4EAQA

Crystal structure of thymidylate kinase from staphylococcus aureus in complex with 3'-azido-3'-deoxythymidine-5'-monophosphate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
201
Chain Sequence
b'FQSNAMSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in complex with 3'-Azido-3'-Deoxythymidine-5'-Monophosphate
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 82
structure length 201
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4eaqA00
1DG1G 3A1SA 5FPSA 3D31A 3ADDA 5EE0A 2GCOB 2N42A 3TBKA 4PC6A 4V0LA 4AG6A 5BWMA 3ZD6A 2ONKA 4MYHA 1XMIA 1KI6A 3ZZTA 5CB6A 4LDJA 1JJ7A 1G3MA 4IDNA 4P4SA 2V7QA 1X8LA 1MABB 1KO7A 1ZUNB 2W6IA 4CT5A 1FTNA 4JT2A 1GNQA 2P6RA 1MO4A 4XWAA 1XFAA 2ZE8A 1DAGA 3EPHA 2O8DA 4M1OA 3I3SR 3MLEA 1OHHD 2BHRA 4ITRC 2CXXA 3NH9A 2ZI7A 4WXRA 2R62A 3GCGA 1C1YA 5AWFC 2BBSA 1T9HA 2CLDX 2XNDA 4G0NA 3RANA 4B3XA 5M04A 3LH5A 1GWNA 3UWKA 3MMPA 2O0JA 2XAUA 5JWHA 1FX0B 1KSJA 1UKYA 5AJZA 1QHIA 4YDHB 4BFTA 3VX4A 3K70B 3U7EB 3LAWA 1IY1A 3NBFA 5CK4A 1GKIA 4M1YA 1G5TA 2OCPA 3A58B 5JSZA 4MKFA 4M21A 5E7MA 4LV8B 1TU3A 2ZSFA 1RW4A 2WWYA 1BMFD 4D82A 1XNJA 4ZCMA 2BJWA 1SGWA 1LFDB 2PX0A 3D7MA 3AP2A 3QPWA 4LBWA 5L3RA 3U60B 4C3ZA 4IVQA 4QFMA 3W5JA 4URXR 3CH5A 1F3OA 1G8YA 2QAGB 4I1UA 4Q4HA 1KK2A 3DDCA 1W0KA 3LBNA 2Q3MA 4Z1MD 1DAIA 2QGZA 3K0AB 1Z6GA 2HCBA 2WHXA 4Q9KA 3OFND 4OKSA 1E9CA 5CLQA 2OE2A 2HF9A 1VYTA 1WE2A 3Q7QA 1UDXA 4I99A 4IDPA 1DBSA 3QXSA 3P27A 5TARA 1E9EA 3F3YA 4C0AC 1U9IC 2QP9X 3GMTA 3UMSA 1W36D 3B1YA 2GF0A 4LYAA 1Q0UA 4V0MA 4LGMA 1RZ3A 4DC9A 1UEIA 2FGJA 2X1VA 2ZJBA 3AM1A 2A5JA 2BJVA 1P9WA 4EPTA 3KB2A 4KI0A 4ERNA 3P4XA 2DFTA 1YR7A 4JYBA 2ZE6A 1E4YA 1IONA 4BZPA 4EFNA 5DGXA 3UWOA 4PQRA 3IDQA 1NBME 2B8TA 2XSZA 4TMXA 5HR5A 4IRUB 3LFUA 2C5LA 2ODBA 4MUBA 3UATA 1X1SA 1NG1A 3PUYA 3DEFA 4AKIA 2ZRHA 3DL0A 1HQCA 1ODFA 2H7VA 2IYUA 2R6AA 4TL9A 5G3ZA 4F92B 4UNSA 1AS0A 4PTLA 3ADKA 2G1JA 2C96A 2BCGY 3IGFA 4H1VA 1OYYA 1FUUA 1SZPA 2DR3A 5GVSA 2OSBA 3FKQA 2HYDA 4BEJA 3IUYA 2X2EA 1MO3A 5EQTA 2BCJQ 5D3MA 2GILA 5AUQA 2GTPA 4RD3A 4D26A 3ZVMA 2G0NA 2NTYC 4KLNA 1TMKA 4EJSB 3W9YA 3WYAA 1BH2A 1IY0A 1DOAA 3B6EA 1XMJA 3SQXA 4P31A 2GCOA 3GLHB 4GL2A 1JPNA 3AUXA 1SXJB 2RGNC 3ASZA 2JLUA 5SZJA 3AQ4A 2NZ8A 1DO0A 1XD9A 2ZUDA 4NYJQ 2IS1A 3NBZC 3N70A 2CCJA 4TL6A 1V5WA 4LJ8A 3ZD7A 1MABA 3MD0A 5GJCA 1N6NA 3NBXX 4X8MA 1OIXA 2ERXA 2RGBA 5KPJA 3IIMA 3GJXC 1EFRA 5FBWB 1CU1A 1OFUX 1V43A 4IDQA 4DLRA 3FPAA 1XPOA 3V4FA 3CH4B 3QI2A 2D06A 5JFGA 3HU1A 4QRHA 1FFHA 1S3GA 2QPAA 4DLSA 3RS7A 4RVCA 4ARZA 1TPZA 3FB4A 3RS3A 4BRUA 2ECKA 2H16A 3AVYA 1VHLA 2VQSA 4YMWA 4HDOB 2ZE7A 1G3QA 3ZJYA 4UNNA 3B5JA 4HUTA 1NIPA 2ZRNA 4G1UC 3WP1B 3CF6R 2C03A 1FX0A 3A36A 3GFTA 5FBLB 2FJUA 2MMGA 4I1SA 1K6MA 2A78A 4AD8A 4E07A 3T35A 3K9GA 2PT5A 2BKEA 2ZJZA 4RZ3A 3PVSA 421PA 2QAGC 4LI0A 1OPXA 4D4JA 4TLEA 3OHMA 2X2FA 1HUQA 3B1XA 1XF9A 2FX3A 3BIFA 1W4BA 2Q3FA 2G77B 2B7CA 4WBSA 2BM0A 2RHMA 3TSZA 4ACBA 2ORIA 1Q3TA 3NVAA 1K5GA 2AN9A 3NDPA 4CZ2A 3C15C 2GZAA 1KK0A 1II8B 3TR0A 4B47A 1KSGA 2VLIA 1E2MA 2DB3A 2HT6A 1UADA 4YQFA 1A1VA 4Q7JB 1G18A 3KDSE 3Q8XB 2ZS9A 3ZIAD 5KPDA 1UPTA 3K0AA 4XOIA 4W5JA 4KVAA 1OJLA 5FTKA 4KFTA 1SHKA 1OB2A 4UJ3A 2DFKB 3J81k 1XEFA 1PVOA 2H57A 1S1MA 1UF9A 1PJRA 2XB4A 1E0JA 4OQNA 2O5VA 2FEMA 2ZUCA 1ZM3A 2FDCA 4JLKA 1AJEA 3CX7A 1IJEA 1E2JA 3AF2A 4EAQA 1Y3AA 5CK5A 2AFHE 3EASA 1NY5A 5F2EA 2IUUA 3BAFA 1JALA 3A4MA 2GKSA 1W36C 4JLBA 2WWFA 2XNSA 4NP6A 1RRFA 2AKYA 2IXEA 2MSCB 4P4UA 4B3CA 2IXGA 5JI3E 2CEAA 2B21A 3FFAA 2F1RA 2I1QA 2QA5A 4MH0R 3GLIE 1TUEA 2J1LA 4PAOA 4HUQB 4OJQA 1ZU5A 2D2FA 3GLFB 5CDFA 2BC9A 2OXRA 5IK2A 2OILA 1KK3A 1MRSA 1ZYUA 1OKKA 4D0LB 3KKNA 2IHBA 1UBCA 4Z54A 2VP9A 4Y0AA 3B85A 4R2HA 3QPVA 4HI0E 5EUMA 3VHLB 1E32A 3T1VA 1G8PA 2OBNA 2HF8A 1N0VC 2JJ1D 1OXSC 4JZKA 4FN5A 5TXGA 1Q12A 4GOXA 3ZQ6A 1GRNA 2YC2C 5FH9A 1XEWY 4DZZA 2DYKA 2GJAA 2EVWX 1N6HA 3RNLA 4HSEA 221PA 4TWZA 5UKDA 1XDBA 3U2QA 2FU5C 3RWOA 3WRYC 3X1YA 3A4LA 3UANA 1J2JA 1NIJA 1ZU4A 3BE4A 3MWKA 4EJSA 4B6EA 1XXHB 5FPYA 3EZ7A 5KSOA 2QT1A 2VP5A 4WZ6A 3QEOA 1E9FA 3EC2A 1JAIA 4NCJA 4BE7B 4GMXA 2VPPA 3T06B 1YJ5A 1WF3A 1E9BA 1YVDA 2XJ9A 1G5RA 2OEPA 5F3WB 2ZRPA 3EIHA 2QTFA 3KUCA 1Z6YA 3I5XA 2EYUA 3S1AA 3ONWA 2J0VA 3KJIA 1KSHA 2OFWA 1ZCBA 3IPXA 1W0JD 5C4MA 2WJHA 1TF5A 3L43A 2HV8A 3EZFA 1L4YA 1OH8A 4XTRA 1KK1A 1P62B 1TQ2A 2GZDA 2PX3A 5EP4A 4PQFA 1CULC 4BLTA 2Q9CA 3P26A 3BH7A 2GBLC 3REGA 1II0A 2FFHA 3BERA 5EXTA 1YQTA 2BMFA 2WMNB 2IF2A 3SDZA 3WHKA 4OHYA 4LHVA 3AVXA 2C95A 3NKVA 3E2IA 3T1QA 3D3QA 1Y63A 4W5WA 621PA 1GTVA 4JKIA 2AK3A 4PSAA 1G6HA 1I4TD 4P32A 4Q9LA 1KZGB 2VRWA 4PR0A 3L0PA 3DZ8A 4JVMA 1TNDA 4GT1A 3SI7A 2F1IA 2IYTA 1NJFA 2C9YA 4QBFA 4Q01A 2CHQA 2F7SA 1JXMA 4RFVA 2DFNA 2ATVA 4RFSB 2CL6X 2R65A 4TN1A 5JS8A 1SKYB 2RAPA 2OCAA 2GA8A 4NU0A 4NYIR 4US1R 3UXMA 4PSKA 1XJCA 1X1RA 2NPIA 1EWQA 1JPJA 1WB9A 4M1MA 1N6OA 3TUJC 2ZYVX 2XOKA 5LPNA 2MSEB 1II8A 2UZ3A 2QNRA 1VPLA 5HPYB 1YR6A 2D4HA 2Q6TA 3WMGA 1XEXB 3HDTA 4EUNA 5KSPA 5C18A 3HR8A 1U8ZA 1R0ZA 2D7CA 2FF7A 4IFBA 4NYIQ 4DT1B 4NCKA 1JJVA 1E0KA 2C9OA 1ONBA 2PZEA 3KZ1E 4IOJA 