4EDYA

Crystal structure of hh-pgds with water displacing inhibitor
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Investigation of the binding pocket of human hematopoietic prostaglandin (PG) D2 synthase (hH-PGDS): a tale of two waters.
pubmed doi rcsb
molecule keywords Hematopoietic prostaglandin D synthase
molecule tags Isomerase/isomerase inhibitor
source organism Homo sapiens
total genus 73
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4edyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4edyA01
3OR5A 3E0UA 3LFLA 5J5NA 4FYUA 1ML6A 1NSWA 3U5RE 4N30A 1V40A 1O73A 1PQNA 2O7KA 2YN1A 1GSDA 4ECIA 1O81A 1TU8A 4IGJA 1DSBA 4K0NA 4X0XA 1K0OA 2FA4A 1OC3A 3IE3A 2GSRA 1FB6A 3GL5A 4AJ8A 1GSQA 3E3EA 1X0RA 2OE0A 3LJRA 3M9KA 2CVDA 2V6KA 2HSNB 2FCHA 3EE2A 1GSEA 3TKSA 4PXOA 4WETA 1AQVA 2YJ7A 4ZBBA 3KH7A 19GSA 3F6FA 2F9SA 5IO0A 1K0MA 2PMTA 4Q5QA 1ERTA 1FB0A 5AGYA 5IO2A 3TRXA 1WE0A 5ECNB 3CBUA 4GXZA 3DXBA 2I81A 2H73A 5DALB 4OFMA 2OA7A 2LTKA 4V2MA 5D96A 4HDEA 5JWQB 4XHMA 3KP8A 2L59A 5DALA 2X8GA 2LJAA 4K0GA 3PINA 4DSSB 3RPNA 2H8LA 1JLVA 3C8EA 5GAPD 5ECLB 4OCFA 2CX4A 4DSSA 4IJIA 1TKDB 2AYTA 4RQRA 5A5KA 3M3MA 3WT2A 5G1KA 1AQXA 2GVPA 2VAFA 2XPEA 1K0CA 4LL4B 4CW9A 2O87A 1JZRA 2DSAA 1Z5YE 4V2NA 3N5OA 1KTEA 2K6VA 1YEPA 1A24A 2VCQA 5HFIA 2XPDA 2VL2C 4MABA 1NHOA 4HZ4A 1Z7PA 1XW6A 3M1GA 3L0HA 5DJMA 4PGTA 4WXTA 5CREA 3F3QA 3VPTA 3HJMA 3FZ4A 2M80A 4TRXA 4WR5A 1SL2B 4ZB8A 4PUAA 2B5EA 3VWXA 2DJ1A 1WRYA 4GSSA 4AF2A 1FVJA 2IMFA 4MMMA 4BWQA 3IV4A 2R3XA 1USBA 1F3BA 1SKWB 2FD3A 4JR6A 4E8EA 4QL9A 3ZVJD 4OO4A 5FHIA 1M2BA 1XCCA 1Z3EA 4HUAA 2FHEA 4QQ7A 5DQYA 4GSTA 3H4KA 2PGTA 1U87A 2YANA 1XWBA 4MPGA 3BD2A 1DUGA 1SYRA 5IMVA 2WJUA 3D5JA 2V32A 1THXA 5G5FA 2LRTA 2LKUA 5HR3A 3P2AA 3RAZA 3ZIJA 3FW2A 1GH2A 2IMDA 1A0RP 4ZL8A 2MMOA 2B7KA 1F9MA 3KXOA 3ED3A 3F3RA 2NTOA 5ELGA 1HYUA 4MLYA 5A4UA 3HKRA 1HD2A 1QUWA 1AC1A 1X5CA 3LORA 1TRSA 3CSHA 4ZBAA 1IYHA 3EU4A 2MZCA 1FAAA 5CP1A 5G31A 12GSA 2HSYA 4N10A 2LJRA 1GSFA 3GIXA 1X9WB 6GSVA 4L5OA 2C0GA 4ML1A 5EVOA 3EC3A 5HR2A 2VLTA 4GLTA 2BJXA 3IR4A 1MEKA 4GRFA 2JZSA 3G7IA 5D9VA 5IM9A 1A8YA 5DAKB 1T00A 2HFDA 2V1MA 2VO4A 2DIYA 4FQUA 1CQGA 4IN0A 4EF0A 4POBA 5DAKA 1SU9A 2L57A 2FY6A 1OAZA 4G0LA 3ZYWA 1XFLA 4FO5A 2I4AA 2GZZA 1R7HA 3GN3A 3FZ9A 1E6BA 4FH8A 5J9CA 4POKA 4E8HA 4NMUA 4IQAA 4MCUA 1BG5A 3CRUA 5JWOB 1B4PA 2V2GA 4YAPA 4K7IA 2QGVA 4DEJA 3QPMA 4KA0A 2MMZA 3N9JA 1M9AA 4BVYB 2CQ9A 1XXUA 1FOVA 3F8UA 4BVYA 4K7OA 3V1WA 3TKPA 4TR1A 3ERFA 4GQCA 3CSIA 2H0HA 4YAVA 5D9TA 1OVNA 1F6MC 5DCHA 1PX6A 2PPTA 1E2YA 4J2FA 5DCGA 3CYNA 4MZBA 3GFKA 2MBSA 6GSWA 2IMEA 3UVTA 2PBJA 2B7JA 4NHWA 2L6DA 4FIWA 2CAQA 1GLQA 3UARA 2RLIA 4TKYA 4GSNA 2WULA 5LD0A 1B9YC 1G6YA 2C8UA 3QMXA 4BVXB 4LL1B 3C73A 4JR4A 4I2TA 5EY6A 5IPGA 4PQIA 5D9XA 1SJ6A 3PH9A 3UJ1A 1XVQA 3ZTLA 1O8XA 22GSA 2AV4A 3D6IA 3HYPA 2A4VA 4AJ6A 1X5DA 1XVWA 3L78A 3F4SA 3F0IA 3H79A 3W8SA 1PL1A 5G5EA 1XWCA 3MDKA 2R4VA 2CX3A 2VCTA 2YWIA 14GSA 2GZYA 1RQMA 1J9BA 2J23A 4ECBA 4KH7A 3APSA 5D93A 1B4QA 3EVIA 2H75A 2WB9A 5HR1A 2P5RA 1GTAA 1BQ7A 1PL2A 3CTFA 4HJMA 4KDUA 2DMLA 1GSYA 4L0WA 2HSHA 1G7EA 1EOHA 3HXSA 2C3QA 1ABAA 1GTIA 2GT6A 1SD9A 1TI1A 3LGCA 1NW2A 4EDYA 2N5AA 2GQKA 2H0GA 3VK9A 5EL8A 3G7YA 3ZL5A 2CAIA 3ZREA 2I3YA 3KMOA 4KSOA 5LCZA 1A23A 3ZITA 1ERVA 1GULA 1QK8A 1R5PA 4V1Ap 5KN1A 4KB3A 2H6ZA 1QQ2A 2IN3A 3I9V2 3GURA 4I97A 3KMNA 2B3SA 3GH6A 4OFNA 4K2DA 3C1RA 4NV2A 1YZXA 4RI6A 4ZILA 2WFCA 2GDRA 4IELA 4RUVA 1H75A 4HQSA 5IMFA 2NVLA 3KTLA 4ZL7A 5J4UA 2QC7A 3TOTA 4KSMA 1TXXA 4JRRA 2WDUA 2GSTA 2DMMA 4K7NA 3KD0A 5KN3A 5JCWA 2G0FA 4Q5FA 4YQUA 3DYRA 3G9BA 3CRTA 2VD0A 4KNDA 3L4NA 2H76A 3UMAA 2GLRA 2RIIA 5C00A 13GSA 3KJYA 4PTSA 4PX1A 1YY7A 4N0VA 4BL7A 4IJ3A 3DKSA 3D0ZA 5B7CA 4I5QA 2JACA 4OCEA 3FR9A 4LA1A 5ECOB 4PURA 1T1VA 5AISA 3LQ7A 2M72A 2B5XA 1SYXA 2KP1A 2GSQA 2VCWA 4WEYA 4I2UA 3VLNA 1AQWA 1T8EB 5COHA 4LMWA 2LSTA 3EWLA 3GL3A 1XWAA 2DBCA 2IFQB 1K0NA 1W89A 3GSSA 3HZ4A 3TKRA 1JFUA 5L71A 1HQOA 4MK3A 2GZPA 2IFQA 2VLUA 4KE3A 2OE1A 1Y6EA 4PUFC 4PQ1A 3EU3A 4DVCA 2F3MA 3IPZA 4JE1A 5F06A 3QFAC 3IC4A 1M0UA 2H70A 3VWUA 2HRKB 3P90A 3HD5A 2CVKA 3KCMA 3CTGA 1U6TA 2ALBA 1Z6MA 2HRKA 1WJKA 3K8NA 5G30A 5D73A 2D2ZA 3M9JA 1AW9A 2NBSA 2KLXA 2YV9A 4G10A 1MD4A 4PQHA 2H1AA 2TRXA 3DVWA 4KCAA 1PX7A 3TRPA 2CZ2A 1KEBA 3H8QA 2CA8A 2XC2A 3EINA 2BTOT 2CVBA 1A8LA 3E9JB 4KF9A 1OC8A 1V98A 2O8VB 4WBRD 3MWHA 1EV4A 5GSTA 5IMZA 1HNCA 2VUPA 4FYCA 