LNS A;  2LNT A;  5DAL B;  5L71 A;  3TB2 A;  1XWC A;  3WD6 A;  1ZL9 A;  3TOT A;  1WPI A;  2IPA A;  5ECS A;  3TKS C;  3CTF A;  3CBU A;  4I6X A;  2DC5 A;  4V2N A;  3VWW A;  3EMP A;  2ZUP A;  2HFD A;  2FWF A;  2GST A;  1BJX A;  1X9S B;  1O7U A;  3QFA C;  2HSM B;  4IS0 A;  3F0I A;  1JZD A;  5J41 A;  4YH2 A;  1TI3 A;  3ZLP A;  4BA7 A;  3L78 A;  2MMA A;  2KOK A;  5IIZ A;  3QAV A;  3TUE A;  4ICY A;  4MPF A;  1QGV A;  3EIN A;  3MYD A;  4ML1 A;  5AIX A;  5GSS A;  3UBK A;  3TGZ A;  2EFE A;  4K0G A;  3VWX A;  1A24 A;  1Z7P A;  3DYR A;  2GT6 A;  3IAM 2;  1PL1 A;  3DVW A;  1X0R A;  2DLX A;  3ERF A;  2OJL A;  3VI7 A;  1M9A A;  2ON7 A;  2UZ8 A;  4EC0 A;  4CHS A;  4PX1 A;  1G6Y A;  3G7I A;  2GZY A;  1S3A A;  4BVY B;  2VD0 A;  1GSD A;  4QQ7 A;  4YQM A;  1GSU A;  4TXO B;  1Z3E A;  1GNW A;  2DKI A;  4IGJ A;  4IQ1 A;  2EIQ A;  3IHQ A;  2EFD A;  3QPM A;  3TRQ A;  4BPY A;  3ZRE A;  5ELA A;  3MAK A;  3ED3 A;  2N5A A;  4K1F A;  1K0C A;  3GA4 A;  3LWA A;  1KNG A;  5CAX A;  2H1A A;  1A8Y A;  2V41 A;  2J23 A;  5F05 A;  2C0G A;  4F9Z A;  3A2W A;  2XBQ A;  3UMA A;  4F82 A;  1B4P A;  2H0G A;  3A3T A;  4OWY A;  5C00 A;  2JU5 A;  2LTK A;  3NOF A;  1AUC A;  2O8V B;  4P3Y B;  3TU3 B;  1O85 A;  5KOW A;  4MJB A;  1I9D A;  4ISD A;  2WS2 A;  4USS A;  2MMZ A;  3LOR A;  2LQQ A;  6GSX A;  4K9Z A;  5HFI A;  1E2Y A;  4KCA A;  1NHY A;  3I43 A;  3M9K A;  3GL5 A;  1YF0 A;  4L0W A;  1YQ1 A;  1TXU A;  5D9W A;  2P5Q A;  4LA1 A;  4DSS A;  2GT5 A;  4W66 A;  2UV8 G;  4YQV A;  1MD4 A;  4XRD A;  4KW6 A;  3QD9 A;  2ZNM A;  2FWG A;  5DQS A;  1UN2 A;  2C80 A;  4MZW A;  3M1G A;  2EC4 A;  5B6N A;  4LLR A;  2B5Y A;  1UA5 A;  2MMN A;  1XWG A;  2OA7 A;  1KBN A;  3ZVJ A;  1OE7 A;  4KF9 A;  3GH9 A;  5HR0 A;  4PUA A;  2PPT A;  3FZA A;  1B8X A;  1ZMA A;  1XW6 A;  1ZYN A;  1QUW A;  4DVC A;  5ECO B;  1M7T A;  3TJF A;  4GLT A;  2GQM A;  2H6Y A;  1JZR A;  2LUS A;  3C7M A;  2BMX A;  1EGO A;  1TTZ A;  2JAC A;  1ZCP A;  4MJC A;  3JCM L;  3N9J A;  1WIK A;  4OCF A;  5E59 A;  1JLV A;  2IWT A;  6GSW A;  5ECN B;  1GTB A;  1TRV A;  4K7O A;  3SBC A;  1EV4 A;  2WDU A;  1GLP A;  2HSY A;  4KE3 A;  5DCH A;  5FT3 A;  3DRN A;  1FOV A;  1FO5 A;  1N2A A;  4KDY A;  2QGV A;  5ENU A;  3IAS 2;  3DGQ A;  4BWS A;  5HR1 A;  3LW9 A;  1K0A A;  4HUA A;  3GUS A;  2NDO A;  2LST A;  1GSF A;  1NSW A;  2QA2 A;  3IPZ A;  2KHP A;  5HFG A;  2L6D A;  3FR9 A;  2VL2 C;  3P90 A;  4LMW A;  4F0B A;  5IOW A;  3Q18 A;  2WZ9 A;  5G1L A;  18GS A;  3UAP A;  5ELG A;  1B9X C;  3IC4 A;  2WUL A;  1TP9 A;  1NW2 A;  3BCK A;  3IE3 A;  1ZZY A;  1YVL A;  1FOH A;  3PGT A;  5A34 A;  1URM A;  5GST A;  3GH6 A;  1K0B A;  3HY2 A;  3M3M A;  5J9C A;  1JHB A;  3HD5 A;  1T00 A;  4PXO A;  1EOH A;  3M0F A;  4YKG A;  1UC7 A;  1ZYE A;  3M8N A;  2V2G A;  1WRY A;  1SVL A;  5IO0 A;  3F6F A;  4NAX A;  3APS