2WAYA 4ASUD 3EPJA 4MKGA 1FQJA 2GCNA 2OCBA 4KVGA 1SVWA 1J8MF 3B2EA 2B92A 4ZKEA 1E1QD 1MT0A 2YHSA 1E9RA 1R5OA 3I8XA 2QI9C 1NKSA 2ZS8A 3KJEA 2GJ9A 3HYTA 1QHSA 4H1UA 4DVGA 1OXXK 2VO1A 5DLQC 1RVDA 2IC5A 4A0GA 5EXPA 2EWVA 3PEWA 1QHYA 3PEVA 3V9PA 1Q20A 2FPLA 4WA7A 4ESHA 4QHTA 2WTUA 1Z3IX 4FMBB 4NYMR 2DWQA 2WZQA 5JBQA 4B3DA 4TTRA 1ZUHA 4JLVA 3GLFA 1Z0AA 4N1AA 1N5JA 4K81B 3ND8A 1F5NA 1GFIA 4YMVA 3NTUA 2ZJ5A 1JR3E 2HDNB 4LV6A 3TAUA 1ZP6A 2XX3A 1NVXQ 3GJ3A 1G5PA 3SU8A 4HB2A 5L3VA 3UK6A 2OUKA 4G5QA 4WIAA 1F60A 2NIPA 3LLMA 1CRPA 1QZXA 4M22A 3KXKA 2G9NA 5JMTA 1S4QA 2GZHA 3OIUA 1T0JB 1G8HA 3B8HA 2W0SA 4MQBA 2FSGA 2GCPA 4ZO4A 4LYFA 1VCNA 4MRNA 4B34A 2FOLA 5A5GA 1U99A 4N3NA 3OEEA 1FMJA 5DYIA 4FIDA 5HTKA 3I5YA 2R2AA 3R9IA 5HKKA 2H18A 2QGNA 3LO5A 4X8HA 2QTHA 1OV4A 3IQWA 1XTQA 4IXMA 3VX3A 4URZR 4DCNA 2ZYUX 3FVQA 4PXAA 4R9UC 4F4JA 4L15A 4DIDA 4TYYA 1Q1BA 1QHXA 1OH5A 5J4VA 5JI2E 3IBYA 2J0QA 1TL7C 1VIYA 2FH5B 2V7QD 4N0EA 2OCYC 4B35A 1E0AA 2W6ID 4KYUA 1RRGA 2NO1A 2GHIA 3LW7A 4A0FA 3AVOA 1EFUA 2A5YB 3KUDA 2BMJA 2ZRKA 3GJ4A 1WQ1R 1AKYA 1P75A 4I4LA 4QM7A 1IBRA 4QBHA 1D2EA 1H65A 2F9LA 3ICEA 4UNPA 3CUEF 3TIFA 4WZBE 4QJ3A 1ZM9A 2RGGA 1G7CA 4DHEA 5J4YA 2V3CC 2V9PA 2XNDD 2JJ8A 3V4RA 4R98A 2IYZA 4YMTA 4OHWA 3KKQA 4R7ZA 1GL9B 4BFSA 4KFRA 4Q1CA 1NMXA 2QM8A 4P4SB 1LF5A 2IYRA 2HXYA 4K8OA 3B78A 4DSUA 2XTZA 3JVUA 5FOVA 2OAQ1 2UKDA 3SYNA 2ZRDA 4RFSA 2GVDC 4JLMA 3OIYA 2FZLA 1VTKA 3B9PA 3MAAC 2VHQA 5DYGA 4G5GA 2GF9A 3ZS9A 1KSFX 3LQQA 1GDDA 4RKEA 3AF4A 4AKEA 3I4LA 1G291 2BBTA 4A0HA 3PCRB 1AN0A 1W49A 2PL3A 1P4SA 2QMUA 1OIWA 1XEXA 3GFOA 4PHTA 4Q47A 4UJ5A 5AJVB 2L0XA 1EGAA 3QEJA 4WZAE 5FTNA 1IHUA 3CKLA 1Z83A 5FBRB 2XXAB 3G0HA 1W0KD 2GESA 5BYKA 1OSNA 4GZMA 1AS3A 4HLUA 5JJKA 3VR1A 4P0TA 3TE6A 2REOA 2QBYA 5HE8A 1J70A 1LS1A 4CW7A 1W5TA 2P0EA 2EQBA 1SVLA 2YNMA 3EIQA 1PUIA 3IEUA 5FUWA 1JQLB 2XZLA 4R71A 2ZRLA 3L0OA 1TU4A 2ZREA 4LC1A 2E9SA 2ASEA 4UXHA 5E7IA 1VDZA 2ZRJA 3C5HA 2ZUBA 1NF3A 3AV0B 2ONJA 4DCTA 4B3FX 1IXSB 3NEYA 4RCZA 1OFIA 1F6BA 4M1WA 4KJZA 3T12A 5B64A 2Q9BA 2PEYA 1TF7A 3NEJA 2GXAA 1U0LA 4TYQA 2XSZD 4YC7A 5P21A 4Q1DA 4TQAA 1I4DD 3KKMA 4P33A 4DCVA 3R7WB 1XX6A 2AD5A 2J87A 4M4SA 2F9MA 4EPXA 2C78A 3RYTC 4QBIA 3A1TA 4DBLC 4RZ2A 3ND9A 2RCNA 4C0HA 2ZYWX 1MKYA 2F6RA 3Q5EA 4L16A 2W83A 3W3AA 4UXIA 2A5FA 1W44A 1PZNA 2GJ8A 3EWAA 3NWJA 4NL4H 2WICA 3WBKA 3SYLA 2W6JA 1I4LD 5LD2C 4ILEA 2CVHA 3HPQA 1P72A 4OK6A 4J0QA 5CYOA 2C2HA 5IHPA 2UVQA 2YZ2A 4IEIA 4LV5B 4EPVA 2JATA 1ZC3A 3AVPA 4I1OA 2VL7A 3A8TA 2W2TA 4IOLA 1U0HC 4Q1EA 4D0GA 5DE3A 2NOAA 1AGRA 3O8RA 4EPRA 2CVFA 1XWIA 4ZDKA 3UIEA 1ZW6A 3MJHA 3MUFA 4A2QA 3GLGB 5FPKA 3WYGA 5KO2A 1JEDA 3TKLA 5TY0A 2PLFA 3QG5A 2VIIA 3MRSA 4LJ7A 1YHNA 1LVGA 1NRJB 1XD2B 4OYHA 1EFRD 1FZQA 4URWR 1P5ZB 4C2TA 4Q7KA 4PPNA 4A8JB 1GKUB 1SVSA 2J7PA 1E2QA 1OE0A 3IILA 1TF2A 4Q00A 3OE7A 1HYQA 4LPSA 3W6OA 2C98A 2PZGA 2IHYA 4L9WA 3VR4A 2CJWA 2Q3HA 1UFQA 1XBTA 2WIAA 3CZQA 1BYUA 2NO9A 1JR6A 2GETA 3IIKA 3PITA 1KJYA 3GQBA 3TNFA 1XMSA 1Z2AA 1GL7A 3X1ZA 5FTLA 1IXRC 1LY1A 1NJGA 4Q9JA 1EFTA 2A30A 2I3BA 2ZR9A 3K70D 1MOZA 1GITA 2IXFA 4ZDWA 4XSGA 3BH6A 5SZHB 5BW8A 2EFGA 3BBPA 3L2OB 3R9XA 1Z07A 1M7BA 1FP7A 4URVR 1ETUA 4Q7LA 1KI7A 4ARZB 2RHDA 5FUYA 3I61A 1CIPA 4ZKDA 3A1UA 2H8KA 4U02A 1J8YF 3BC1A 4KLZA 1UBEA 1VMAA 2ZJ8A 3U7FB 2X77A 4BASA 4JSYA 3WNCA 3WRXC 2F3TA 2XXAA 1G4UR 2FSIA 5KDDA 1DAFA 3PIRA 1NNEA 1XEWX 2ZVQX 3PUWA 1E79A 1G7TA 2UZIR 1OW3B 4A2WA 5GJBA 2W0MA 3K9HA 3K0CA 1CEEA 2YJTD 3RS5A 3K8YA 3SJCA 4CIDA 1X3SA 1E9AA 1UKVY 3HPRA 3BB3A 4UKDA 5J4HA 3Q7PA 3GJ5A 5LB2A 1ZNYA 1UAAA 1UKZA 1SVMA 2Z5FA 4MDFA 3A1VA 2G0TA 2V1XA 3TVDA 4NMMA 1T8TA 3PUVA 1KOFA 2RGCA 1KI3A 2R6FA 4M53A 4LC0A 1WRBA 4C0KA 3LW8A 1QHHA 2OFXA 1F48A 1KI4A 2IEYA 2BWJA 2ZRMA 3ZLJA 4FCVA 5J5CA 4Q66C 1Z8FA 2P2LA 2GDJA 2VEDA 5TVKA 4DLYA 5IK2D 1NN5A 3PEUA 1AZTA 2FA9A 4DIEA 3R7WA 3E70C 2JEOA 1OKKD 3FDIA 1GNPA 1YZTA 4QXAA 4UQOA 4Q18A 5TB5A 1E2IA 3QVUA 1IN5A 4OBEA 1XPUA 4C7OB 3RHFA 4HB3A 2ZIAA 4Z8YA 4BUJA 2WSMA 3T1OA 3VKGA 5F98A 1GOTA 2PT7A 3QF4B 3QNUA 3GLGE 1XJ0A 4FD2A 4PQYA 1R0XA 4M1KA 1AA9A 1Q44A 5B2ZA 5B57C 4LUCA 4HDQB 3LX5A 4V0KA 4HAZA 1OIVA 3B1VA 5JECA 5DO9A 4TSFA 4CEIB 1U90A 3RABA 1E2KA 2VBCA 4KO8A 3V00A 2VP6A 4FWTA 1RRCA 3IPYA 3KQKA 3P1JA 1SXJD 5HE9A 2RGAA 3CX8A 3B82A 4ZIRA 2VTKA 1E2DA 1HV8A 3JVVA 1T8UA 3I92A 1KO4A 3GLGA 4WW0A 1WBDA 3QKTA 4QC2A 1AZSC 3GLIB 3NHAA 4PC7A 3QE0A 2ZJYA 3H2YA 1XD2A 1NBMA 3MSXA 4OQXA 3UMRA 1RIFA 1OH6A 5FL7A 3DOFA 4LYJA 5FUXA 4A8JA 3PQCA 3F8TA 1UBFA 4LBYA 3SZRA 2QM7A 2OLJA 1SQ5A 1IM2A 3FKSA 4LHWA 3NDBB 5CM8B 3VAAA 2Y8EA 2EYQA 3S1AB 4K46A 3SN6A 3U6BA 2FN4A 1NN1A 3BH0A 4TTPA 4B43A 1G16A 3K9LA 1P2VA 1Z08A 4F91B 1G8GA 4G5OA 4AKGA 5ANRB 1W46A 3FYHA 1DS6A 1ZD1A 2QORA 4JKYA 2VP4A 2ZS7A 3CM0A 3ETLA 1D8TA 3W34A 4WOPA 4BZXA 1J7KA 1SULA 1XCMA 5KNDA 3K70C 2WIBA 1E2GA 4B3BA 1LB1B 1Q57A 1TUIA 3WY9A 4DCSA 2ZJOA 1XRJA 3IO3A 5FOTA 4IW3B 2HXSA 3NXSA 3MWLA 3D8BA 4PHGA 4B76A 1TADA 4FINA 2I4IA 3AKEA 2HYIC 4OQFA 1FW6A 4CEJA 2XOKD 4XVUA 1OB5A 3QJYA 4RZXA 1TQ6A 5FBQB 3U7HB 3DM5A 5AUNB 1NVUQ 3Q9LA 3PXGA 4BFVA 