4CDOA 1OE8A 2H1GA 4HJ2A 1ILOA 2RUFA 4MF7A 3QOUA 2LEGA 3FZ5A 2HZEB 5GZZB 1WPIA 6GSXA 5H5QA 5KN2A 2IMIA 2HZEA 3MNGA 4G2EA 2H6YA 1RK4A 2JZRA 3F4RA 1ZMAA 5CAXA 4IQ1A 3RDWA 1GTUA 5INYA 3LXTA 4AGSA 2HQTA 2F8FA 4ZXGA 2VOCA 1G0TA 1I5GA 3UBKA 1F3AA 3PGTA 3GRXA 4HOJA 2K18A 5ECSA 1DE2A 1BX9A 4TR0A 2JADA 3ISOA 3IDVA 4O32A 2FGXA 2IPAA 4HU7A 1TOFA 4USSA 1PKZA 4TW5A 4GF0A 2H0IA 4EUYA 1HNAA 4QL7A 3S9FA 5ECIB 1NM3A 3KEBA 2R5GA 4J57E 1OYJA 5F0GA 3A2VA 1O85A 1Q98A 4F03A 2F51A 4EO3A 2N5BA 2HNLA 2GQMA 1GNEA 10GSA 3WD6A 3KGKA 3QCPA 4KAEA 4IHUA 1UVZA 4OFTA 4POMA 3QDNA 1ZZYA 3IHQA 4ECCA 5AIXA 3P8WA 3C7MA 4LMVA 1JLWA 2DJ2A 3M0FA 3TKSC 3UL3A 3FR3A 1DE1A 1EP8A 2L6CA 2PUKC 1K3LA 1N8JA 3I43A 5CYYA 3VURA 1MDIA 2C1YA 4GCIA 3DWVA 2AHEA 5GSSA 2K8SA 1ZOFA 5B6NA 3KP9A 2MMAA 3ME8A 1SL0B 3F63A 5AN1A 2NPBA 4O7HA 3IRAA 2C80A 5E4WA 2OACA 1GUMA 4MJAA 1SKRB 3FY7A 2E2MA 3HA9A 1YEXA 1X9MB 2HRNA 1WOUA 17GSA 1TRVA 4HS1A 5HQPA 1VGLA 1AAZA 3TJBA 5HFGA 1A2JA 6GSUA 3GUSA 3IA1A 4ILFA 2R37A 2RM5A 1LU4A 3RHBA 1F2EA 3ZMLA 2EIRA 1A0FA 3GA4A 2FLSA 1XW9A 2JSZA 3G7JA 3I69A 3DMLA 2OJLA 1R26A 6GSYA 2HT9A 4HU9A 2YP6A 3QR6A 4NWYA 2ON5A 2FNOA 1RW1A 4XIHA 1SJIA 4XRDA 4ISDA 2VCVA 1VRSD 8GSSA 4X1UA 2J9HA 2HSMB 4H86A 3FHKA 2AJQB 1XBSA 3HHVA 2HSMA 4KW6A 4WBJA 1FO5A 1FW1A 4MJEA 3US3A 5J41A 1GNWA 5IMCA 4F0BA 5CRDA 3PPUA 2I1UA 5ECHB 4MDCA 3VPQA 3WGXA 5KEJA 1TRUA 3GKKA 4TN8A 2WGRA 3GH9A 3GTUB 5IPHA 2R6KA 1BJXA 2C4JA 3L9VA 3O76A 4JU5A 4L0UA 2R2JA 3GTUA 3TJKA 2KHPA 1URMA 4ZB9A 3QD9A 1ON4A 4ZB6A 3A3TA 1WIKA 3GNJA 4BVXA 1GL8A 3DIEA 5DJLA 4KDXA 1V9WA 2GQLA 1SJZA 1TK8B 4HI7A 2L4QA 2VL9A 4TR4A 5ID2B 1ST9A 2HLSA 4XS4B 2L4CA 5EPFA 2L5OA 2MBTA 4G9HA 1ERWA 5DDLA 5ID2A 3WGDA 1S3CA 1C72A 4K6XA 4XS4A 4POLA 2MYGA 1B8XA 3WYWA 2O85A 2PWJA 3W8JA 4MJBA 2YZUA 3KM6A 1J0FA 3O6TA 3TJJA 2YZHA 3W6GA 2YNXA 2VM1A 3C71A 1OC9B 2LS5A 4Q5RA 4J56E 4MF6A 1AIUA 4G0IA 5HFKA 2K9FA 1OC9A 3CSJA 4F0CA 1S3AA 2X8HA 1UC7A 2H71A 3FEUA 4HZ2A 5JCUA 1GRXA 2H66A 3Q18A 6GSTA 1M99A 1K0DA 2TRCP 4YH2A 4XCSA 5F07A 3R2QA 5CRWA 4MH2A 4OD7A 1UN2A 4YQVA 1XOAA 4RI7A 2C0EA 5DBQA 3GYKA 1UA5A 3EMXA 1U3IA 1JZOA 1T3BA 3FZAA 3QFBC 5A4VA 3ZFBA 4ZIJA 1XPVA 4TOPA 3BJ5A 4HQZA 2E2GA 1PA3A 3LSZA 4GTUA 2FWEA 11GSA 2DIZA 2FA8A 1XOBA 1GUHA 4JZQA 4MZCA 1M2DA 1JZWA 4N11A 3CMIA 1GP1A 2M46A 5ABRA 2HZFA 20GSA 4K9ZA 1X5EA 2BMXA 3BCKA 4MF5A 3VWWA 3FR6A 3HDCA 1U3AA 2DJKA 2PERA 2I9HA 1ZGNA 5IMDA 3APQA 3FYGA 3EURA 2IWTA 2YWOA 5CRHA 2AAWA 1PMTA 3TUEA 3F9UA 5IOXA 3GV1A 2YJHA 3H1NA 2EC4A 5IOWA 3UIWA 2VL2A 4OO5A 4Q5NA 4KX4A 1SK2A 3IC8A 3J7Yb 3D21A 1EP7A 1T4ZA 2ZCTA 5D8IA 3L9SA 5C04A 2X8CA 2YPMA 2JU5A 3U6VA 2QKEA 4O5RA 3SBCA 3TKSE 1TI3A 2GS3A 2X99A 1H4OA 1OE7A 5B8AA 2C0FA 3SWLA 4OMVA 2OKAA 1V58A 3LXZA 1GSUA 2H1BA 1QGVA 1TK5B 4IP6A 3IAS2 1ZCPA 1V2AA 1YKAA 2V41A 3BOAA 4YQMA 3MSZA 2X64A 3D4TA 3APOA 3F6DA 5F8BA 4LLRA 2GGTA 4DSRA 3J7Yk 3AY8A 3Q6OA 4NXIA 1Z7RA 3JCML 1OKTA 1SL1B 2LUSA 4XS6A 4MZWA 3A2XA 2OE3A 2VLVA 3C1SA 1YQ1A 1AXDA 5ECQB 1BAYA 2VL3A 1ZYEA 3FRCA 4ACSA 4ML6A 1YF1A 1M2AA 3EMPA 3QAWA 4MPFA 3LEFA 1TRWA 2OBKA 3HJOA 1A2LA 3IBHA 2DLXA 2H72A 3I6AA 3R3EA 2H6XA 2WS2A 1MD3A 3VWVA 3H93A 3ZMKA 1XWGA 1LJRA 3F4TA 1O7UA 3VFIA 1EGOA 1FG4A 2YV7A 3CXGA 2PN8A 2IL3A 2N5FA 3ZVJA 1FVKA 3ZZXA 3TGZA 2WRTA 3L9UA 3PR8A 2DJ3A 4IP1A 1PKWA 4TR3A 4NV5A 4BPYA 2MMNA 1OKDA 3TDGA 2GSSA 1K3OA 5IQYA 5ECRB 1GUKA 1XWKA 4MP4A 4EKZA 4NPBA 1TDIA 1IYIA 5AIVA 2YOIA 4WF5A 4GQFA 3HJPA 5ELAA 1ERUA 4BWSA 1M9BA 1YKCA 5J9BA 2AB6A 5ECPB 2FUG2 3D22A 4V1Ag 1I9DA 1G7OA 2JL4A 5JCGA 2ES7A 2H1DA 18GSA 2JSYA 3GHAA 3VI7A 3HY2A 1A2MA 3LYPA 2EIOA 4EE0A 3RPPA 3LYKA 4TXVA 1MTCA 1TW9A 1THOA 1CQHA 2LV3A 2TIRA 3QAGA 2XHFA 2YCDA 1K0AA 3TJFA 1YF0A 4AJ7A 5JWRB 1TK0B 1LBKA 5A4WA 2DC5A 5IIZA 5IMAA 4F82A 3IK7A 2A2RA 3FKFA 1GLPA 3LWAA 1KNGA 2NDOA 5FT3A 4K1FA 1Z9HA 3DVXA 2KP2A 5F05A 1GSSA 1QFNA 4ZBDA 3NOFA 3NIVA 2B1LA 3MAKA 2VD1A 2FWFA 1XZOA 3A2WA 3LG6A 5FWGA 1M7TA 5CNWA 1DBYA 2GTUA 1Y25A 1SD8A 1V57A 4MJCA 1SK1A 3ZLPA 4ID0A 5G2ZA 4L5LA 1JHBA 4F9ZA 2UZ8A 4ZL9A 1FHEA 1EGRA 3D4MA 4MA9A 2B5YA 3GKMA 3IXRA 4P3YB 4IVFA 2HXKA 3BCIA 2WCIA 4EDZA 1Q4JA 3GX0A 1T4YA 2HRAA 4XRAA 1WMJA 2LNSA 3TB2A 1BYEA 3GSTA 4CHSA 1SENA 1VF2A 1W4VA 4HEA2 4PNFA 4G19A 1XW5A 4MH3A 4IW9A 1EZKA 3FK8A 1R5AA 3GMFA 4JBBA 2GT5A 3HZ8A 2VCXA 1EV9A 1PGTA 2C0DA 5LNKe 3KZQA 5H5SA 2DJJA 1K0BA 1O8WA 2A2SA 2OADA 3RBTA 2C3TA 2L5LA 1QXHA 1S3DA 3DD3A 3M8NA 5B8BA 5E59A 4NHZA 2H19A 2FWGA 5ECMB 1F37A 