A;  1YKC A;  2VCZ A;  4QMK A;  3WT1 A;  2LJA A;  5F07 A;  1M2A A;  4ZBA A;  2CVD A;  1XBS A;  1GUK A;  2IIY A;  2WRT A;  1F9M A;  1GTU A;  2IFQ A;  4MF5 A;  3NZN A;  1T4Y A;  1Z5Y E;  3KP8 A;  1K3O A;  4XS4 B;  5KOX A;  1FVK A;  4K5R A;  1YEP A;  2VIM A;  1N25 A;  2REM A;  4TR3 A;  1SD8 A;  3ZYW A;  2HRN A;  2GSQ A;  3G9B A;  5B7C A;  4X1U A;  1M2D A;  1SJI A;  4HU7 A;  1MD3 A;  2A2S A;  3CSI A;  1BYE A;  1XWK A;  4WBJ A;  3IBH A;  4ULX A;  1R4W A;  4KA0 A;  3HDC A;  3A5I A;  2C0D A;  4WF4 A;  4JED A;  2VCT A;  3HZ8 A;  5ECP B;  3IV4 A;  2YWM A;  2HLS A;  1EP8 A;  1T1V A;  1EOG A;  4AKX B;  1GLQ A;  6GSS A;  3TJJ A;  4BWQ A;  3H8Q A;  3E0U A;  1B48 A;  3O76 A;  3GSS A;  2PER A;  1Y1U A;  4MZC A;  5KN2 A;  1GSE A;  4PQH A;  2JSZ A;  2B7K A;  4ZL9 A;  5JWO B;  3FR3 A;  2GQL A;  3MWH A;  3LXT A;  2TRX A;  1MEK A;  3IK9 A;  3ZTL A;  5KN3 A;  2RLI A;  4IKH A;  2IMI A;  3ZFB A;  2IN3 A;  2N5F A;  4PQI A;  1K0D A;  3F3R A;  4FO5 A;  2A4H A;  8GSS A;  5CNW A;  1U88 A;  4FYB A;  4MMM A;  3UIW A;  3I9V 2;  2EIR A;  4MJA A;  2F8A A;  2LQO A;  1PGT A;  2C0F A;  3BD2 A;  3S9F A;  3EU4 A;  4KSM A;  2YPM A;  3MDK A;  1AW9 A;  3F4R A;  4J2F A;  2VCQ A;  3UEM A;  2CVK A;  1R26 A;  1SVM A;  3D4T A;  4POK A;  12GS A;  1TDI A;  6GSV A;  4AJ8 A;  2EIO A;  1XFL A;  3UBL A;  4XCS A;  3KD0 A;  4N3Z A;  3LSZ A;  2X8C A;  1YF1 A;  5DQY A;  4KX4 A;  2HZE B;  2H6Z A;  3PR8 A;  5DAK B;  2RM6 A;  5IPG A;  2LS5 A;  3V1W A;  3GTU A;  2PU9 C;  4KB3 A;  5F06 A;  2R4V A;  2XPE A;  2H71 A;  2A4V A;  5ECQ B;  2QA1 A;  4XTS A;  3TRX A;  2HSH A;  5D9T A;  4AKI A;  2OE0 A;  2VLV A;  3VFI A;  1E6B A;  2HSN B;  2FNO A;  1TU8 A;  3D6I A;  3FHK A;  5IM9 A;  4G9H A;  4EO3 A;  4Q5R A;  1J0F A;  4BVX B;  3BBY A;  2R6K A;  4G0K A;  5JWR B;  2C3N A;  2JZS A;  2V6K A;  2CZ2 A;  2NPB A;  1ZYP A;  3EMX A;  1GSY A;  2FCH A;  3HVX A;  3QAW A;  1OC9 A;  2DIZ A;  2GVP A;  4KCE A;  1F3A A;  4IJ3 A;  2HNL A;  1J08 A;  2QC7 A;  4O92 A;  4LMV A;  1K0N A;  4WKW A;  5D8I A;  20GS A;  2B3S A;  2FWE A;  1A0F A;  1G7E A;  5CRW A;  3GST A;  5GZZ B;  4MLY A;  2YCD A;  5CRG A;  1IYH A;  6GST A;  3GX8 A;  1U3I A;  4N0V A;  5CRE A;  2FA4 A;  2H01 A;  3IRA A;  2P0G A;  3CSJ A;  4GST A;  3EUR A;  5ID2 B;  2AHE A;  1A2J A;  3RHC A;  2H73 A;  1DSB A;  4L5O A;  3GKX A;  4Z2R A;  4WET A;  2GSR A;  1A0R P;  4BL7 A;  2JAD A;  4ZBD A;  1TRW A;  5H5Q A;  2OKA A;  1QMV A;  2VL2 A;  4K7I A;  1WMJ A;  3F4T A;  1ST9 A;  2L5O A;  4EIQ A;  4EDZ A;  1PKZ A;  1U87 A;  5FHI A;  2DJ3 A;  5HR2 A;  1K0O A;  3KJY A;  5CP1 A;  4ZB8 A;  1SYR A;  1DBY A;  1FAA A;  1R5A A;  2FY6 A;  2MBS A;  3GMF A;  1LU4 A;  2HXK A;  1ILO A;  1TK8 B;  2FWH A;  2H0I A;  1G0T A;  1TKD B;  3ME7 A;  4PQ1 A;  5G30 A;  2OE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...