2F55A 2KJQA 5L8VA 4KSBA 1NN0A 4NZYA 3LBHA 2AWNA 3QY0A 3DKPA 4FMCF 3FHCB 1P61B 2IEZA 2KE5A 2DHRA 3DPUA 3F5FA 4D6PA 1P2SA 1P6XA 1VCIA 4MGIR 1FQKA 3M0EA 1G4AE 1W4RA 2OBMA 1KKLA 2X19A 1X8JA 2RMKA 3EPKA 2VHJA 2QZ4A 8OHMA 2DCUA 1YE8A 5F9HA 4MDEA 3T61A 5CIQA 4M2LA 1NLZA 3SFZA 4LJ4A 4DDUA 2YOHA 1G3UA 1IQPA 1IXZA 2ZI9A 5G53C 3M6AA 1EG7A 2F1HA 1ZUIA 2ZRCA 4CYMA 4PPQA 4AY2A 2FNAA 3U4QB 1E3MA 1RYHA 4L9SA 3CZPA 3QSYA 4II7A 1FTSA 4B2LA 2GEUA 3MWYW 3MWJA 4BLRA 4QM6A 3TQCA 3W8RA 3ADBA 3DM9B 2J3EA 3SBDA 1XU4A 2FFQA 3AF0A 2ZRFA 4A92A 3Q85A 4EPWA 1Z06A 3AKCA 121PA 1ZVQA 4FCTA 4OQMA 4C7OA 2WKQA 3EAQA 5AJYA 3CWZA 4GPTA 3UMFA 1W5SA 4L4UA 2R6CA 1TTTA 3QF4A 4JLOA 3EC1A 3E5HA 4KSCA 1Q1ZA 1G20E 3IKJA 2D62A 2G6BA 4IVRA 5BN5A 3EW9A 1KMHB 1U98A 3WBJA 5J4KA 3CRVA 3JZAA 2EFDB 4CEIA 2OBLA 1HE8B 1I2MA 1TAGA 4QNRA 1W47A 2C8VA 1G6OA 1O3YA 3VU9A 3QXJA 3MG9A 3OEED 3QBVA 4EJSC 1NG9A 2ZSAA 5BXQC 4RD6A 5EP2A 2QG6A 1Z22A 2F1JA 4Q7MB 4DUGA 2ZAOA 2ZR7A 1G7RA 1SXJC 2ATXA 4IFEA 1M8PA 3FMOB 4QGHA 3LX8A 3I1FA 4JL5A 3HU2A 1AK2A 4DEXA 4E03A 3TQFA 3BORA 2JJ2A 3GLIA 4GBMA 2IWHA 1RE0A 2KB0A 3B1ZA 3AVVA 1EX7A 2OFOA 2GAOA 2WPDA 4NTZA 2ZRGA 1Q1QA 5CITA 5JS7A 3TSOA 4Q19A 2IYVA 1E9SA 2ODNA 2ZRAA 4GFDA 2BVNA 3E1SA 2ZQ5A 3NIBA 4B71A 3U3OA 1LTQA 3FMFA 2OAP1 3TW8B 3HR7A 2JDIA 3TUZC 1OH7A 1D2MA 3PEYA 5K8LA 3WMFA 3QBTA 3C41J 5DIFA 5FI1B 4US2R 4JSTA 1KNXA 2V6IA 4OJKA 3ZQJA 1FUKA 4F38A 2JAQA 1AKEA 3R8FA 3KQHA 3BGWA 3CRRA 4TYNA 1L4UA 4HZUA 4B73A 1R4AA 1D6JA 1QF9A 2ZU0C 1N5IA 1TQ4A 2QMEA 3BFXA 4GOKA 3PENA 2QPOA 3U5ZB 4NCHA 3VKHA 2HCJB 1NL3A 1BKDR 4TQUS 3C4JA 1WXQA 3CF0A 4EIWA 3FMIA 3LVRE 4MYTA 4US0R 2BMDA 3BK7A 4LWZA 1T5LA 1F2TB 1G21E 2J0SA 2PEZA 1G41A 2JCSA 1OLOA 4X8LA 3VKWA 3KB1A 5BQ5A 2B7BA 2O8EA 1G8FA 3OIVA 1ANKA 3CF2A 1C9KA 4BLOA 4BWYA 4Q4AB 1M34E 3KXIA 1CR2A 5BYJA 1DAMA 1R6BX 4B32A 4EKDA 1VG0B 4ZI2A 4TZ6A 2IF0A 4GOJA 4M9XA 3H0KA 4V03A 2NPFA 5JWOA 3OF5A 3VQTA 4B33A 4QGFA 1OXUA 3C5CA 3ZGXA 1AIPA 1KAGA 2D7DA 3U4QA 3IIJA 2IT1A 5FFMA 1ESMA 3H4MA 1N3BA 1P2UA 2O8BB 1D9XA 3CONA 2V4ZA 3BRWD 4WAUA 1IN6A 5AK0A 2QBYB 3SJBA 2CE2X 1E2HA 4BEBA 3JZMA 1GSIA 3CR8A 5JHHB 5JJIA 1PLKA 2IYLD 4YDSA 5LB4A 2AK2A 1UBGA 3QPUA 5EXSA 4HAYA 1E4VA 5C2JB 1HA3A 3A6PC 2DFLA 4C0JA 4DEYA 5FUVA 1OYWA 4D2IA 4YLGA 1TEXA 3W6NA 2ZAMA 3BD9A 5BN3A 2WM9B 4IOKA 5E4FA 2WJJA 1KMHA 3A37A 1WP9A 2D3WA 521PA 3VMFA 4Z51A 3CNNA 3KTAA 2W6JD 3IHLA 4D4MA 4IJMA 5KSYA 4PO9A 1NN3A 1W48A 1Z0DA 4RKFA 4P4TA 5EE5B 2QE7A 4PX9A 4BFXA 2LCFA 5JWRA 3SR0A 4DLTA 1W4AA 3P4YA 1R8QA 4LBZA 3SNHA 5FOUA 4NYMQ 5KDLA 3U3RA 2ZU6A 3VR2A 2AXNA 2IW3A 2GJKA 2IS2A 1CF4A 2V54A 1WA5A 2GEDA 2KBEA 4QL3A 2CNWA 4OI1A 4RJLA 4AYXA 4RCYA 1N5KA 1G9XA 1DE0A 2JA1A 2JLRA 3B9QA 3QXCA 2YKGA 2WVJA 4TMVA 3K0SA 4BLSA 3SQWA 3KJHA 1ZM2A 4GP7A 3UPUA 4KBGA 4Q48A 2NGRA 2FPMA 2C99A 2VF7A 5HCIA 2XTNA 5DNYB 4BFZA 2V55B 2J7PD 2WMOB 1JR3A 1NVWQ 4XJXA 3VR5A 5JRJA 3OE7D 1FMLA 4C0LA 1NSFA 2WWWA 4G5RA 3X1DA 2O0HA 3FE2A 1A4RA 2PJRA 4MGZR 5H8WA 1A82A 1EK0A 1Z6XA 4PHFA 4TTQA 2MMCA 2ORWA 1S9HA 2PMDA 3I73A 3SJAA 1N25A 3CR7A 4KFUA 5F9FA 1CR1A 4TLBA 3U44B 3BJIC 4DDWA 3EPLA 1OF1A 5H70A 2IBMA 4X8OA 3N2EA 3MGCA 2JJ1A 4B44A 4Q5IA 4ZCIA 4B2IA 3VNUA 2REXB 4PPGA 2CJWB 4EFMA 4BRWA 4AYWA 3K53A 5KUTA 1A5TA 1J90A 1JB1A 2BMEA 3CIOA 1G1MA 2Z4RA 3W3ZB 5JEEA 5FL3A 2G3YA 3LDAA 3FGNA 4JYCA 1GAJA 5J47A 1F2TA 4KV9A 1VYVA 2XEXA 4RD2A 1UJ2A 2ZXUA 2QUZA 5AJXA 2BIFA 4M8NE 3IHWA 1RKBA 1E79D 1ZJ6A 2CBZA 3AGPA 5AR1A 2V1UA 2QL6A 1KZ7B 4C9BA 2YWEA 3EIEA 2B6HA 3IBGA 4HLUC 2SHKA 2PJZA 1HTWA 4Q4AA 1VHTA 4RD0A 2FSFA 2HLDA 2QT0A 2F43B 4XD7A 3U6KA 3TK1A 3AKYA 1N5LA 4NKRA 3RWMB 5GADl 2YV5A 3PR1A 4DCUA 3BWDD 4FMDF 2PCJA 2CCGA 2P6NA 1Z29A 3NBYC 3BB4A 4C0BA 5EZ5A 1H8HA 5DSZA 4F4CA 2A5GA 4QGGA 5E95A 4JVLA 4LOAA 4HLCA 1W2GA 4YONB 1ZIPA 2V8OA 5L3QB 3U61B 1Z6TA 3CNLA 2O8BA 3WYFA 2ORVA 4AKHA 1A2BA 1S3SA 1CR4A 5KSZA 3KL4A 1IOZA 3DKVA 3QKSB 1VG1A 1OFHA 1T4GA 2ZJAA 4GI7A 3OIWA 4NCIA 5DH9A 2KBFA 1Z0KA 2XZPA 1NMZA 2CK3A 3LBIA 3K09A 3AVTA 1GIAA 1KTVA 3PUZA 2IUTA 2IYXA 2WJVA 4ABYA 821PA 3U3JA 1D5CA 5AUOB 3SE0A 1R8SA 5DI3A 1PLJA 2A7QA 4PC2A 4EFLA 4JBWA 1QHHB 3NHBA 1ZRHA 2J0UB 2IYYA 4M9QA 1SVKA 3QOFA 2OM2A 1R2QA 1RRPA 4LHZA 2ZI6A 5EP3A 2YOGA 3OAAA 4URYR 4XWKA 2CL7X 2LKDA 2E1RA 1N6IA 3EARA 1BS1A 4TSFD 1R5BA 1PV4A 1VCMA 2C9CA 1CJVC 4XSHA 1MR3F 1YZGA 4GMDA 4LZZA 2J46A 3T1TA 3OEHA 5FTJA 2ZSBA 2WWHA 3THOA 1O87A 1ESNA 4HDCA 3THXB 2W58A 1RPZA 3TLXA 2O52A 4DSNA 4NH0A 3TW4A 1OXTA 1WMSA 1UKEA 2H1LA 4PZYA 5JJLA 4QHYA 5FI0B 2W2XA 1HURA 4Q1BA 1COWA 3PFIA 2NO0A 1YZNA 1RFLA 2FZ4A 1NBMD 3EXAA 3GJ6A 3QENA 3IO5A 4I1VA 3MFYA 2WAXA 5FL7D 4OK5A 1H8EA 2V6JA 1U94A 3L8YA 3HP1A 3EA5A 2IYWA 2ZANA 4TT3A 2FFAA 1EFCA 4E09A 4P3YA 4RY2A 1AS2A 2QENA 2AKAB 3EWSA 4ZIRB 1HT2E 4PO8A 4A36A 1II9A 4IHQA 1MH1A 2G88A 1ZINA 2QQEA 5C4GB 4KODA 1Z47A 2K5UA 1Q21A 1KDOA 2QP4A 2Z43A 3K0FB 4DSOA 1S1CA 1UEJA 5FTMA 3GFPA 5FR2A 2FMXA 2RGDA 3U44A 2BDTA 1T0HB 3MCAA 4A1FA 2J5XA 2XTMA 1N6RA 3GJ0A 3THWB 2WWIA 1G17A 3CX6A 1KO1A 1W2HA 4TYWA 5IT5A 4MGYR 3EZ9A 5D3QA 2JLZA 3QKRB 1KI9A 2JIZA 5TDHA 3ZDQA 3TGPA 