2IJYA 2LRNA 1YJ6A 4I6XA 3ERGA 3QAVA 3IAM2 2H30A 4TR1B 3KIJA 2LRCA 1ACVA 2P5QA 4EVMA 3NZNA 2ZNMA 1ZL9A 5CRGA 4WKWA 2PU9C 1MDKA 2VM2A 1SKSB 4IS0A 2ON7A 3Q74A 3WGEA 4KDYA 3WT1A 2AUVA 2XBQA 3GKXA 4IBPA 2IIYA 1XIYA 3VI5A 2DJ0A 7GSSA 2E7PA 2RUEA 1YDKA 5J3RA 3TKQA 5H5RA 3KTBA 3ME7A 3GKNA 3UVHA 3ERWA 4K8MA 9GSSA 1EEMA 4FYBA 4EXJA 5D9WA 2K8VA 2LJKA 2VIMA 3TCOA 1PSQA 4L8EA 3ZFLA 1WP0A 4BA7A 1J08A 3HVXA 2OBIA 3IK9A 3P7XA 1EWXA 4OWYA 4RQXA 2HI7A 2XBIA 2F8AA 2HE3A 1Z6NA 2HRFA 1HNBA 1WWJA 4N0ZA 2VCZA 4KCEA 2REMA 4G0KA 2YWMA 1X9SB 3UOMA 2LQOA 4XS1A 1PRXA 2G2QA 3UAPA 2ZUPA 2PVOC 3O3TA 1VF3A 4X43A 4TXOB 1GWCA 1T7PB 1U88A 2H74A 4ULXA 4WR4A 2B6MA 4TXOA 2HYXA 5ECKB 2KOKA 4EL1A 2P31A 4IKHA 1B9XC 1R4WA 4GWRA 2PVQA 16GSA 4JEDA 6GSSA 3UEMA 2CT6A 1TJDA 3KH9A 1QMVA 1GTBA 5KN0A 3ZRDA 3ZIVA 1N2AA 2RM6A 5BMUA 4V2LA 2IMKA 1EEJA 4EC0A 3TOUA 1KBNA 1TP9A 3RHCA 1EOGA 1JZDA 4Z7XA 3Q19A 4KUNA 4ECJA 3HVSA 1SK0A 4WF4A 2QSIA 2O89A 5B6MA 5DQSA 1VF4A 5HR0A 2E0QA 2P0GA 3GX8A 4NAXA 2Z9SA 4KGIA 2B1KA 2C3NA 3UBLA 2EIQA 2YWNA 2CV4A 2WZ9A 4F2IA 3EYTA 1PD21 3IOSA 4D73B 5DVBA 1ZYQB 3TJGA 4PNGA 4BL7B 1G6WA 4D73A 5G1LA 1TTZA 4TVEA 4XTSA 2LQQA 2CZ3A 1TU7A 3DEXA 3DRNA 3A5WA 4DSQA 1O6JA 2LNTA 3HVVA 1B48A 5GAND 4O92A 1NHYA 3DGQA 5ENUA 1K3YA 2JZTA 3TRQA 5CO3A 1VF1A 1PN9A 2H01A 2V6OA 4I8BA 1AUCA 1MDJA 1BEDA 2KUCA 2FWHA 3HCZA 3BBYA
chains in the Genus database with same CATH superfamily
3OR5A 3E0UA 3LFLA 5J5NA 4FYUA 1ML6A 5A5HB 1NSWA 3U5RE 4N30A 1V40A 1O73A 1PQNA 2O7KA 2YN1A 1GSDA 4ECIA 1O81A 3MIXA 1TU8A 4IGJA 1DSBA 4K0NA 4X0XA 1K0OA 2FA4A 1OC3A 3IE3A 2GSRA 1FB6A 3GL5A 4AJ8A 1GSQA 3E3EA 1X0RA 2OE0A 3LJRA 3M9KA 2CVDA 2V6KA 2HSNB 2FCHA 3EE2A 1GSEA 3TKSA 4PXOA 4WETA 1AQVA 2HSNA 2YJ7A 4ZBBA 3KH7A 19GSA 3F6FA 2F9SA 5IO0A 1K0MA 2PMTA 4Q5QA 1ERTA 1FB0A 5AGYA 5IO2A 3TRXA 1WE0A 4YKFA 5ECNB 3CBUA 4GXZA 3DXBA 2I81A 2H73A 5DALB 4OFMA 2OA7A 2LTKA 4V2MA 5D96A 4HDEA 5JWQB 4XHMA 3KP8A 2L59A 5DALA 2X8GA 2LJAA 4K0GA 3PINA 4DSSB 3RPNA 2H8LA 1JLVA 3C8EA 5GAPD 5ECLB 4OCFA 2CX4A 4DSSA 4IJIA 1TKDB 2AYTA 4RQRA 5A5KA 3M3MA 3WT2A 5G1KA 1AQXA 2GVPA 4X4JA 2VAFA 2XPEA 1K0CA 4LL4B 4CW9A 2O87A 1JZRA 2DSAA 1Z5YE 4V2NA 3N5OA 1KTEA 2K6VA 1YEPA 1A24A 2VCQA 5HFIA 2XPDA 2VL2C 4MABA 1NHOA 4HZ4A 4N3ZA 1Z7PA 1XW6A 3M1GA 3L0HA 5DJMA 4PGTA 4WXTA 5CREA 3F3QA 3VPTA 3HJMA 3FZ4A 2M80A 4TRXA 4WR5A 1SL2B 4ZB8A 4PUAA 2B5EA 3VWXA 2DJ1A 1WRYA 4GSSA 4AF2A 1FVJA 4W66A 2IMFA 4MMMA 4BWQA 3IV4A 2R3XA 1USBA 1F3BA 1SKWB 2FD3A 4JR6A 4E8EA 4QL9A 3ZVJD 4OO4A 5FHIA 1M2BA 1XCCA 1Z3EA 4HUAA 2FHEA 4QQ7A 5DQYA 4GSTA 2WW3A 3H4KA 2PGTA 1U87A 2YANA 1XWBA 4MPGA 3BD2A 1DUGA 1SYRA 5IMVA 2WJUA 3D5JA 2V32A 1THXA 5G5FA 2LRTA 2LKUA 5HR3A 3P2AA 3RAZA 3ZIJA 3FW2A 1I1IP 1GH2A 2IMDA 1A0RP 4ZL8A 2MMOA 2A4HA 2B7KA 1F9MA 3KXOA 3ED3A 3F3RA 4AI6A 2NTOA 5ELGA 1HYUA 4MLYA 5A4UA 3HKRA 1HD2A 1QUWA 1AC1A 1X5CA 1S3RA 3LORA 1TRSA 3CSHA 4ZBAA 1IYHA 3EU4A 2A2PA 2MZCA 1FAAA 5CP1A 5G31A 12GSA 2HSYA 4N10A 2LJRA 1GSFA 3GIXA 1X9WB 6GSVA 4L5OA 2C0GA 4ML1A 5EVOA 3EC3A 5HR2A 2VLTA 4GLTA 2BJXA 3IR4A 1MEKA 4GRFA 3HMJG 2JZSA 3G7IA 5D9VA 5IM9A 1A8YA 5DAKB 1T00A 2HFDA 2V1MA 2VO4A 2DIYA 4FQUA 1CQGA 4IN0A 4EF0A 4POBA 5DAKA 1SU9A 2L57A 2FY6A 4O5UA 1OAZA 5J40A 4G0LA 3ZYWA 1XFLA 4FO5A 2I4AA 2GZZA 1R7HA 4Z2RA 3GN3A 3FZ9A 1E6BA 4FH8A 5J9CA 4POKA 4E8HA 4NMUA 4IQAA 4MCUA 1BG5A 3CRUA 5JWOB 1B4PA 4HSCX 2V2GA 4YAPA 4K7IA 2QGVA 4DEJA 3QPMA 4KA0A 2MMZA 3N9JA 1M9AA 4BVYB 2CQ9A 1XXUA 4E68A 1FOVA 3F8UA 4BVYA 4K7OA 3V1WA 3TKPA 4TR1A 3ERFA 4GQCA 3CSIA 2H0HA 4YAVA 5D9TA 1OVNA 1F6MC 5DCHA 1PX6A 2PPTA 1E2YA 4J2FA 3CYNA 5DCGA 5J4YA 4MZBA 3GFKA 2MBSA 6GSWA 2IMEA 3UVTA 2PBJA 2B7JA 4NHWA 2L6DA 3RGBC 4FIWA 2CAQA 1GLQA 3UARA 2EFHA 2RLIA 4TKYA 4GSNA 2WVYA 2WULA 5LD0A 1B9YC 4PI2C 1G6YA 2C8UA 3QMXA 4BVXB 4LL1B 3C73A 4JR4A 4I2TA 5EY6A 5IPGA 4PQIA 5D9XA 1SJ6A 3PH9A 3UJ1A 1ZYPA 1XVQA 3ZTLA 1O8XA 22GSA 2AV4A 3D6IA 3HYPA 2A4VA 4AJ6A 1X5DA 1XVWA 3L78A 3F4SA 3F0IA 3H79A 3W8SA 1PL1A 4CY8A 5G5EA 1XWCA 3MDKA 2R4VA 2CX3A 3TU3B 2VCTA 2YWIA 14GSA 2GZYA 1RQMA 1J9BA 2J23A 4ECBA 4KH7A 3APSA 5D93A 1B4QA 3EVIA 2H75A 2WB9A 5HR1A 2P5RA 1GTAA 1BQ7A 1PL2A 3CTFA 4HJMA 4KDUA 2DMLA 1GSYA 4L0WA 2HSHA 1G7EA 1EOHA 3HXSA 2C3QA 1ABAA 1GTIA 2GT6A 1SD9A 1TI1A 3LGCA 1NW2A 2H1LA 4EDYA 2N5AA 2GQKA 2H0GA 3VK9A 5EL8A 3G7YA 3ZL5A 2CAIA 3ZREA 2I3YA 3KMOA 4KSOA 5LCZA 1A23A 3ZITA 1ERVA 1GULA 1QK8A 1R5PA 4V1Ap 5KN1A 4KB3A 2H6ZA 1QQ2A 2IN3A 3I9V2 3GURA 4I97A 