2O8FB 1CP2A 3ZZUA 4DB4A 1C4OA 4F93B 4NE2A 1S2MA 1E99A 2VYFA 2WSSA 5E3HA 1FP6A 1KDTA 2XZOA 4LK2A 2OLKA 3W5IA 4CGZA 4Q9IA 3TJZA 3BS4A 3DHWC 3SHWA 4F7WA 1Z28A 3BB1A 4U5XA 4OHVA 5G40A 2W00A 1PLLA 4TL8A 4DB2A 1E98A 5SZKB 4Q4JA 2F43A 2RB4A 2Q0HA 3K0CC 4KHZA 1X6VA 2HJGA 3CB4A 1K8RA 4CEJB 5DN6A 1F2UB 3CRQA 1E1RA 1Q1EA 3O8CA 2TMKA 1NP6A 2ERYA 2Z6VA 2QMHA 4YXWA 1XPRA 4Q1AA 1YRAA 2EU8A 4W7SA 2Z4SA 3ICQB 1SHZA 2G1KA 1NVVR 2AX4A 2ZEJA 1JECA 4AWXA 2QMOA 4C4PA 5L3QA 4ESVA 4JVNA 1XZPA 3SFVA 4Y0VA 1M2OB 5FOXA 3TVTA 5FBVB 4HAXA 2ODEA 1D2NA 5J40A 2PZFA 5G41A 3QKSA 2A3RA 1HT1E 4NDZA 1KHTA 1KJWA 3LD9A 3EG5A 4MKHA 1NVVQ 3CWQA 1DG3A 2GAAA 3I62A 2P6UA 2H5EA 1T91A 4KYIB 3AH8A 2J41A 4BFWA 1DAKA 5JEDA 4MRPA 1XTIA 4XH9B 3KXLA 1KIMA 1E9DA 4IVPA 2GXSA 3DVLA 1XTSA 4OI2A 2J0UA 5EUQB 1GRQA 2P65A 4POAA 2HUPA 4UXJA 1S0UA 4JBXA 4JMPA 4JLAA 5JHGB 4PPFA 4QHSA 4YMUA 1FNMA 2AL7A 2OT3B 2YINC 4JIMA 2VP0A 2QSYA 2P3SA 4V0ME 3LXRA 1E0SA 1U81A 1JI0A 1VKJA 3ZZ0A 4HLDA 3FOZA 4BPBA 2ZM5A 4BFUA 4PHHA 4V02A 3THXA 4DUGD 2FE4A 4TLCA 1GZSA 2IS6A 1JQJC 3LXXA 4GSYA 1W7AA 4ZPXA 2EW1A 3C7KA 4QKQA 2JJ2D 4RD4A 1XB2A 3GEHA 4KXFB 2G83A 2ZROA 4MYUA 1CR0A 2WPDD 2FWRA 1ZNXA 2XITA 3VU9B 1OT3A 3U7GA 1VECA 1Z2CA 2O0KA 4PC3A 4PSVA 1E2LA 3AUYA 4A8JC 3GPLA 4L5BA 3IEVA 1DELA 2NQ2C 3NC0C 5KDOA 1VG8A 3W90A 2JDID 1G3IA 1NLFA 4EQ6B 2WOJA 3SHFA 2H17A 3AP1A 3KQLA 4L8GA 1U2RA 3RLFA 1U9IA 2AXPA 4HAWA 2OXCA 2QPTA 3AF3A 3K0FA 3SEAA 4JLDA 2O8CB 1YR8A 2R9VA 1ZC4A 1QHGA 2DY1A 2WV9A 1YZKA 1W36B 3WP0A 2N46A 2J45A 3THWA 2P5SA 1MV5A 2QU8A 4Q02A 2BOVA 2ODWA 2RH5A 1CTQA 1GILA 1R0WA 3LWNA 3SOPA 1HE1C 2ZI5A 3QKRA 2GK6A 4M1TA 3D6TB 2O8FA 5IDVA 2ZITA 5CLLA 1L2TA 4NYJR 3LNCA 1ZBDA 1NI3A 4A4DA 1R10A 1ZAKA 1N0UA 5JLJA 2DPXA 4QNMA 5JZVA 4DLZA 3DOEA 3FMPB 3TUIC 2OESA 3VR6A 1XD8A 1G3RA 4EDHA 2IYQA 4HZUB 5CYPA 1FOEB 2QN6A 5ELXA 4MRSA 4RZUA 3ZVNA 4D4LA 2IUSA 2IWRA 4Q21A 1XTRA 1K5DA 1F2UA 2EFCB 4LRWA 1M74A 5FPTA 2HJVA 1XJQA 4N0DA 3TSWA 1RC8A 5BN4A 1YZQA 4JJZA 4CVNA 4JL8A 3TH5A 2AD1A 1T5IA 3QQ5A 1AGPA 1E6CA 2LWIA 4PO1A 1XCGB 5KHOC 3QG1A 1QG4A 2GJSA 2A2ZA 2ZI3A 4M9ZA 4PAMA 2JLVA 4QJ5A 1ELOA 2RGNA 1XZQA 2ZJ2A 3X1XA 3KKPA 4NBSA 5K8IA 2FPKA 3B13B 4AURA 2ZVPX 3UG6A 2O8EB 3LV8A 1CBUA 1DEKA 1CKEA 3VHXA 4ZI3A 4A6PA 3R9WA 2CMKA 2VSXA 1G19A 1ZD9A 2R8RA 2AHOA 2QROA 5AUPB 3OESA 4S35A 2PH1A 1KMQA 2AR7A 4KAXA 3QXXA 4O2RA 4CRWB 2Q9AA 2VH5R 2IA5A 1FPMA 3RAPR 2HT1A 1MRNA 2VF8A 4FMDB 4TMKA 1OHHA 4XVQA 1KDPA 1ZIOA 4MGKR 5CB8A 1TQDA 4TLAA 4C0QC 3TR5A 2OG2A 4Q4LA 4C0SA 3BFKA 1A2KC 5TV2A 1NKTA 2FG5A 1T3LA 3B60A 2BKUA 3SJZA 1A7JA 3AGQA 2QRZA 2IX3A 721PA 1LV7A 4MUAA 3HYRA 2QE7D 3QUSA 5C46F 4TMTA 4E5UA 1KJZA 1YKSA 2QAGA 4M0LA 2FEOA 2KI5A 3MJRA 4GP6A 1Z63A 1ZMXA 3UKDA 3QIAA 4DDTA 3GEIA 2R44A 3A1WA 1W1WA 4AI6A 2WKPA 4PZLA 1IN7A 1QBKC 4ZDJA 3SS8A 4D81A 2XB2A 1OFTA 4EPYA 5CDFE 4LY6A 1BMFA 2I1VB 5CJPA 2Q21A 2CNWD 1GKYA 3B1WA 1W4CA 3KTAB 2E87A 4B74A 4IKEA 4TMZA 1GM5A 1AQYA 4PANA 3THYB 4TQ9A 5CM9C 4D25A 2R6GA 4OHXA 2B8WA 1QHNA 5DISB 1Z0FA 2RKOA 3O47A 4DJTA 1EX6A 3M1IA 4C2UA 1U8AA 4F4IA 2R6DA 5B58C 1CJKC 1JR3D 5HKKD 2WJGA 3KX2A 5HZKA 3CLVA 1E2NA 2VA8A 3CW2A 4UNQA 4Z1MA 4Q9HA 4O0MA 1DAHA 3OFNA 4IEEA 1U8YA 1YR9A 1E94E 4EQ6A 2VP2A 2QY9A 3AVUA 5KTYA 1QVRA 3T5GA 1Q22A 1L7VC 4BGDA 1KY3A 4DWJA 2O8CA 1KO8A 1US8B 1ZCAA 4FXPA 4O3MA 1DVRA 2JLQA 3GLHE 1KY2A 2A5DA 2OZEA 2RGEA 1SXJE 3GJ8A 2JLWA 1TX4B 1MO5A 3NG1A 2BM1A 3I8SA 4LX0A 1LF0A 5EXXA 2FSHA 2P67A 2P5TB 3DMNA 1VCOA 1SVIA 1GUAA 2C77A 1CLUA 3CO5A 2WWGA 1YRBA 2KSQA 4CEHB 2DWOA 1P9NA 2ZTSA 1GNRA 4IDHA 4W5HA 4AC9A 2FGKA 2Z0MA 3GJ7A 4OQLA 4QGAA 4URUR 5KNBA 3RSLA 3LRPA 3EX7C 2DWPA 2BBOA 5H68A 4A15A 5H1YA 4A0RA 4DRZA 1CS4C 3H84A 1KNQA 3GLHA 1JEEA 3PG5A 1SXJA 3T5DA 4TLDA 4JL6A 1CXZA 5FOWA 4LYHA 4LSGA 4DKXA 1NSTA 1PUJA 3QVVA 1R0YA 1P7CA 3HU3A 4FCWA 4G01B 2HLDD 1ZNZA 3SC3A 4XD7D 4MITA 3WNBA 1EESA 4AG5A 3RVBA 4XWOA 3N2IA 3GP8A 1ZM4A 3H86A 1H8HD 3BFVA 1IN8A 3I32A 4PC1A 3U3MA 4BFYA 3R20A 4TZ0A 1P73A 3KFVA 3G5UA 2RGXA 4LJ6A 4BZQA 5AJWA 4AK9A 1DPFA 2WWXA 2CL0X 1LW7A 1CJUC 2ANBA 4LHXA 3VNVA 2GXUA 4CT4B 2QP3A 2CK3D 2IL1A 4DLVA 2EWWA 2GBLA 3FFBA 1KI8A 2ZR0A 1UM8A 3FHOA 4TL7A 6Q21A 1E96A 1GG2A 3RRMA 1Z6AA 1IN4A 3Q5DA 2D2EA 2HEIA 1DO2A 2GRJA 2ZRIA 5B30A 2PLRA 4E22A 5L3SB 3F0TA 4O2LA 1D9ZA 1GRRA 1N0WA 3GD7A 2EFEB 4HAVA 1N2CE 3NH6A 3RRYA 4AIIA 2BEKA 1KI1A 1S9DA 2CLCX 4MA4A 2AFIE 3OAAD 4D0NA 1WDTA 3WMEA 2D74A 2OO7A 1ZM7A 3RRZA 3AP3A 5G3YA 2IS4A 1GVNB 2ZPTX 1HQYE 5CJ2A 3X2SA 2BBWA 2NZJA 3OEHD 4AYTA 5KU1A 1RJ9B 2CE7A 4DSTA 5GJWC 5C1BA 2J59A 2IK8A 4PZZA 3KQNA 5DI3B 2ZSDA 1S96A 3L8ZA 4G5SA 4A2PA 4TMWA 3GLFE 4HB4A 3G82C 3HWSA 5DHFA 4ZDIA 1IJFA 4HEJA 4D80A 4NHOA 1MO6A 3REFA 1M1YE 1JNYA 4CDGA 1P3JA 1ZNWA 4XVRA 3PUXA 2GWHA 3THYA 1COWD 2J9RA 2VSFA 4KITB 1N6PA 1BOFA 4M9SA 4LJAA 1B23P 2QSZA 4IDOA 4JJKA 4PAQA 4TYPA 1YZLA 1H8ED 4MRVA 5EE3A 5EZ6B 5JRZA 4R2IA 4JBYA 1TEVA 1YU9A 3C8UA 1X8KA 4TT3D 3ZIAA 3OZXA 5K8TA 2EFHB 1P2TA 1Q3HA 5GVRA 2BV3A 2GK7A 4GZLA 2N1BA 4HUQA 3BOSA 4DLXA 1IY2A 2FV8A 1KO5A 1XXHE 3RC8A 4IXNA 3TMKA 3VFDA 4JT4A 1US8A 3O8DA 4JLJA 1Z0IA 3CNOA 4DDVA 1LNZA 2XGJA 3AVWA 3DO6A 3W6PA 1T3HA 5J4LA 1B0UA 3ZS8A 3AF1A 5EE1A 4H9GA 1RYFA 4XTCS 5SZIA 3SBEA 2C04A 3CRW1 3H1TA 3SYKA 4B2PA 5TMPA 1AM4D 2NO6A 3WHLA 4KBFA 2LKCA 3LLUA 4CEHA 4V0OA 1N6LA 4MRRA 4RSGA 2BEJA 2JIZD 2ZRBA 1EXMA 1DAEA 3QF7A 4KCGA 3FTQA 2PMKA 3PV0A 3A4NA 5EE9A 1XXHA 3VTKA 2PBRA 2CCKA 2WSSD 4OL0A 1XTJA 3RS4A 1EWRA 4QOSA 1N6KA 3ZVLA 3P32A 4HZIA 2ZI4A 4JLPA 5CIWA 5A0FA 4LCBA 5FOSA 1WBBA 2ZE5A 5E7JA 3ZVRA 4UNRA 3LVQE 3KFXA 4FI3C 1WCV1 3IQXA 4JVSB 4NCNA 4B75A 3M4YA 5LD2B 4V0NA 4DLWA 5DN6D 4HLQB 5FPHA 1E1RD 2QRNA 3Q72A 4HAUA 3RDPA 4GRAA 2FFBA 2A9KA 2GEVA 3AB3A 3C14C 4QBGB 5IF9A 3BXZA 4RD1A 3FWYA 4YXWD 4B3GA 4S2EA 2XJ4A 3O8BA 1E2FA 1SKYE 2IYSA 4GDFA 3VR3A 1U0JA 4BQSA 1NMYA 5KNCA 1KYIA 5FR1A 3KQUA 5GJVC 2YWFA 5LBIA 2W2VA 1LS6A 2GNOA 1JXOA 3I72A 1KDRA 2YVUA 2GXQA 1JAHA 3T15A 4JS0A 1IAQA 3QXHA 5DHAA 4U00A 3P20A 4LJ5A 4FW9A 1T6NA 4Q4JB 1KI6B 2QQ0A 2OHFA 5K8UA 1W0JA 5HZHA 1M7GA 1SKQA 4W9MC 1BO6A 3RC3A 4LJYA 4LPKA 5EP1A 4LHYA 3QKUA 2AWOA 4BLQA 1CJTC 3EA0A 1BYIA 4CF7A 1DTSA 3K09C 1Z5ZA 3GEEA 2YYZA 1ZD8A 2VHUA 4M1SA 3FHTA 1GL6A 2O8DB 2NG1A 5L3SA 5IRCD 1DARA 1I2DA 4FMCB 3RSOA 3TAHA 4KU4A 2MSDB 3LQRA 3CPHA 3R8CA 1KGDA 4IOMA 3T34A 2Z83A 3U3KA 1SVOA 1AQUA 2WBLC 1JBKA 1QVAA 2REBA 2JLYA 1J99A 2VHTA 1XCPA 3ASYA 4QG7A 1EFHA 3CPJB 4OK3A 3K9NA 5JCPA 2QEQA 1RJ9A 1G7SA 2VSOA 4DT1A 4WVFA 1CRQA 2JLSA 1BIFA 1S8FA 4D4KA 5JSZB 1HEIA 4KFSA 4OI0A 2ANCA 2ZYTX 1R5NA 2CHVA 4DLUA 4FWIB 4Q1FA 3AVQA 5DI9A 3X1WA 4HYYA 2ZETA 4Q03A 1KI2A 4JLNA 4A82A 2JLXA 1E69A 3AEZA 3K0EA 3CPEA 1NLYA 3LY5A 4C30A 3RS2A 1NY6A 2F3RA 2PCLA 3ECCA 1E2EA 4Q4HB 4A9AA 4QJ4A 4DXAA 1L8QA 5KOYA 5KYKA 1X86B 3TRFA 4ASUA 2H92A 3DMDA 2OV2A 3UG7A 5EJEA 4MKIA 4LJ9A 4O25A 4ON9A 3L0IB 3B7GA 1E1QA 3C16C 3KJGA 3EZ6A 3ZH9B 3RRNA 1Z0JA 1G64A 3CBQA 3L0SA 1VIAA 4HATA 3EZ2A 4OI4A 2YC4C 2ZSEA 1M7HA 3LA6A 1HY3A 4ZCLA 3N5CA 3FKSD 1QDEA 4Z8XA 1XTKA 2QTVB 1HH4A 4MYCA 5LDDC 1R7RA 3RS0A 1CJMA 1DADA 3W8NA 3DZDA 2WKRA 2CDNA 1KKMA 2YWHA 1GP2A 4A6XA 1M6NA 4NONA 4LBVA 3WXMA 1FL9A 2WOOA 2NMVA 4B6FA 3CRMA 4U7DA 4XIGS 1UDWA 2VHCA 5JCZA 4NPHA 2JGNA 2QAJA 3WNDA 4ACAA 2JASA 1QRAA 4YMSA 2KWIA 1FNNA 3NC1C 2GVZC 1VYUA 3PJRA 2WJYA 2YWGA 5HCNA 3KKOA 1E2PA 1QG2A 2DBYA 2X8AA 4B48A 3ADCA 1XMVA 2CLSA 2YOFA 2CHGA 5A4JA 1P60A 1VG9B 4PFSA 1OXVA 4I81A 4BECA 3K1JA 3AKDA 1P9RA 5D3MB 4BLPA 4WXPA 3L82B 4HB0A 1T3SA 1XP8A 1YZUA 2J7KA 2NO7A 4GNKA 1KAOA 4OHZA 2WJIA 4G3XA 3HJNA 3ZYCA 4ZV4A 3Q3JB
chains in the Genus database with same CATH superfamily
1BVUA 1IRIA 3L4BA 1AKUA 4QLBA 3GBVA 5KOIA 3ZWXA 1U7DA 3UF0A 5B7QA 3ZDCA 2I71A 4GOOD 2XMCA 5BWMA 1J07A 3ILHA 3O26A 4KIUA 3GT4A 4NNJA 4UM8B 4NHEA 1Y3IA 1KI6A 1GQFA 1YOVB 5E1MA 4BQOA 5DOZA 5CB6A 1EGHA 3T5AA 4LDJA 1G3MA 2FMKA 1QE0A 3CSSA 4IDNA 2V7QA 4G67A 4LCEA 4LVNA 1VGQA 4P4SA 3WDMA 1ZUNB 3QWBA 1QWSA 1FTNA 5F4BA 2QTTA 5JDCA 3JXEA 3L7JA 4JT2A 5IYZA 2P6RA 3FI9A 4XWAA 2PV0A 1J49A 4CCSA 3QPBA 4LY0A 5DXFA 3RAJA 3EW7A 5IM4A 3EPHA 2O8DA 3TVYA 3MLEA 4L75A 1OHHD 1HO3A 2BHRA 2C9DA 3H1AA 3H42B 2KX7A 3QRWA 4Y6QA 3R3SA 1QRTA 1U3UA 3LT4A 1IUPA 4X7PA 5HDQA 1M76A 3BDVA 2P75A 1XWWA 4AJEA 4B3XA 1MDBA 1CS0A 3LH5A 1R16A 3MT9A 1GWNA 4YFYA 1C3LA 1Q1AA 3O3OB 1U2DA 2C0PA 4OEHA 4GD3Q 1CQIB 2QVZX 5G0SA 1JEOA 1FSFA 2X13A 2PGDA 5AYVA 4DMHA 4G0UA 4F86A 2Z5VA 5JPCA 5KOHA 1W85B 4QT4A 2WR8A 4QU5A 4TWAA 4II3A 3FAKA 3KWLA 1CT9A 2W2OA 2W2QA 4MUJA 4JEMA 3HO6A 3QEKA 3U7EB 4MPDA 4R2LA 3UAOA 3VZRA 3X43A 4QVIA 4M1YA 1VJTA 2WUDA 3I1YA 4TXNA 1KAEA 4E13A 2BZ1A 1EM8B 2I2WA 3A58B 3KK0A 5G0UA 4MKFA 3O38A 3GNTA 3R5KA 5TJ9A 4EHKA 2ZSFA 4RA9A 4D56A 4UW9A 1SAYA 3IMEA 4KPEC 1BMFD 4AS2A 3VJRA 3AHFA 4ZCMA 1MH9A 2Y0PA 4EO4A 3LBFA 5A6SB 5HUQA 5KYTA 4LBWA 4NDNE 4CBVA 4F85A 4B3RB 3HA7A 4QFMA 1UPUA 2C5HA 2PBZA 4FU0A 4QT0A 3W06A 1G8YA 1M83A 4BTEA 4LOJA 1DQZA 1FTWA 5CEFA 4TVKA 4JP5A 1P18A 4BTVA 1XL1A 5EY5B 3R74A 2Q6VA 2QGZA 4LTNA 5CT9A 2I6UA 2WHXA 5KUTA 4OKSA 4D3YA 4KIGA 2G17A 3E53A 3PJEA 5CLQA 4OBBA 1BXZA 2VNJA 3G0CA 1VYTA 1LK5A 3M6MD 3Q7QA 3R3VA 5AVQA 2FG6C 2HSGA 1YB1A 3QXSA 5FUMA 1EUCB 4ECAA 3TTSA 1E9EA 1NC1A 3I3OA 2WTBA 3BJZA 4MP3A 1Y9AA 2C5EA 2UUPA 2P5UA 2QP9X 3OMWA 3GMTA 3UMSA 1DI0A 1H3NA 5JFOA 1J9GA 2VPTA 1NQ5A 4KBYA 1Q0UA 4P86A 4DC9A 4RVOA 5TT0A 4ER6A 2M9MA 4XA8A 2X1VA 4FUTA 1SXPA 4Y1RB 2A5JA 4GEKA 2V96A 4LRYA 3KB2A 4KI0A 2Q8NA 4LZJA 5JH7B 1YR7A 3DF9A 4CTKA 4ZARA 2MR5A 4M36A 1E7QA 1V8FA 1GL3A 2ZE6A 4RQBA 1E4YA 3JQRA 4KGXA 4WCFB 1RWBA 1ZO8A 4YAOA 1CNFA 2XSZA 4IIHA 4I36A 1DTEA 4IRUB 2OCGA 3LFUA 2ODBA 1X1SA 4FZRA 2QVCA 3VSAA 1YRHA 4AKIA 2ZRHA 3LC0A 5KTSA 1HQCA 3WYDA 1H2RS 4Q39A 5THKA 1X7XA 1XZCA 1AS0A 4L50A 4XUCA 3A9SA 5IVKA 3GDOA 3KZMA 2BI8A 2BCGY 2C96A 3KVVA 3HFSA 3N2GA 5CW2A 3A26A 3T9DA 3TNLA 2OSBA 3MTIA 3PGXA 1R9JA 3R40A 3R6LA 4CI0B 2X2EA 3M89A 5HWSA 5BOSA 5D3MA 1H1TA 3O83A 3GEGA 1VE3A 3GGOA 4RD3A 2QNIA 2NTYC 4KLNA 4NC9A 3ZWBA 4EJSB 5K8JB 4LYGA 3S81A 4PIPA 3WYAA 1RKXA 2H7CA 1JDBC 1IQRA 4UPDA 4GL2A 3L6RA 4Q93A 2XDAA 3MUOA 1RQGA 1BD3A 2X6RA 5AKHA 1HLPA 1W73A 3TZKA 3PBKA 3ZHYA 1R3DA 1X7HA 1ZD2P 5SZJA 3E5RA 1C2TA 1PQUA 3LT0A 1KKUA 