3KMNA 2B3SA 3GH6A 4OFNA 4K2DA 3C1RA 4NV2A 1YZXA 3RFRC 4RI6A 4ZILA 2WFCA 2GDRA 4IELA 4RUVA 1H75A 4HQSA 5IMFA 2NVLA 3KTLA 4ZL7A 5J4UA 2QC7A 3TOTA 4KSMA 1TXXA 4JRRA 2WDUA 2GSTA 2DMMA 4K7NA 2O36A 3KD0A 5KN3A 5JCWA 2G0FA 4Q5FA 4YQUA 3DYRA 3G9BA 3CRTA 2VD0A 4KNDA 3L4NA 2H76A 3UMAA 2GLRA 4G01A 2RIIA 13GSA 5C00A 3KJYA 1S4BP 4PTSA 4PX1A 1YY7A 4N0VA 4BL7A 5J4VA 4IJ3A 3DKSA 3D0ZA 5B7CA 4I5QA 2JACA 4OCEA 3FR9A 4LA1A 5ECOB 4PURA 1T1VA 5AISA 3LQ7A 2M72A 2B5XA 1SYXA 2KP1A 2GSQA 2VCWA 4WEYA 4I2UA 3VLNA 1AQWA 1T8EB 5COHA 4LMWA 2LSTA 3EWLA 3GL3A 2WW0A 1XWAA 2DBCA 2IFQB 1K0NA 5A5HA 1W89A 3GSSA 3HZ4A 3TKRA 1JFUA 5L71A 1HQOA 4MK3A 2GZPA 2IFQA 2VLUA 4KE3A 2OE1A 1Y6EA 4PUFC 4PQ1A 3EU3A 4DVCA 2F3MA 3IPZA 4JE1A 5F06A 3QFAC 3IC4A 1M0UA 2H70A 3VWUA 2HRKB 3P90A 3HD5A 2CVKA 3KCMA 4PHZC 3CTGA 1U6TA 2ALBA 1Z6MA 2HRKA 1WJKA 3K8NA 5G30A 4YKGA 3IHGA 5D73A 2D2ZA 3M9JA 1AW9A 2NBSA 2KLXA 2YV9A 4G10A 1MD4A 4PQHA 2H1AA 2TRXA 3DVWA 4KCAA 1PX7A 3TRPA 2CZ2A 1KEBA 3H8QA 2CA8A 2XC2A 3EINA 2BTOT 4A5PA 2CVBA 1A8LA 3E9JB 4KF9A 1OC8A 1V98A 2O8VB 4WBRD 3MWHA 1EV4A 5GSTA 5IMZA 1HNCA 2VUPA 4FYCA 4CDOA 1OE8A 2H1GA 4HJ2A 1ILOA 2RUFA 4MF7A 3QOUA 2LEGA 3FZ5A 2HZEB 5GZZB 1WPIA 6GSXA 5H5QA 5KN2A 2IMIA 2HZEA 3MNGA 4G2EA 2H6YA 1RK4A 2JZRA 3F4RA 1ZMAA 5CAXA 2O3EA 4IQ1A 3RDWA 1GTUA 5INYA 3LXTA 4AGSA 2HQTA 2F8FA 4ZXGA 2VOCA 1G0TA 1I5GA 3UBKA 1F3AA 2X4AA 3PGTA 3FMWA 3GRXA 4HOJA 2K18A 5ECSA 1DE2A 1BX9A 2EFDA 4TR0A 2JADA 4ICYA 3ISOA 3IDVA 4O32A 2FGXA 2IPAA 4HU7A 1TOFA 4USSA 1PKZA 4TW5A 4GF0A 1TXUA 2H0IA 4EUYA 1HNAA 4QL7A 3S9FA 5ECIB 1NM3A 3KEBA 2R5GA 4J57E 1OYJA 5F0GA 3A2VA 1O85A 1Q98A 4F03A 2F51A 4EO3A 2N5BA 2HNLA 2GQMA 1GNEA 10GSA 3WD6A 3KGKA 3QCPA 4KAEA 4IHUA 5KOXA 1UVZA 4OFTA 4POMA 3QDNA 1ZZYA 3IHQA 4ECCA 5AIXA 3P8WA 3C7MA 4LMVA 1JLWA 2DJ2A 3M0FA 3CWGA 3TKSC 3UL3A 3FR3A 1DE1A 1EP8A 2L6CA 2PUKC 1K3LA 1N8JA 3I43A 5CYYA 3VURA 1MDIA 2C1YA 4GCIA 3DWVA 2AHEA 4QMKA 5GSSA 2K8SA 1ZOFA 5B6NA 3KP9A 2MMAA 3ME8A 1SL0B 3F63A 5AN1A 2NPBA 4O7HA 3IRAA 2C80A 5E4WA 2OACA 1GUMA 1BF5A 4MJAA 1SKRB 4PI0C 3FY7A 2E2MA 3HA9A 1YEXA 1X9MB 2HRNA 1WOUA 4AKIA 1XG8A 17GSA 1TRVA 4HS1A 5HQPA 1VGLA 1AAZA 3TJBA 5HFGA 1A2JA 6GSUA 3GUSA 3IA1A 4ILFA 2R37A 2RM5A 1LU4A 3RHBA 1F2EA 3ZMLA 2EIRA 1A0FA 3GA4A 2FLSA 1XW9A 2JSZA 3G7JA 3I69A 3DMLA 2OJLA 4K5RA 1R26A 6GSYA 2HT9A 4HU9A 2YP6A 3QR6A 4NWYA 2ON5A 2EFEA 2FNOA 1RW1A 4XIHA 1SJIA 4XRDA 4ISDA 2VCVA 1VRSD 8GSSA 4X1UA 2J9HA 2HSMB 4H86A 3FHKA 1SVLA 2AJQB 1XBSA 3HHVA 2HSMA 4KW6A 4WBJA 1FO5A 1FW1A 1Y1UA 4MJEA 3US3A 5J41A 1GNWA 5IMCA 4F0BA 5CRDA 3PPUA 2QA1A 2I1UA 5ECHB 4MDCA 3VPQA 3WGXA 5KEJA 1TRUA 3GKKA 4TN8A 2WGRA 3GH9A 2DKHA 3GTUB 5IPHA 2R6KA 1BJXA 2C4JA 3L9VA 3O76A 4JU5A 5A1NB 4L0UA 2R2JA 3GTUA 3TJKA 2KHPA 1URMA 4ZB9A 3QD9A 1ON4A 4ZB6A 3A3TA 1N25A 1WIKA 3GNJA 4BVXA 5A1NA 2R0CA 1GL8A 3DIEA 5DJLA 4KDXA 1V9WA 2GQLA 2VKZG 1SJZA 1TK8B 4HI7A 2L4QA 2VL9A 4TR4A 5ID2B 1ST9A 2HLSA 4XS4B 2L4CA 5EPFA 2L5OA 2QA2A 2MBTA 4G9HA 1ERWA 5DDLA 5ID2A 3WGDA 1S3CA 1C72A 4K6XA 4XS4A 4POLA 2MYGA 1B8XA 3WYWA 2O85A 2PWJA 3W8JA 4MJBA 4K5SA 2YZUA 3KM6A 1J0FA 3O6TA 3TJJA 2YZHA 3W6GA 2YNXA 2VM1A 3C71A 1OC9B 2LS5A 4Q5RA 4J56E 1FOHA 4MF6A 1AIUA 4G0IA 5HFKA 2K9FA 1OC9A 3CSJA 4F0CA 1S3AA 2X8HA 1UC7A 2H71A 3FEUA 4HZ2A 5JCUA 1GRXA 2H66A 3Q18A 6GSTA 1M99A 1PN0A 1K0DA 2TRCP 4YH2A 4XCSA 5F07A 3R2QA 5CRWA 2WVZA 4MH2A 4OD7A 1UN2A 4YQVA 1XOAA 2WVXB 4RI7A 2C0EA 5DBQA 3GYKA 4GDFA 1UA5A 3EMXA 1U3IA 1M3JA 1JZOA 1T3BA 2WVXA 3FZAA 3QFBC 5A4VA 3ZFBA 4ZIJA 1XPVA 4MNNA 4TOPA 4AKGA 3BJ5A 4HQZA 2E2GA 1PA3A 3LSZA 4GTUA 2FWEA 11GSA 2DIZA 2FA8A 1XOBA 4Z2UA 1GUHA 4JZQA 4MZCA 5BRTA 1M2DA 1JZWA 4N11A 3CMIA 1GP1A 2M46A 4O5QA 5ABRA 2HZFA 20GSA 4K9ZA 1X5EA 2BMXA 3BCKA 4MF5A 3VWWA 3FR6A 3HDCA 1U3AA 2DJKA 2PERA 2I9HA 1ZGNA 5IMDA 3APQA 3FYGA 3EURA 2IWTA 2YWOA 5CRHA 2AAWA 1PMTA 3TUEA 3F9UA 5IOXA 3GV1A 2YJHA 3H1NA 2EC4A 5IOWA 3UIWA 2VL2A 4OO5A 4Q5NA 4KX4A 1SK2A 3IC8A 3J7Yb 3D21A 1EP7A 1T4ZA 2ZCTA 5D8IA 3L9SA 5C04A 2X8CA 2YPMA 2JU5A 3U6VA 2QKEA 1PFOA 4O5RA 3SBCA 3TKSE 1TI3A 2GS3A 2X99A 1H4OA 1OE7A 5B8AA 2C0FA 3SWLA 4OMVA 2OKAA 1V58A 3LXZA 1GSUA 2H1BA 1SVMA 4EIQA 1QGVA 1TK5B 4IP6A 3IAS2 1ZCPA 4K2XA 1V2AA 1YKAA 2V41A 3BOAA 4YQMA 3MSZA 2X64A 3D4TA 3APOA 3F6DA 5F8BA 4LLRA 2GGTA 4DSRA 3J7Yk 3AY8A 3Q6OA 4NXIA 1Z7RA 3JCML 1OKTA 1SL1B 2LUSA 4XS6A 4MZWA 3A2XA 2OE3A 2VLVA 3C1SA 1YQ1A 1AXDA 5ECQB 1BAYA 2VL3A 1ZYEA 3FRCA 4ACSA 4ML6A 1YF1A 1M2AA 3EMPA 3QAWA 