2FW1A 2VAMA 4MIYA 3J7AC 3DE3X 2VJCA 3NBZC 3N70A 2CCJA 3MYYA 3GGSA 1D4OA 3ICCA 3U1VA 1FU8A 4WI1A 3MJ4A 2H85A 1ILEA 3RSHA 5J2TB 1MF7A 1N6NA 3NBXX 2QMQA 3OIGA 1OIXA 2ERXA 3PFBA 5C5DA 1XUOA 1Q92A 1P8JA 4UASA 3DC2A 3IB6A 1CU1A 1SOMA 3NJ4A 5HW0A 3KSBC 1UBMS 4B79A 1FFWA 2REQB 4INPA 1TO2E 2AQIA 3WFIA 5JFGA 3HU1A 1R27A 1U9YA 4M9UA 4OHMA 5JCXA 1S3GA 5ERYA 2F1OA 1T1EA 1DT3A 1JFLA 1RAHA 2AOTB 1NU6A 3D7NA 3D9QX 2BSXA 3DDZX 3G3EA 4FHEA 2E4VA 4HMOA 1TPZA 4K6KA 4S12A 3WB2A 4ARZA 4BRUA 4ZI5A 3AVYA 1M67A 2XUZA 1MX1A 5ENZA 3UOGA 3AJ8A 4HDOB 2XKKA 1GR1A 5AW9A 5HKAA 4UNNA 1JG7A 3IV6A 3DUFB 4HUTA 5F33A 2DKNA 1IN1A 2H5IA 3JQ9A 3Q6NA 1ZVKA 2O2DA 4G1UC 4Q16A 4RY8A 4N6OA 5HHTA 1EM6A 4HDMB 4BKOA 2MMGA 4BIIA 4DQKA 4PNEA 3BCRA 3TO5A 2BKEA 1UT6A 2X0RA 2EFJA 2EP7A 3PTLA 4RZ3A 5ECWA 4CFSA 3PVSA 1OPXA 4D4JA 1UM9B 2FY8A 2BHLA 2Z9BA 3GRUA 3OOYA 1CIVA 1CUVA 3EQ7A 3P2JA 4MUFA 1HUQA 1RLMA 3KXPA 3BIFA 2FX3A 4R0VA 2Q1WA 1T6XA 1T26A 4RELA 5CDHA 3WL5A 2ZB8A 3I12A 4KO4S 4U9UA 1VDMA 1FSPA 3PJFA 4GPEA 2ORIA 1Q3TA 1K5GA 3FR8A 5ECYA 1ZJWA 4CZ2A 1ICEA 2GZAA 1SO8A 4ND5A 2CFTA 3F6PA 3REQA 4AZVA 2H31A 4CM8A 2WC1A 2XWSA 3FDZA 3FOBA 1VLHA 3S0JA 4YPVA 5JSHA 5LLDA 1YIDA 4Q7JB 5AXBA 3KDSE 5KPDA 2ZS9A 3K0AA 1AY0A 4QFDA 5TGDA 1P0MA 1BEUB 4WLOA 4W5JA 2E49A 3IKMB 4YRRA 2XYHA 3UT5A 1OJLA 1ZRMA 5WRFA 4BWVA 5JANA 4UBKA 4UJ3A 1SCQA 1X42A 2DFKB 3FXAA 4NVRA 1JXQA 3PZRA 4E5MA 1PVOA 1ORIA 2H57A 3FTFA 5B7NA 1PJRA 3NDIA 2QLNA 2XB4A 3OF3A 5J5VA 4F21A 2BKXA 2ZUCA 2YN0A 3IVMA 2O2EA 5ADUS 1MC8A 3P52A 3OQ1A 4IMPA 2AFHE 3UQYS 2YWBA 2ODTX 2AFIB 2ZZNA 3W2GA 2B8NA 5F2EA 4FE4A 1PX2A 3BAFA 4FYXA 2R1UA 2RH8A 1FS6A 1XIVA 2F3SA 3DONA 3KETA 3WA6A 3KWFA 1LFAA 5DW0A 1P1JA 3T3PB 3B1KA 4MS3A 2AE2A 1E8NA 2V45A 4EELA 2DLCX 5LN1A 3L07A 3GLIE 4OXQA 1TUEA 2J1LA 4OJQA 3D6FA 5EZYF 3GLFB 3FY4A 4DUZB 5CDFA 2OXRA 1I13A 3G0BA 4KQFA 4NATA 1KK3A 1OKKA 3DL7A 1XA0A 3FLBA 3KKNA 3W0LB 3LLVA 2I76A 4X66B 2GCGA 4HF7A 5E1OA 3QPVA 4HI0E 3PVCA 5EUMA 3T0FA 5FWAA 4OOFA 3WISA 1N0VC 3NFRA 4FN5A 5EG5A 1Q12A 5TXGA 3QELA 1AURA 1YJQA 2CN1A 2ZUWA 5C8YF 1ZRSA 1ZCZA 2P9CA 1PEKE 1SXHA 4KGZA 4IQFA 5F2NA 3X1KA 2AOVA 4KR0A 3CG4A 4QX6A 5UKDA 1E4OA 5I7HA 4Z9BA 1SG0A 3ZGNA 3A4LA 3OJ0A 1T6BY 1EQ2A 5TMBA 3U0VA 4MZXA 3BE4A 3MWKA 3ZHUA 1QFJA 1R12A 4EGAA 3VYTB 1G9TA 3C1AA 4FP9A 3A0RB 4UATA 4WFKA 4KQ1A 4B6EA 4EW2A 1L4KA 1E9FA 2JAHA 3ROMA 1JAIA 3G9XA 4BE7B 4J7CA 4TKZA 2B99A 1E9BA 1YZHA 2XJ9A 4MGHA 1G5RA 5BR7A 3FPKA 3KXDA 2A9OA 4EL0A 4GSLA 3GLGE 4EYSA 1Z6YA 3CC8A 2OCLA 5FLYA 4CDMA 4E21A 1NXOA 1D6MA 1I1HA 1KSHA 1UZLA 3E5MA 3LOUA 2WABA 1ZCBA 3IPXA 3VU3A 1NVMB 1SKMA 4F0JA 3L43A 1GSAA 5KTTA 3EG9B 5EINA 4P5PA 1KK1A 3HA5A 4R8MA 2GZDA 2PX3A 5EP4A 2GPNA 2PKQP 2Q9CA 3P26A 1GA4A 1IWBB 4W6QA 5MFPA 5JARA 2FFHA 3IULA 2OR3A 4EP1A 4R9SA 4CLEA 2A0WA 2L82A 2BMFA 1ZEJA 3SDZA 3JTEA 2JD1A 3NTRA 4F1JA 4LHVA 5AI8A 2C95A 3UWSA 4D8TA 3T1QA 1WMDA 4O2AA 4PHCA 3F1LA 3OPYA 4Y1EA 5E38A 4W5WA 1ECJA 2O6LA 3ETGA 4COOA 4DG5A 1EGVB 5EWJA 4KOEC 621PA 2XNHA 1SKBA 1ISSA 4JKIA 1I4EB 4GH5A 4K88A 1ORWA 2L19A 1G6HA 4PSAA 2C2YA 3HBFA 1DBQA 2BZ0A 2O57A 4P32A 1UQUA 2HC9A 4EHIA 3CFYA 4PR0A 3KEMA 2VDJA 1BJKA 2POQX 3MJDA 1H66A 1NJSA 5K2OA 3ANXA 4KXYA 5CX1A 1U4OA 2HOQA 2C9YA 1FFBA 2IYTA 5DXJA 4XUDA 5IJ0B 4DV6B 2DFNA 1WXHA 2ATVA 2CL6X 2Z9DA 2W98A 3Q6IA 4RFSB 3STWA 4EA6A 3ULKA 3DMGA 2HSZA 3WGQA 1HF3A 4FBMA 4A6EA 4US1R 1QVVA 1TM4E 3H7AA 1XJCA 2JGFA 3ELWA 4XUEA 5EMLA 2Q4TA 4B4KA 5G1PA 3TUJC 1N6OA 5BO5A 1DGQA 3GHYA 4CQJA 7AT1A 5CRIA 4YAFA 1AG9A 1M2HA 2UZ3A 4EARA 3O8LA 3OLCX 3LPMA 1GRVA 4L73A 4D44A 1RYYA 1OX6A 1QOPB 2BUCA 3HR8A 3UJ8A 1SEVA 3L01A 4J2HA 4LOHA 1ABEA 4EITA 5IN5A 1R0ZA 4IFBA 1XE3A 4DT1B 1JYEA 2DBQA 1JKJB 1K2VN 1JJVA 1E0KA 4HEQA 1FDTA 1XVAA 2II6A 1ONBA 2JHAA 1I6WA 2PZEA 4ASUD 4DMKA 4V1CA 4MKGA 1VYHA 4EKNB 3EPJA 3CE6A 2GCNA 2OCBA 3VJMA 3DHVA 3HVRA 4C7VA 3WSTA 2B92A 4ZKEA 4J0JA 3GA5A 2N3ZA 2XWQA 4Z4HA 4WFJA 1SELA 5H59A 1JLSA 3KJEA 4RV4A 4ZCTA 1TLLA 2ZIUB 2NO4A 4KIJA 1E20A 4CUZA 1TJYA 4FYHA 2ZWMA 1WMBA 3MUEA 3SR4A 5EXPA 2EWVA 4TS1A 5AJHA 1QHYA 5T3YA 2EZ9A 4WA7A 3IJ5A 4HD8A 4DS3A 2WTUA 1A9QA 3EGEA 5HQJA 1Z3IX 3UAZA 2VJAA 3GUYA 3I2HA 5E9JA 1JHUA 4C4TA 5JBQA 4HNTA 2RHCA 3HKDA 3V2IA 5KS2A 1ZUHA 4LCJA 3ZJ4A 5CDSA 4N1AA 3FTCA 1S7GA 9MHTA 3FPLA 2RHBA 4KKVA 3TTUA 4FHCA 4RTQA 3SKXA 1S2DA 1NUHA 1WUHS 1FDVA 3NTLA 2H29A 4KDCA 4GXTA 1JR3E 2JNWA 1QM5A 2R8BA 3L04A 4GS5A 1B0ZA 3IESA 4OSOA 3H75A 3OE1A 3QLVC 3PQ5A 4X60A 3RK0A 2XX3A 3WZ2A 4DAEA 5I6DA 3TTTA 5K9ZA 1PW7A 2ZG6A 1MJFA 4V0QA 1FYDA 3QVMA 5L3VA 1QH8B 4WIAA 5B53A 3ZYZA 1CRPA 4J7XA 1QZXA 4JCOA 2AXEA 1K5HA 2ZVJA 2GPJA 4DA0A 5AQEA 2QUJA 1G8HA 3B8HA 2W0SA 3OZEA 4IYRA 4MQBA 4MR9A 1W75A 2ZIGA 4CIBA 3F1KA 1JWAB 3TZEA 3KTDA 1VCNA 2HU8A 4LYFA 1VJ5A 2FOLA 4JENA 4ROSA 4MNTA 4CCWA 1AA6A 2FHSA 3OEEA 3OCZA 4OL9A 1D2RA 1ZGJA 3I1JA 4FIDA 4D9NA 1UEXC 2OQ2A 3F3SA 1K0UA 4UZFA 1TI7A 2H18A 2QGNA 1RQ2A 4CT0A 1OV4A 1PT5A 2G4VA 3GCWA 4HGQA 4URZR 1U2QA 3GZTB 5JI3E 4AWAA 3F3KA 4R9UC 4F4JA 4PFKA 4DIDA 2WWTA 3BD8A 3EGVA 3L46A 1EFPA 1HPLA 1Q1BA 5JI2E 3OQMA 1C3OA 1YUBA 1Y4UA 3KT3A 4Y6RA 