4MPFA 3LEFA 1TRWA 2OBKA 3HJOA 1A2LA 3IBHA 2DLXA 2H72A 3I6AA 3R3EA 2H6XA 2WS2A 5J47A 2R0GA 1MD3A 3VWVA 3H93A 3ZMKA 1XWGA 1LJRA 3F4TA 1O7UA 3VFIA 1EGOA 1FG4A 2YV7A 3CXGA 2PN8A 2IL3A 2N5FA 2WW1A 3ZVJA 1FVKA 3ZZXA 3TGZA 2WRTA 3L9UA 3A5IA 3PR8A 2DJ3A 4IP1A 1PKWA 4TR3A 4NV5A 4BPYA 2MMNA 1OKDA 3TDGA 2GSSA 1K3OA 2OT3A 5IQYA 5ECRB 2R0PA 1GUKA 1M3IA 1XWKA 4MP4A 4EKZA 4NPBA 1TDIA 1IYIA 5AIVA 2YOIA 4WF5A 4GQFA 3HJPA 3HVNA 5ELAA 1ERUA 4BWSA 1M9BA 1YKCA 5J9BA 2AB6A 5ECPB 2FUG2 3D22A 4V1Ag 1I9DA 1G7OA 2JL4A 5JCGA 2ES7A 2H1DA 18GSA 2JSYA 3GHAA 3VI7A 3HY2A 1A2MA 3LYPA 2EIOA 4EE0A 3RPPA 3LYKA 4TXVA 1MTCA 1TW9A 1THOA 2UV8G 1CQHA 2LV3A 2TIRA 3QAGA 2DKIA 2XHFA 2YCDA 1K0AA 3TJFA 1YF0A 4AJ7A 5JWRB 1TK0B 1LBKA 5A4WA 2DC5A 5IIZA 5IMAA 4F82A 3IK7A 2A2RA 3FKFA 3MYDA 1GLPA 3LWAA 1KNGA 2NDOA 4BIKA 5FT3A 4K1FA 1Z9HA 3DVXA 2KP2A 5F05A 1GSSA 1QFNA 4ZBDA 3NOFA 3NIVA 2B1LA 3MAKA 2VD1A 2FWFA 1XZOA 3EPTA 3A2WA 3LG6A 5FWGA 1M7TA 5CNWA 1DBYA 2GTUA 1Y25A 1SD8A 1YEWC 1V57A 4MJCA 1SK1A 3ZLPA 4ID0A 5G2ZA 4L5LA 1JHBA 4F9ZA 2UZ8A 4ZL9A 1FHEA 1EGRA 3D4MA 4MA9A 2B5YA 3GKMA 3IXRA 4P3YB 4IVFA 2HXKA 3BCIA 2WCIA 4EDZA 1Q4JA 3GX0A 1T4YA 2HRAA 4XRAA 1WMJA 2LNSA 4CY6A 3TB2A 1BYEA 3GSTA 4CHSA 1SENA 1VF2A 1W4VA 4HEA2 4PNFA 4G19A 1XW5A 4MH3A 4IW9A 1EZKA 3FK8A 1R5AA 3GMFA 4JBBA 2GT5A 3HZ8A 2VCXA 1EV9A 1PGTA 2C0DA 5LNKe 3KZQA 5H5SA 2DJJA 2EFCA 1K0BA 1O8WA 2A2SA 2OADA 3RBTA 2C3TA 2L5LA 1QXHA 1S3DA 3DD3A 3M8NA 5B8BA 5E59A 4NHZA 2H19A 2FWGA 5ECMB 1F37A 2IJYA 2LRNA 1YJ6A 4I6XA 3ERGA 3QAVA 5KOWA 4EIPA 3IAM2 2H30A 4TR1B 3KIJA 4AKHA 2LRCA 1ACVA 2P5QA 4EVMA 3NZNA 2ZNMA 1ZL9A 3LW9A 5CRGA 4WKWA 2PU9C 1MDKA 2VM2A 1SKSB 4IS0A 2ON7A 3Q74A 3WGEA 4KDYA 3WT1A 2AUVA 2XBQA 3GKXA 4IBPA 2IIYA 1XIYA 3VI5A 2DJ0A 7GSSA 2E7PA 2RUEA 1YDKA 5J3RA 3TKQA 5H5RA 3KTBA 3ME7A 3GKNA 3UVHA 3ERWA 4K8MA 9GSSA 1EEMA 1ZYNA 4FYBA 4EXJA 4Z2TA 5D9WA 2K8VA 2LJKA 2VIMA 3TCOA 1PSQA 4L8EA 3ZFLA 1WP0A 4BA7A 1J08A 1BG1A 3HVXA 2OBIA 3IK9A 3P7XA 1EWXA 4OWYA 4RQXA 2HI7A 5A34B 2XBIA 2F8AA 2HE3A 1Z6NA 2HRFA 1HNBA 5A34A 1WWJA 4N0ZA 2VCZA 4KCEA 2REMA 4G0KA 2YWMA 1YVLA 1SVOA 1X9SB 3UOMA 2O5VA 2LQOA 4XS1A 1PRXA 2G2QA 3UAPA 2ZUPA 2PVOC 3O3TA 1VF3A 4X43A 4TXOB 2WW2A 1GWCA 1T7PB 1U88A 2H74A 4ULXA 4WR4A 2B6MA 4TXOA 2HYXA 5ECKB 2KOKA 4EL1A 2P31A 4IKHA 1B9XC 1R4WA 4GWRA 2PVQA 16GSA 4JEDA 6GSSA 3UEMA 2CT6A 1TJDA 3KH9A 1QMVA 5BMUB 1GTBA 5KN0A 3ZRDA 3ZIVA 1N2AA 2RM6A 5BMUA 4V2LA 2IMKA 1EEJA 4AKXB 4EC0A 3TOUA 1KBNA 1TP9A 3RHCA 1EOGA 1JZDA 4Z7XA 3Q19A 2WZSA 4KUNA 4ECJA 3HVSA 1SK0A 4WF4A 2QSIA 2O89A 5B6MA 5DQSA 1VF4A 5HR0A 3CHXC 3CQFA 2E0QA 2P0GA 3GX8A 4NAXA 2Z9SA 4KGIA 2B1KA 2C3NA 3UBLA 2EIQA 2YWNA 2CV4A 2WZ9A 4F2IA 3EYTA 1PD21 3IOSA 4D73B 5DVBA 1ZYQB 3TJGA 4PNGA 4BL7B 1G6WA 4D73A 5G1LA 1TTZA 4TVEA 4XTSA 2LQQA 2CZ3A 1TU7A 3DEXA 3DRNA 3A5WA 4DSQA 1O6JA 2LNTA 3HVVA 1B48A 5GAND 2X49A 4O92A 1NHYA 3DGQA 5ENUA 1K3YA 4FXYP 4ZB7A 2JZTA 3TRQA 5CO3A 1VF1A 1PN9A 2H01A 2V6OA 4I8BA 1AUCA 1MDJA 1BEDA 2KUCA 2FWHA 3HCZA 3BBYA
chains in the Genus database with same CATH topology
3OR5A 3E0UA 3LFLA 5J5NA 4FYUA 1ML6A 5A5HB 1NSWA 3U5RE 4N30A 1V40A 1O73A 1PQNA 2O7KA 2YN1A 1GSDA 4ECIA 1O81A 3MIXA 1TU8A 4IGJA 1DSBA 4K0NA 4X0XA 1K0OA 2FA4A 1OC3A 3IE3A 2GSRA 1FB6A 3GL5A 4AJ8A 1GSQA 3E3EA 1X0RA 2OE0A 3LJRA 3M9KA 2CVDA 2V6KA 2HSNB 2FCHA 3EE2A 1GSEA 3TKSA 4PXOA 4WETA 1AQVA 2HSNA 2YJ7A 4ZBBA 3KH7A 19GSA 3F6FA 2F9SA 5IO0A 1K0MA 2PMTA 4Q5QA 1ERTA 1FB0A 5AGYA 5IO2A 3TRXA 1WE0A 4YKFA 5ECNB 3CBUA 4GXZA 3DXBA 2I81A 2H73A 5DALB 4OFMA 2OA7A 2LTKA 4V2MA 5D96A 4HDEA 5JWQB 4XHMA 3KP8A 2L59A 5DALA 2X8GA 2LJAA 4K0GA 3PINA 4DSSB 3RPNA 2H8LA 1JLVA 3C8EA 5GAPD 5ECLB 4OCFA 2CX4A 4DSSA 4IJIA 1TKDB 2AYTA 4RQRA 5A5KA 3M3MA 3WT2A 5G1KA 1AQXA 2GVPA 4X4JA 2VAFA 2XPEA 1K0CA 4LL4B 4CW9A 2O87A 1JZRA 2DSAA 1Z5YE 4V2NA 3N5OA 1KTEA 2K6VA 1YEPA 1A24A 2VCQA 5HFIA 2XPDA 2VL2C 4MABA 1NHOA 4HZ4A 4N3ZA 1Z7PA 1XW6A 3M1GA 3L0HA 5DJMA 4PGTA 4WXTA 5CREA 3F3QA 3VPTA 3HJMA 3FZ4A 2M80A 4TRXA 4WR5A 1SL2B 4ZB8A 4PUAA 2B5EA 3VWXA 2DJ1A 1WRYA 4GSSA 4AF2A 1FVJA 4W66A 2IMFA 4MMMA 4BWQA 3IV4A 2R3XA 1USBA 1F3BA 1SKWB 2FD3A 4JR6A 4E8EA 4QL9A 3ZVJD 4OO4A 5FHIA 1M2BA 1XCCA 1Z3EA 4HUAA 2FHEA 4QQ7A 5DQYA 4GSTA 3H4KA 2PGTA 1U87A 2YANA 1XWBA 4MPGA 3BD2A 1DUGA 1SYRA 5IMVA 2WJUA 3D5JA 2V32A 1THXA 5G5FA 2LRTA 2LKUA 5HR3A 3P2AA 3RAZA 3ZIJA 3FW2A 1GH2A 2IMDA 1A0RP 4ZL8A 2MMOA 2A4HA 2B7KA 1F9MA 3KXOA 3ED3A 3F3RA 4AI6A 2NTOA 5ELGA 1HYUA 4MLYA 5A4UA 3HKRA 1HD2A 1QUWA 1AC1A 1X5CA 3LORA 1TRSA 3CSHA 4ZBAA 1IYHA 3EU4A 2A2PA 2MZCA 1FAAA 5CP1A 5G31A 12GSA 2HSYA 4N10A 2LJRA 1GSFA 3GIXA 1X9WB 6GSVA 4L5OA 2C0GA 4ML1A 5EVOA 3EC3A 5HR2A 2VLTA 4GLTA 2BJXA 3IR4A 1MEKA 4GRFA 3HMJG 2JZSA 3G7IA 5D9VA 5IM9A 1A8YA 5DAKB 1T00A 2HFDA 2V1MA 2VO4A 2DIYA 4FQUA 1CQGA 4IN0A 4EF0A 4POBA 5DAKA 1SU9A 2L57A 2FY6A 4O5UA 1OAZA 5J40A 4G0LA 3ZYWA 1XFLA 4FO5A 2I4AA 2GZZA 1R7HA 4Z2RA 3GN3A 3FZ9A 1E6BA 4FH8A 5J9CA 4POKA 4E8HA 4NMUA 4IQAA 4MCUA 1BG5A 3CRUA 5JWOB 1B4PA 2V2GA 4YAPA 4K7IA 2QGVA 4DEJA 3QPMA 4KA0A 2MMZA 3N9JA 1M9AA 4BVYB 2CQ9A 1XXUA 4E68A 1FOVA 3F8UA 4BVYA 4K7OA 3V1WA 3TKPA 4TR1A 3ERFA 4GQCA 3CSIA 2H0HA 4YAVA 5D9TA 1OVNA 1F6MC 5DCHA 1PX6A 2PPTA 1E2YA 4J2FA 3CYNA 5DCGA 5J4YA 4MZBA 3GFKA 2MBSA 6GSWA 2IMEA 3UVTA 2PBJA 2B7JA 4NHWA 2L6DA 4FIWA 2CAQA 1GLQA 3UARA 2EFHA 2RLIA 4TKYA 4GSNA 2WULA 5LD0A 1B9YC 1G6YA 2C8UA 3QMXA 4BVXB 4LL1B 3C73A 4JR4A 4I2TA 5EY6A 5IPGA 4PQIA 5D9XA 1SJ6A 3PH9A 3UJ1A 1ZYPA 1XVQA 3ZTLA 1O8XA 22GSA 2AV4A 3D6IA 3HYPA 2A4VA 4AJ6A 1X5DA 1XVWA 3L78A 3F4SA 3F0IA 3H79A 3W8SA 1PL1A 4CY8A 5G5EA 1XWCA 3MDKA 2R4VA 2CX3A 3TU3B 2VCTA 2YWIA 14GSA 2GZYA 1RQMA 1J9BA 2J23A 4ECBA 4KH7A 3APSA 5D93A 1B4QA 3EVIA 2H75A 2WB9A 5HR1A 2P5RA 1GTAA 1BQ7A 1PL2A 3CTFA 4HJMA 4KDUA 2DMLA 1GSYA 4L0WA 2HSHA 1G7EA 1EOHA 3HXSA 2C3QA 1ABAA 1GTIA 2GT6A 1SD9A 1TI1A 3LGCA 1NW2A 2H1LA 4EDYA 2N5AA 2GQKA 2H0GA 3VK9A 5EL8A 3G7YA 3ZL5A 2CAIA 3ZREA 2I3YA 3KMOA 4KSOA 5LCZA 1A23A 3ZITA 1ERVA 1GULA 1QK8A 1R5PA 4V1Ap 5KN1A 4KB3A 2H6ZA 1QQ2A 2IN3A 3I9V2 3GURA 4I97A 3KMNA 2B3SA 3GH6A 4OFNA 4K2DA 3C1RA 4NV2A 1YZXA 4RI6A 4ZILA 2WFCA 2GDRA 4IELA 4RUVA 1H75A 4HQSA 5IMFA 2NVLA 3KTLA 4ZL7A 5J4UA 2QC7A 3TOTA 4KSMA 1TXXA 4JRRA 2WDUA 2GSTA 2DMMA 4K7NA 3KD0A 5KN3A 5JCWA 2G0FA 4Q5FA 4YQUA 3DYRA 3G9BA 3CRTA 2VD0A 4KNDA 3L4NA 2H76A 3UMAA 2GLRA 4G01A 2RIIA 13GSA 5C00A 3KJYA 4PTSA 4PX1A 1YY7A 4N0VA 4BL7A 5J4VA 4IJ3A 3DKSA 3D0ZA 5B7CA 4I5QA 2JACA 4OCEA 3FR9A 4LA1A 5ECOB 4PURA 1T1VA 5AISA 3LQ7A 2M72A 2B5XA 1SYXA 2KP1A 2GSQA 2VCWA 4WEYA 4I2UA 3VLNA 1AQWA 1T8EB 5COHA 4LMWA 2LSTA 3EWLA 3GL3A 1XWAA 2DBCA 2IFQB 1K0NA 5A5HA 1W89A 3GSSA 3HZ4A 3TKRA 1JFUA 5L71A 1HQOA 4MK3A 2GZPA 2IFQA 2VLUA 4KE3A 2OE1A 1Y6EA 4PUFC 4PQ1A 3EU3A 4DVCA 2F3MA 3IPZA 4JE1A 5F06A 3QFAC 3IC4A 1M0UA 2H70A 3VWUA 2HRKB 3P90A 3HD5A 2CVKA 3KCMA 3CTGA 1U6TA 2ALBA 1Z6MA 2HRKA 1WJKA 3K8NA 5G30A 4YKGA 3IHGA 5D73A 2D2ZA 3M9JA 1AW9A 2NBSA 2KLXA 2YV9A 4G10A 1MD4A 4PQHA 2H1AA 2TRXA 3DVWA 4KCAA 1PX7A 3TRPA 2CZ2A 1KEBA 3H8QA 2CA8A 2XC2A 3EINA 2BTOT 4A5PA 2CVBA 1A8LA 3E9JB 4KF9A 1OC8A 1V98A 2O8VB 4WBRD 3MWHA 1EV4A 5GSTA 5IMZA 1HNCA 2VUPA 4FYCA 4CDOA 1OE8A 2H1GA 4HJ2A 1ILOA 2RUFA 4MF7A 3QOUA 2LEGA 3FZ5A 2HZEB 5GZZB 1WPIA 6GSXA 5H5QA 5KN2A 2IMIA 2HZEA 3MNGA 4G2EA 2H6YA 1RK4A 2JZRA 3F4RA 1ZMAA 5CAXA 4IQ1A 3RDWA 1GTUA 5INYA 3LXTA 4AGSA 2HQTA 2F8FA 4ZXGA 2VOCA 1G0TA 1I5GA 3UBKA 1F3AA 2X4AA 3PGTA 3FMWA 3GRXA 4HOJA 2K18A 5ECSA 1DE2A 1BX9A 2EFDA 4TR0A 2JADA 4ICYA 3ISOA 3IDVA 4O32A 2FGXA 2IPAA 4HU7A 1TOFA 4USSA 1PKZA 4TW5A 4GF0A 1TXUA 2H0IA 4EUYA 1HNAA 4QL7A 3S9FA 5ECIB 1NM3A 3KEBA 2R5GA 4J57E 1OYJA 5F0GA 3A2VA 1O85A 1Q98A 4F03A 2F51A 4EO3A 2N5BA 2HNLA 2GQMA 1GNEA 10GSA 3WD6A 3KGKA 3QCPA 4KAEA 4IHUA 5KOXA 1UVZA 4OFTA 4POMA 3QDNA 1ZZYA 3IHQA 4ECCA 5AIXA 3P8WA 3C7MA 4LMVA 1JLWA 2DJ2A 3M0FA 3CWGA 3TKSC 3UL3A 3FR3A 1DE1A 1EP8A 2L6CA 2PUKC 1K3LA 1N8JA 3I43A 5CYYA 3VURA 1MDIA 2C1YA 4GCIA 3DWVA 2AHEA 4QMKA 5GSSA 2K8SA 1ZOFA 5B6NA 3KP9A 2MMAA 3ME8A 1SL0B 3F63A 5AN1A 2NPBA 4O7HA 3IRAA 2C80A 5E4WA 2OACA 1GUMA 1BF5A 4MJAA 1SKRB 3FY7A 2E2MA 3HA9A 1YEXA 1X9MB 2HRNA 1WOUA 4AKIA 17GSA 1TRVA 4HS1A 5HQPA 1VGLA 1AAZA 3TJBA 5HFGA 1A2JA 6GSUA 3GUSA 3IA1A 4ILFA 2R37A 2RM5A 1LU4A 3RHBA 1F2EA 3ZMLA 2EIRA 1A0FA 3GA4A 2FLSA 1XW9A 2JSZA 3G7JA 3I69A 3DMLA 2OJLA 4K5RA 1R26A 6GSYA 2HT9A 4HU9A 2YP6A 3QR6A 4NWYA 2ON5A 2EFEA 2FNOA 1RW1A 4XIHA 1SJIA 4XRDA 4ISDA 2VCVA 1VRSD 8GSSA 4X1UA 2J9HA 2HSMB 4H86A 3FHKA 1SVLA 2AJQB 1XBSA 3HHVA 2HSMA 4KW6A 4WBJA 1FO5A 1FW1A 1Y1UA 4MJEA 3US3A 5J41A 1GNWA 5IMCA 4F0BA 5CRDA 3PPUA 2QA1A 2I1UA 5ECHB 4MDCA 3VPQA 3WGXA 5KEJA 1TRUA 3GKKA 4TN8A 2WGRA 3GH9A 2DKHA 3GTUB 5IPHA 2R6KA 1BJXA 2C4JA 3L9VA 3O76A 4JU5A 5A1NB 4L0UA 2R2JA 3GTUA 3TJKA 2KHPA 1URMA 4ZB9A 3QD9A 1ON4A 4ZB6A 3A3TA 1N25A 1WIKA 3GNJA 4BVXA 5A1NA 2R0CA 1GL8A 3DIEA 5DJLA 4KDXA 1V9WA 2GQLA 2VKZG 1SJZA 1TK8B 4HI7A 2L4QA 2VL9A 4TR4A 5ID2B 