4BQFA 4QICA 2OCYC 1LLQA 4HDRB 5IH3A 4B35A 4D9IA 1ENYA 3ZQ4A 4Z49A 3WGIA 1CJCA 1CUJA 1RS0A 3CUKA 4II2A 2A5YB 1KEEA 4FGZA 2NV6A 4J0HA 2X58A 1P75A 1L5HB 3OP1A 3PYLA 3GLKA 4QBHA 1A71A 1D2EA 1JFSA 4PCUA 3VZBA 4TOIA 4RHCA 3TIFA 1QO0A 5JNTA 1YCDA 1QAQA 4JD5A 5J4YA 3USZA 2V3CC 1NDQA 3T3OA 2XNDD 3BMOB 1DWUA 2PVPA 2Y9PB 2W4QA 2SNIE 3KKQA 5CP8A 3WYCA 4IMIB 4F97A 2WD7A 4BFSA 2QM8A 3R6DA 4P4SB 4K9PA 4DG9A 1MEOA 3NCHA 5AHKA 2HXYA 4RM3A 4MYSA 3T1HB 3RHTA 3U7RA 1MZVA 4CMIA 3LP6A 5SYAA 2L18A 5DYYA 3SYNA 3V42A 1J33A 2ZRDA 1SHJA 2GVDC 5FV4A 2CNKA 1Y1QA 3SX0A 3PXBA 5CLJA 1KYTA 3MAAC 1N78A 5DYGA 2O1SA 1L6RA 4G5GA 2Q50A 2GF9A 3ZS9A 4AQDA 1KSFX 2AW5A 3U4MA 1BU5A 3BICA 2X4DA 3JWGA 3QEMA 3ZCUA 3TIIA 3V8BA 3LL4A 2C8KA 1F1BA 4AKEA 4B82A 4QZVA 3UWMA 1SG6A 3BWMA 2BBTA 4A0HA 3QH4A 1W49A 3I05A 5EP3A 3S6JA 2Q1YA 1XEXA 5AJVB 4GE3A 3WGYA 3IALA 1YQEA 1VL0A 2YRWA 1CSEE 3IH5A 4E4TA 2B9VA 1G63A 1Q19A 4WZAE 4XDHA 5FTNA 1J2TA 1T9KA 2QG4A 1OYVA 1P3Y1 4F3CA 1T4DA 1QNLA 1W0KD 2IELA 1ABBA 1OSNA 4LYEA 2IY7A 2Z58A 4P0TA 1O94D 2VJQA 4F04A 2XQGA 3I0MA 1LS1A 3L06A 1SVLA 1H2WA 1RWOA 1PUIA 2BGTA 1CZOA 3EIQA 3IEUA 1DEAA 4E1AA 5CCEA 3ELUA 2DKOA 3HS3A 3I9JA 4M0KA 5EA2A 1P77A 1GU0A 1KS9A 4FC6A 5IANA 3L0OA 2V0NA 4RLQA 4WPGA 2GZSA 5BNTA 5ECDA 4L5YA 5ADHA 4BNUA 4UXHA 3LHDA 1MO2A 3C5HA 4BNFA 1NF3A 2P35A 3ELBA 4O08A 3PNYA 1IXSB 3TW0A 1OFIA 4LVCA 4ZAFA 2B2XA 1F6BA 1YCFA 4J0DA 1BWQA 4GXNA 4KJZA 4HV4A 3BRWA 1JQBA 1HE2A 5B64A 5KYWB 3PK0A 1SA0B 2DWUA 4YAKA 2GXAA 2XOEA 3IC5A 4TYQA 2FUNB 4B6OA 5JC1A 1VGRA 4TQAA 3L8HA 2QX8A 2J6HA 3KKMA 4DCVA 1CY4A 4G5FA 3M6FA 1J06A 4FZJA 4PVCA 2NU7A 4I08A 4N9QA 4UEWA 5LYJA 2E4WA 3ZU6A 3OO1A 4F6RB 2VSNA 4QFBA 1FVHA 2XUHA 3BGVA 3EOZA 3TQQA 3TXXA 4EPXA 2KMLA 1KFCB 5FJJA 1U8TA 4QIHA 1G2OA 2Z2YA 3AOEA 1RVV1 2LIVA 2RCNA 3JZDA 2XUIA 2ZYWX 3QFSA 1MKYA 2F6RA 4L16A 3AFIA 1JQ5A 1TLTA 2W83A 3JWEA 4LXIA 5CB0A 2BZGA 4XWYA 4NL4H 2NO5A 1DZ3A 2PRSA 3PDJA 5KTOA 2W11A 4BX3A 3QMMA 1MQ8B 4LTMA 3MTDA 1P7PA 3A2LA 1WABA 5BORA 4KTVE 5K3FB 3HPQA 4CMEA 1RLIA 5EZYB 1LBTA 4V0RA 3IUQA 4DLAA 4QTZA 3KTFA 5CYOA 5LNK6 3PFGA 2C2HA 5KYWA 4MI6A 2UVQA 1X7XB 2JC3A 2PS3A 2YZ2A 3C1UA 3PFHA 4IEIA 4KAFA 5EKTA 2J3HA 4I14A 1W581 1H0SA 2B3DA 3G6WA 1YS2X 4UU1A 2ZJ4A 4ZRMA 2FWBA 3O8RA 2CVFA 1L7OA 3IQHX 3W5AA 2ES4A 4GX2A 3UIEA 1AC5A 3MUFA 1P4GA 4A2QA 3GLGB 4CKEB 3WYGA 1FFAA 2P9QA 1JEDA 2BTQA 5TY0A 3HCEA 2HL6A 2VIIA 1DQPA 2R7MA 1LVGA 1IB6A 4XEUA 5NLLA 3W5BA 4G8DA 3EHEA 4JJ6A 1EFRD 4RFLA 3TZLA 3C3MA 3F90A 1QH1A 1SVSA 3OX4A 4KIFA 1E2QA 3IILA 4EHNA 4LPSA 5JXWA 3QITA 2M6SA 1RQNA 1DQYA 1XBTA 1WV0A 2Q3HA 1UJBA 2WYWA 1NFFA 5U9CA 4F4FA 1BYUA 1L8LA 1ZK3A 5DTRA 2P6OA 3MB8A 5A7HA 3TL2A 1CUWA 3IIKA 4YJDA 5DDIP 3OT5A 4IIFA 1YL6A 3JVIA 2G1PA 3TNFA 4AZ3A 1Z2AA 1FRQA 1L3IA 4BAGA 1GL7A 3X1ZA 4BO9A 4E7PA 2ZCVA 2Z1NA 3DMHA 2WM2A 3LUFA 3O3NB 2A30A 2ZB2A 4UTOA 1KR2A 3I9V1 3DFKA 3L92A 4FX2A 2L69A 4TLMB 5SZHB 2BYTA 2HA5A 5BW8A 3FOEC 2EFGA 5AW2A 2O8NA 1DRJA 1NUUA 1BFKA 2AOXA 5SY4A 1M1XB 3ESXA 3TQSA 4Q7LA 1KI7A 3HCNA 4ARZB 3I61A 4KGDA 1N2SA 3FLMA 2AH5A 3DT8A 2IZOA 4P84A 3A1UA 4JJ7A 1ICIA 4Y6OA 1J8YF 3BC1A 3T3DA 4MI9A 4CM5A 1DXYA 4J07A 1T10A 1C1XB 1SU4A 4JQZA 4ZEOA 1AQLA 1QYVA 2IGBA 4OB7A 1Z2EA 4BASA 2RHOA 4GX1A 3GVIA 4JSYA 4RGVA 4YJGB 5YASA 3JWPA 3U48A 4R3UC 2GM5A 3WRXC 3ABQB 5JASA 5BNZA 3DNFA 5IF3A 2MWMA 3UNXA 3UJ6A 1RIIA 1MB4A 1FLDA 1NASA 2A0XA 2YWXA 1XEWX 3O4IA 1QGED 4KL8S 1G7TA 3CKYA 3NT4A 1AO3A 2FYTA 2IDZA 5ABPA 3K0HA 3D81A 4ZHSA 3I4FA 1CEEA 2YJGA 1DKOA 1O94C 3G9TA 3K8YA 4FSDA 3SJCA 2BLLA 2CXOA 4H7DA 5JS2A 1QYIA 4RPKA 3THSA 3Q8KA 3AESA 2G09A 3HPRA 4O4HA 4M1EA 2NUTB 4V2UA 2HRBA 1YS7A 3HVHA 1UKZA 1XNGA 3VKVA 1P31A 1EUDA 2A58A 3A1VA 3PXUA 3RKRA 4DIOA 2P4EA 2V1XA 4O5AA 4NMMA 3FDZB 2F67A 1VP9A 3TVDA 4U2DA 4EA9A 4AW9A 3PUVA 1FFXA 1DEOA 2RGCA 3CN9A 1W25A 3L02A 4C0KA 3AY3A 1KI4A 5F21A 2ZRMA 3WKCA 4TMYA 2IP1A 5IZCC 3ZLJA 5J5CA 4Q66C 2WTXA 1Z8FA 2P2LA 2H0RA 3O4FA 3CUVA 1WMFA 1TYZA 5TVKA 3Q5GA 5HJEA 2ZBQA 3B6JA 1LCIA 1NMEA 3PEUA 4W4TA 1PYOA 3E70C 3R7WA 2YV1A 4YDQA 2HDOA 2HSEA 3AU9A 3VDMA 2FB9A 4ZC8A 1E2IA 4E31A 1NOIA 1ZA1A 1XPUA 4FFSA 3FYUA 2E89A 4TTVA 3GRPA 3JASB 4OXKA 4GW3A 4QUKA 4QO7A 2WSMA 4BUJA 2BM8A 1ODJA 5D3ZA 3VNRA 3QF4B 5F98A 4KK3A 1W76A 2NYVA 4FD2A 4F45A 4M1KA 4HNQA 3D7KA 5BN5B 5I4CA 1ODTC 1IZ0A 5B57C 4LUCA 4HDQB 2IPAB 4HAZA 5JECA 2I4NA 4WD3A 1SZCA 1U90A 4Z0HO 3RABA 2WYUA 5EKSA 2PUGA 2ET6A 4KO8A 1Z8NA 2PSFA 3DOCA 2MU1A 1A98A 3E7PA 2GNAA 4QDKA 1O96B 3P1JA 3MLAA 2TYSB 4ZIRA 3GGPA 2Z08A 1GUZA 2QVLA 4CF5A 1IJBA 2NUBA 3JATA 4G07A 5EWMA 1E2DA 1HV8A 3ICVA 2J4CA 3UPDA 5M34A 4MQ6A 4LWOA 1PK7A 1Q6YA 3R0JA 5B3AA 3D4LA 4HGOA 3ZTWA 4CQMA 2Y0EA 3LT1A 2AUTA 2QVGA 2I9PA 3NHAA 5GONF 4PC7A 5K0CA 1H2AS 3NJRA 4CI9A 1NBMA 1SXIA 1O6GA 1A27A 5LIPA 1RIFA 3IBTA 5FQNA 1Z56C 2I87A 3AYXB 3RSGA 1OPRA 4C6TA 3DGFC 5CD9A 1ZXBA 1P7YA 2QM7A 2OLJA 3AEXA 3FOCA 2XUOA 3T5MA 4QXOA 3GVCA 4NQRA 4ER5A 1IM2A 3FKSA 1XWFA 5HOQA 5CM8B 5LXTA 3NDBB 5H3CA 4EI8A 2ZIVB 4U39A 3SN6A 2FN4A 4J29A 4BNLA 1BD4A 1X1AA 4MV8A 1GPKA 2WU4A 3B3JA 1IEWA 2HKIA 3HN7A 3L84A 2Q5EA 2YL2A 2JK1A 1ZD1A 1KQGA 2VP4A 5AJTA 2H6EA 1BRMA 1RJEA 5EN4A 4L4SA 1Z5NA 4DDKA 1L5WA 5FPPA 5CFZA 4GQAA 5FI5A 3DV9A 4YRIA 2HHAA 4B3BA 4JYPA 1I7DA 1LB1B 3VC3A 3WY9A 4DCSA 3L79A 4O2AB 1LZKA 4UUMA 2HU7A 4RY9A 4Y8VA 2HXSA 2GTIA 4B76A 3A6EA 1MOPA 5J2UA 4FINA 3MCVA 1QYDA 3ZNNA 5BV1A 4I55A 4NK4A 1ACMA 1PZHA 3IAM1 2XOKD 3NV9A 2FHPA 1Z6ZA 1RYZA 4CG2A 4XVUA 2X22A 1TQ6A 2C2BA 2VDUE 5DM70 1TRKA 3DM5A 1ZQ1A 4RACA 3PXGA 1EJ6A 5L8VA 1RLJA 3QYJA 3VHRA 5HBRA 2XF2A 2VCYA 4G0PA 3DKPA 3FZNA 1K7CA 1P61B 1CK4A 1Z7WA 4YEDA 5IXSA 3DPUA 4H0FA 4X6LA 1J0EA 4D6PA 2IUEA 1PX0A 1V47A 4DM3A 4WACA 1NW4A 2P40A 2QX4A 3HUEA 2VOJA 3KHSA 4OX9B 1BG6A 2Q6KA 2OHGA 2V7XA 4W5NA 1G4AE 2OBMA 4R0NA 1JJBA 2GN9A 2J85A 4ZOLA 3H2KA 1X8JA 2RMKA 1C0IA 4RU1A 3ROFA 4BO0A 2QZ4A 5EJAA 3IE1A 3COVA 3I53A 1V1MB 5JD3A 4XGIA 5IH7A 1NLZA 2YOHA 4INAA 4ZJZA 4F3TA 2DTDA 1W2WB 5AVJA 3ZHCA 5C5EA 4FGLA 4M8SA 4BPRA 1DKUA 2ZI9A 1EG7A 1E7MA 2F1HA 3ETNA 4J7UA 3PFNA 3ZBUA 5AKLA 5I4BA 4MP8A 4PPQA 5ALGA 4E46A 1OOEA 4N82A 3M1YA 3ETJA 4H08A 4ER3A 2W2NA 3T7RA 4DMMA 3OZDA 3CZPA 3QSYA 3I09A 4QQ8A 2Z6QA 3VISA 1H2EA 3MWYW 1WB4A 3MWJA 5AVWA 4XDYA 4BC1A 3QX3A 4QM6A 3TQCA 1Q7RA 3JU3A 3W8RA 5JDIA 4WCFC 3NONA 4OQDA 3FNGA 1GG8A 4IWYA 3GQVA 4H3SA 3SBDA 1XU4A 4LHEA 1DJNA 3I9MA 2JK0A 1JV2B 2XGMA 4QA9A 4EKGA 1LWOA 1SD2A 2QQGA 1I0LA 2WKQA 3CLSD 3EAQA 3PHHA 4HFRA 4E70A 2AJDA 1F8XA 3Q40A 2B0CA 4I3FA 4EB6B 4XPIA 4L4UA 1LPPA 3Q9NA 2WNHA 4KSCA 1I94B 3OA2A 4AKTA 1YI8A 3L4JA 1P0IA 2AF4C 2G6BA 2PNFA 1Z74A 2PTHA 3GJZA 3JR7A 4EHJA 2IHNA 5LUAA 5J4KA 2L42A 1S3FA 2EFDB 2ZGVA 1TKRA 1GTMA 1UFOA 3DMPA 3P96A 4KE8A 5H81A 1HE8B 1TAGA 3SZGA 1T43A 1JA0A 3KPJA 1G6OA 3G79A 4N5LA 5CU7A 4K1XA 5FBHA 1G5IA 3CNEA 3VU9A 4EJSC 3ZNOA 3JS5A 5BXQC 4JJFA 3AW9A 4RD6A 4WOBA 1C50A 4OMCA 5EP2A 1ZH0A 2F1JA 5I01A 2ZR7A 4FR0A 2WNSA 3H3XA 2ATXA 3HV0A 3PC8A 4IFEA 3R5HA 3FMOB 5LQUA 4QGHA 3S2IA 3UB3A 2PIAA 3DP7A 1EFVB 2X4IA 3I1FA 3JAKB 4JL5A 1EE2A 3TQFA 4AQ7A 4PYOA 2YFQA 4JP2A 3ZIUA 3SDBA 1GPDG 1FW8A 4GE0A 4D0RA 4F4UA 3B1ZA 4KQGA 2AN3A 3V2UA 1ZR2A 5KI6A 3VU0A 2EBHX 2WK1A 2ZRGA 3TCNA 1TKCA 3GPBA 2ZIWB 2Y77A 1RAEA 2LUOA 4F8EA 5JS7A 5AOAA 3K2EA 1UFKA 4D3FA 3JQAA 4Y3UA 1FXWF 3DEZA 1MW9X 3E1SA 4DA9A 2M6KA 2BRUA 3TW8B 1E7YA 2JDIA 3ZXSA 3GK3A 2Z3ZA 3TUZC 5ILOA 1OH7A 1D2MA 1H85A 1USUA 3LC7O 2OZKA 1WHTA 3BFPA 2BF4A 2F8LA 5E9AA 3C41J 1EFPB 2XE6A 1QWOA 3TOSA 1C3OB 4JSTA 1LDBA 3JD4A 4HZGA 4KW7A 3SLGA 3S2UA 4MZDA 3WLIA 2OBYA 3OO0A 1I7LA 1AKEA 1QRRA 1XROA 4PBRA 3WB0A 1EGQA 3KQHA 4R01A 3PPIA 2CWWA 1KP3A 4UTPA 2PQ0A 3TIGA 2XW6A 2VZ8A 3IBSA 4R2MA 4HZUA 3WJ7A 2ZBEA 4B73A 1NJ2A 2IPXA 4LMBA 1IM8A 1IBSA 1ONOA 3KT8A 2VDKB 4DG8A 1TQ4A 2IE0A 2QN9A 3PENA 4YCNA 2QPOA 2FZ5A 3Q12A 1PR4A 3VKHA 2Q7XA 1Y1KE 3LUDA 3C4JA 1NW7A 3PDIA 3ROTA 4PSCA 4DUYB 1M6HA 3II6X 4E2WA 1VLLA 3BK7A 3GI1A 1VPWA 1T5LA 1PWEA 5MF6A 4LOLA 2J0SA 3OLZA 1G41A 2XNCA 1TVEA 1X7YB 3TBFA 3VKWA 2SBTA 2OGUA 4LZPA 5D87A 4YCSA 2B7BA 4MWGA 2BFNA 4EFKA 1KBOA 1G8FA 3OIVA 2DMRA 5CDGA 3CF2A 2XUGA 4IFIA 4BLOA 3NKLA 5TRTA 3ZZNA 3TLYA 4ZCRA 4RVUA 1M34E 4RX1A 1CR2A 4GPBA 2PH7A 2C2ZA 1R8JA 1YB7A 3HI4A 4YT2A 3IR6A 1VBMA 3OCWA 5KMGA 2HQRA 4BWFB 4EGSA 5C0OE 1G42A 5FUQA 4PX3A 2WDZA 4B33A 4QGFA 2I99A 3LGXA 3ZGXA 1X8XA 1JFVA 3VYSB 4GAEA 2D7DA 4MW7A 1WWKA 1OZ0A 1N3BA 1BDMA 1P2UA 2WAAA 1EZZA 4P83A 3CONA 3LL7A 1DBRA 1IN6A 4DLLA 4URFA 3PUHA 3V7WA 3SJBA 2CE2X 3VGJA 1K98A 5KZMB 3CR8A 3Q9UA 4GX0A 5CLIA 3TNJA 2C4HA 1C8VB 5BW5A 5I5EA 1Q0TA 1Z36A 4N48A 2CMFA 2AK2A 5I5GA 2QRLA 1YI1A 3GMIA 4HAYA 2BW0A 1HA3A 5C2JB 3A6PC 2ZRQA 1E1CB 4C0JA 2XXAA 3NS7A 4CPDA 4D2IA 1HZZA 1NT2A 2FPGA 3CLSC 4OQ4A 4BU1A 4D46A 1C7JA 3USES 2ZAMA 3BD9A 3W6NA 5BN3A 4WXMA 1JEAA 3DKIA 4ZOBA 5GY7A 4ZI7F 5JTTA 3R3YA 3VTFA 3EGXA 1W6UA 3CNNA 3HB1A 3WKEA 4B3TB 1CY0A 4ZVOA 2OD9A 3IV9A 3M6IA 3TZQA 4EGFA 4RKFA 1W48A 3GT0A 1KEKA 1TJ5A 2I29A 1PL0A 2P9HA 1NGSA 1IUNA 3SR0A 3T7SA 1O5OA 3P4YA 4WY5A 3IAAA 4MWEA 1QAMA 3H99A 4NYMQ 1RBZA 3PR2B 1RYEA 4ND7A 2PDAA 2IW3A 4FEAA 2I7DA 2D54A 3TPFA 2SICE 4U9HS 5CNKA 1L5KA 4JITA 2I34A 1NBHA 1NMQA 1OBCA 3K20A 4PF1A 3MJTA 4FFRA 4QL3A 5A04A 4M7OA 5IJWA 1GPBA 2QL9A 3OIFA 3ZOKA 5IVPA 1WM1A 3M9WA 4LA4A 3K0SA 2EJCA 3KJHA 1L7PA 4KBGA 2IPMA 4Q48A 4EUKA 1IC6A 4N4AA 5KTPA 3SJ7A 1C81A 1RHJA 2GRUA 4UAGA 1FLAA 1JJIA 4AVYA 4BFZA 4ER0A 2V55B 5JZBA 2WMOB 2VC2B 2O5EA 1FMLA 3RHSA 1GGHA 4G89A 5B2EA 1VBKA 1EHIA 3I5AA 3PL5A 3Q11A 2QOEA 1R0CA 1TT7A 1A4RA 4IRMA 4D96A 1OWPA 3ZGOA 1PV1A 3PPWA 1FSGA 4X94A 2GASA 4ZYLA 4K9QA 1KEWA 4ZOCA 4EB0A 2QZ9A 1M73E 4PRZA 3I73A 1Z26A 1JDJA 3DMYA 2PGJA 3ISVA 3CR7A 5LZ9A 1TIBA 2PX4A 1CR1A 4DV3B 1L1EA 1T0IA 2P68A 4TLBA 1YDFA 1FBNA 5GONB 4V2IA 3BJIC 1RQLA 2OY0A 3INTA 1UJNA 5LDGA 1H05A 3UOAB 4EZIA 3EPLA 3B7WA 3ISTA 4X8OA 1CNEA 2CFRA 4XGRA 4BX2A 1NDHA 1C7FA 5AI5A 2WTEA 1RWVA 1VL2A 4ZV9A 2JAUA 4XX1A 1CQPA 2PHZA 1CD5A 3T9AA 3SCZA 3ZBTA 3K53A 4AYWA 3PQ3A 1J90A 2Q3EA 1JB1A 1DSSG 1PR1A 1DTWB 1G1MA 2BMEA 2CXQA 3N0RA 4J0CA 3W3ZB 1XKTA 2P9EA 1T0BA 1YQQA 4OA5A 5FL3A 2G3YA 3W7VA 1AMNA 2M98A 1ZK0A 5HM8A 1FP4B 5D85A 3M2TA 3HNOA 3PLNA 3PRKE 4R9NA 1GAJA 3ZTYA 4BCCA 2G4LA 2GBPA