1ST9A 2HLSA 4XS4B 2L4CA 5EPFA 2L5OA 2QA2A 2MBTA 4G9HA 1ERWA 5DDLA 5ID2A 3WGDA 1S3CA 1C72A 4K6XA 4XS4A 4POLA 2MYGA 1B8XA 3WYWA 2O85A 2PWJA 3W8JA 4MJBA 4K5SA 2YZUA 3KM6A 1J0FA 3O6TA 3TJJA 2YZHA 3W6GA 2YNXA 2VM1A 3C71A 1OC9B 2LS5A 4Q5RA 4J56E 1FOHA 4MF6A 1AIUA 4G0IA 5HFKA 2K9FA 1OC9A 3CSJA 4F0CA 1S3AA 2X8HA 1UC7A 2H71A 3FEUA 4HZ2A 5JCUA 1GRXA 2H66A 3Q18A 6GSTA 1M99A 1PN0A 1K0DA 2TRCP 4YH2A 4XCSA 5F07A 3R2QA 5CRWA 4MH2A 4OD7A 1UN2A 4YQVA 1XOAA 4RI7A 2C0EA 5DBQA 3GYKA 4GDFA 1UA5A 3EMXA 1U3IA 1JZOA 1T3BA 3FZAA 3QFBC 5A4VA 3ZFBA 4ZIJA 1XPVA 4MNNA 4TOPA 4AKGA 3BJ5A 4HQZA 2E2GA 1PA3A 3LSZA 4GTUA 2FWEA 11GSA 2DIZA 2FA8A 1XOBA 4Z2UA 1GUHA 4JZQA 4MZCA 5BRTA 1M2DA 1JZWA 4N11A 3CMIA 1GP1A 2M46A 4O5QA 5ABRA 2HZFA 20GSA 4K9ZA 1X5EA 2BMXA 3BCKA 4MF5A 3VWWA 3FR6A 3HDCA 1U3AA 2DJKA 2PERA 2I9HA 1ZGNA 5IMDA 3APQA 3FYGA 3EURA 2IWTA 2YWOA 5CRHA 2AAWA 1PMTA 3TUEA 3F9UA 5IOXA 3GV1A 2YJHA 3H1NA 2EC4A 5IOWA 3UIWA 2VL2A 4OO5A 4Q5NA 4KX4A 1SK2A 3IC8A 3J7Yb 3D21A 1EP7A 1T4ZA 2ZCTA 5D8IA 3L9SA 5C04A 2X8CA 2YPMA 2JU5A 3U6VA 2QKEA 4O5RA 3SBCA 3TKSE 1TI3A 2GS3A 2X99A 1H4OA 1OE7A 5B8AA 2C0FA 3SWLA 4OMVA 2OKAA 1V58A 3LXZA 1GSUA 2H1BA 1SVMA 4EIQA 1QGVA 1TK5B 4IP6A 3IAS2 1ZCPA 4K2XA 1V2AA 1YKAA 2V41A 3BOAA 4YQMA 3MSZA 2X64A 3D4TA 3APOA 3F6DA 5F8BA 4LLRA 2GGTA 4DSRA 3J7Yk 3AY8A 3Q6OA 4NXIA 1Z7RA 3JCML 1OKTA 1SL1B 2LUSA 4XS6A 4MZWA 3A2XA 2OE3A 2VLVA 3C1SA 1YQ1A 1AXDA 5ECQB 1BAYA 2VL3A 1ZYEA 3FRCA 4ACSA 4ML6A 1YF1A 1M2AA 3EMPA 3QAWA 4MPFA 3LEFA 1TRWA 2OBKA 3HJOA 1A2LA 3IBHA 2DLXA 2H72A 3I6AA 3R3EA 2H6XA 2WS2A 5J47A 2R0GA 1MD3A 3VWVA 3H93A 3ZMKA 1XWGA 1LJRA 3F4TA 1O7UA 3VFIA 1EGOA 1FG4A 2YV7A 3CXGA 2PN8A 2IL3A 2N5FA 3ZVJA 1FVKA 3ZZXA 3TGZA 2WRTA 3L9UA 3A5IA 3PR8A 2DJ3A 4IP1A 1PKWA 4TR3A 4NV5A 4BPYA 2MMNA 1OKDA 3TDGA 2GSSA 1K3OA 2OT3A 5IQYA 5ECRB 2R0PA 1GUKA 1XWKA 4MP4A 4EKZA 4NPBA 1TDIA 1IYIA 5AIVA 2YOIA 4WF5A 4GQFA 3HJPA 5ELAA 1ERUA 4BWSA 1M9BA 1YKCA 5J9BA 2AB6A 5ECPB 2FUG2 3D22A 4V1Ag 1I9DA 1G7OA 2JL4A 5JCGA 2ES7A 2H1DA 18GSA 2JSYA 3GHAA 3VI7A 3HY2A 1A2MA 3LYPA 2EIOA 4EE0A 3RPPA 3LYKA 4TXVA 1MTCA 1TW9A 1THOA 2UV8G 1CQHA 2LV3A 2TIRA 3QAGA 2DKIA 2XHFA 2YCDA 1K0AA 3TJFA 1YF0A 4AJ7A 5JWRB 1TK0B 1LBKA 5A4WA 2DC5A 5IIZA 5IMAA 4F82A 3IK7A 2A2RA 3FKFA 3MYDA 1GLPA 3LWAA 1KNGA 2NDOA 5FT3A 4K1FA 1Z9HA 3DVXA 2KP2A 5F05A 1GSSA 1QFNA 4ZBDA 3NOFA 3NIVA 2B1LA 3MAKA 2VD1A 2FWFA 1XZOA 3EPTA 3A2WA 3LG6A 5FWGA 1M7TA 5CNWA 1DBYA 2GTUA 1Y25A 1SD8A 1V57A 4MJCA 1SK1A 3ZLPA 4ID0A 5G2ZA 4L5LA 1JHBA 4F9ZA 2UZ8A 4ZL9A 1FHEA 1EGRA 3D4MA 4MA9A 2B5YA 3GKMA 3IXRA 4P3YB 4IVFA 2HXKA 3BCIA 2WCIA 4EDZA 1Q4JA 3GX0A 1T4YA 2HRAA 4XRAA 1WMJA 2LNSA 4CY6A 3TB2A 1BYEA 3GSTA 4CHSA 1SENA 1VF2A 1W4VA 4HEA2 4PNFA 4G19A 1XW5A 4MH3A 4IW9A 1EZKA 3FK8A 1R5AA 3GMFA 4JBBA 2GT5A 3HZ8A 2VCXA 1EV9A 1PGTA 2C0DA 5LNKe 3KZQA 5H5SA 2DJJA 2EFCA 1K0BA 1O8WA 2A2SA 2OADA 3RBTA 2C3TA 2L5LA 1QXHA 1S3DA 3DD3A 3M8NA 5B8BA 5E59A 4NHZA 2H19A 2FWGA 5ECMB 1F37A 2IJYA 2LRNA 1YJ6A 4I6XA 3ERGA 3QAVA 5KOWA 4EIPA 3IAM2 2H30A 4TR1B 3KIJA 4AKHA 2LRCA 1ACVA 2P5QA 4EVMA 3NZNA 2ZNMA 1ZL9A 3LW9A 5CRGA 4WKWA 2PU9C 1MDKA 2VM2A 1SKSB 4IS0A 2ON7A 3Q74A 3WGEA 4KDYA 3WT1A 2AUVA 2XBQA 3GKXA 4IBPA 2IIYA 1XIYA 3VI5A 2DJ0A 7GSSA 2E7PA 2RUEA 1YDKA 5J3RA 3TKQA 5H5RA 3KTBA 3ME7A 3GKNA 3UVHA 3ERWA 4K8MA 9GSSA 1EEMA 1ZYNA 4FYBA 4EXJA 4Z2TA 5D9WA 2K8VA 2LJKA 2VIMA 3TCOA 1PSQA 4L8EA 3ZFLA 1WP0A 4BA7A 1J08A 1BG1A 3HVXA 2OBIA 3IK9A 3P7XA 1EWXA 4OWYA 4RQXA 2HI7A 5A34B 2XBIA 2F8AA 2HE3A 1Z6NA 2HRFA 1HNBA 5A34A 1WWJA 4N0ZA 2VCZA 4KCEA 2REMA 4G0KA 2YWMA 1YVLA 1SVOA 1X9SB 3UOMA 2O5VA 2LQOA 4XS1A 1PRXA 2G2QA 3UAPA 2ZUPA 2PVOC 3O3TA 1VF3A 4X43A 4TXOB 1GWCA 1T7PB 1U88A 2H74A 4ULXA 4WR4A 2B6MA 4TXOA 2HYXA 5ECKB 2KOKA 4EL1A 2P31A 4IKHA 1B9XC 1R4WA 4GWRA 2PVQA 16GSA 4JEDA 6GSSA 3UEMA 2CT6A 1TJDA 3KH9A 1QMVA 5BMUB 1GTBA 5KN0A 3ZRDA 3ZIVA 1N2AA 2RM6A 5BMUA 4V2LA 2IMKA 1EEJA 4AKXB 4EC0A 3TOUA 1KBNA 1TP9A 3RHCA 1EOGA 1JZDA 4Z7XA 3Q19A 4KUNA 4ECJA 3HVSA 1SK0A 4WF4A 2QSIA 2O89A 5B6MA 5DQSA 1VF4A 5HR0A 2E0QA 2P0GA 3GX8A 4NAXA 2Z9SA 4KGIA 2B1KA 2C3NA 3UBLA 2EIQA 2YWNA 2CV4A 2WZ9A 4F2IA 3EYTA 1PD21 3IOSA 4D73B 5DVBA 1ZYQB 3TJGA 4PNGA 4BL7B 1G6WA 4D73A 5G1LA 1TTZA 4TVEA 4XTSA 2LQQA 2CZ3A 1TU7A 3DEXA 3DRNA 3A5WA 4DSQA 1O6JA 2LNTA 3HVVA 1B48A 5GAND 2X49A 4O92A 1NHYA 3DGQA 5ENUA 1K3YA 4ZB7A 2JZTA 3TRQA 5CO3A 1VF1A 1PN9A 2H01A 2V6OA 4I8BA 1AUCA 1MDJA 1BEDA 2KUCA 2FWHA 3HCZA 3BBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OR5 A;  3E0U A;  3LFL A;  5J5N A;  4FYU A;  1ML6 A;  1NSW A;  3U5R E;  4N30 A;  1V40 A;  1O73 A;  1PQN A;  2O7K A;  2YN1 A;  1GSD A;  4ECI A;  1O81 A;  1TU8 A;  4IGJ A;  1DSB A;  4K0N A;  4X0X A;  1K0O A;  2FA4 A;  1OC3 A;  3IE3 A;  2GSR A;  1FB6 A;  3GL5 A;  4AJ8 A;  1GSQ A;  3E3E A;  1X0R A;  2OE0 A;  3LJR A;  3M9K A;  2CVD A;  2V6K A;  2HSN B;  2FCH A;  3EE2 A;  1GSE A;  3TKS A;  4PXO A;  4WET A;  1AQV A;  2YJ7 A;  4ZBB A;  3KH7 A;  19GS A;  3F6F A;  2F9S A;  5IO0 A;  1K0M A;  2PMT A;  4Q5Q A;  1ERT A;  1FB0 A;  5AGY A;  5IO2 A;  3TRX A;  1WE0 A;  5ECN B;  3CBU A;  4GXZ A;  3DXB A;  2I81 A;  2H73 A;  5DAL B;  4OFM A;  2OA7 A;  2LTK A;  4V2M A;  5D96 A;  4HDE A;  5JWQ B;  4XHM A;  3KP8 A;  2L59 A;  5DAL A;  2X8G A;  2LJA A;  4K0G A;  3PIN A;  4DSS B;  3RPN A;  2H8L A;  1JLV A;  3C8E A;  5GAP D;  5ECL B;  4OCF A;  2CX4 A;  4DSS A;  4IJI A;  1TKD B;  2AYT A;  4RQR A;  5A5K A;  3M3M A;  3WT2 A;  5G1K A;  1AQX A;  2GVP A;  2VAF A;  2XPE A;  1K0C A;  4LL4 B;  4CW9 A;  2O87 A;  1JZR A;  2DSA A;  1Z5Y E;  4V2N A;  3N5O A;  1KTE A;  2K6V A;  1YEP A;  1A24 A;  2VCQ A;  5HFI A;  2XPD A;  2VL2 C;  4MAB A;  1NHO A;  4HZ4 A;  1Z7P A;  1XW6 A;  3M1G A;  3L0H A;  5DJM A;  4PGT A;  4WXT A;  5CRE A;  3F3Q A;  3VPT A;  3HJM A;  3FZ4 A;  2M80 A;  4TRX A;  4WR5 A;  1SL2 B;  4ZB8 A;  4PUA A;  2B5E A;  3VWX A;  2DJ1 A;  1WRY A;  4GSS A;  4AF2 A;  1FVJ A;  2IMF A;  4MMM A;  4BWQ A;  3IV4 A;  2R3X A;  1USB A;  1F3B A;  1SKW B;  2FD3 A;  4JR6 A;  4E8E A;  4QL9 A;  3ZVJ D;  4OO4 A;  5FHI A;  1M2B A;  1XCC A;  1Z3E A;  4HUA A;  2FHE A;  4QQ7 A;  5DQY A;  4GST A;  3H4K A;  2PGT A;  1U87 A;  2YAN A;  1XWB A;  4MPG A;  3BD2 A;  1DUG A;  1SYR A;  5IMV A;  2WJU A;  3D5J A;  2V32 A;  1THX A;  5G5F A;  2LRT A;  2LKU A;  5HR3 A;  3P2A A;  3RAZ A;  3ZIJ A;  3FW2 A;  1GH2 A;  2IMD A;  1A0R P;  4ZL8 A;  2MMO A;  2B7K A;  1F9M A;  3KXO A;  3ED3 A;  3F3R A;  2NTO A;  5ELG A;  1HYU A;  4MLY A;  5A4U A;  3HKR A;  1HD2 A;  1QUW A;  1AC1 A;  1X5C A;  3LOR A;  1TRS A;  3CSH A;  4ZBA A;  1IYH A;  3EU4 A;  2MZC A;  1FAA A;  5CP1 A;  5G31 A;  12GS A;  2HSY A;  4N10 A;  2LJR A;  1GSF A;  3GIX A;  1X9W B;  6GSV A;  4L5O A;  2C0G A;  4ML1 A;  5EVO A;  3EC3 A;  5HR2 A;  2VLT A;  4GLT A;  2BJX A;  3IR4 A;  1MEK A;  4GRF A;  2JZS A;  3G7I A;  5D9V A;  5IM9 A;  1A8Y A;  5DAK B;  1T00 A;  2HFD A;  2V1M A;  2VO4 A;  2DIY A;  4FQU A;  1CQG A;  4IN0 A;  4EF0 A;  4POB A;  5DAK A;  1SU9 A;  2L57 A;  2FY6 A;  1OAZ A;  4G0L A;  3ZYW A;  1XFL A;  4FO5 A;  2I4A A;  2GZZ A;  1R7H A;  3GN3 A;  3FZ9 A;  1E6B A;  4FH8 A;  5J9C A;  4POK A;  4E8H A;  4NMU A;  4IQA A;  4MCU A;  1BG5 A;  3CRU A;  5JWO B;  1B4P A;  2V2G A;  4YAP A;  4K7I A;  2QGV A;  4DEJ A;  3QPM A;  4KA0 A;  2MMZ A;  3N9J A;  1M9A A;  4BVY B;  2CQ9 A;  1XXU A;  1FOV A;  3F8U A;  4BVY A;  4K7O A;  3V1W A;  3TKP A;  4TR1 A;  3ERF A;  4GQC A;  3CSI A;  2H0H A;  4YAV A;  5D9T A;  1OVN A;  1F6M C;  5DCH A;  1PX6 A;  2PPT A;  1E2Y A;  4J2F A;  5DCG A;  3CYN A;  4MZB A;  3GFK A;  2MBS A;  6GSW A;  2IME A;  3UVT A;  2PBJ A;  2B7J A;  4NHW A;  2L6D A;  4FIW A;  2CAQ A;  1GLQ A;  3UAR A;  2RLI A;  4TKY A;  4GSN A;  2WUL A;  5LD0 A;  1B9Y C;  1G6Y A;  2C8U A;  3QMX A;  4BVX B;  4LL1 B;  3C73 A;  4JR4 A;  4I2T A;  5EY6 A;  5IPG A;  4PQI A;  5D9X A;  1SJ6 A;  3PH9 A;  3UJ1 A;  1XVQ A;  3ZTL A;  1O8X A;  22GS A;  2AV4 A;  3D6I A;  3HYP A;  2A4V A;  4AJ6 A;  1X5D A;  1XVW A;  3L78 A;  3F4S A;  3F0I A;  3H79 A;  3W8S A;  1PL1 A;  5G5E A;  1XWC A;  3MDK A;  2R4V A;  2CX3 A;  2VCT A;  2YWI A;  14GS A;  2GZY A;  1RQM A;  1J9B A;  2J23 A;  4ECB A;  4KH7 A;  3APS A;  5D93 A;  1B4Q A;  3EVI A;  2H75 A;  2WB9 A;  5HR1 A;  2P5R A;  1GTA A;  1BQ7 A;  1PL2 A;  3CTF A;  4HJM A;  4KDU A;  2DML A;  1GSY A;  4L0W A;  2HSH A;  1G7E A;  1EOH A;  3HXS A;  2C3Q A;  1ABA A;  1GTI A;  2GT6 A;  1SD9 A;  1TI1 A;  3LGC A;  1NW2 A;  4EDY A;  2N5A A;  2GQK A;  2H0G A;  3VK9 A;  5EL8 A;  3G7Y A;  3ZL5 A;  2CAI A;  3ZRE A;  2I3Y A;  3KMO A;  4KSO A;  5LCZ A;  1A23 A;  3ZIT A;  1ERV A;  1GUL A;  1QK8 A;  1R5P A;  4V1A p;  5KN1 A;  4KB3 A;  2H6Z A;  1QQ2 A;  2IN3 A;  3I9V 2;  3GUR A;  4I97 A;  3KMN A;  2B3S A;  3GH6 A;  4OFN A;  4K2D A;  3C1R A;  4NV2 A;  1YZX A;  4RI6 A;  4ZIL A;  2WFC A;  2GDR A;  4IEL A;  4RUV A;  1H75 A;  4HQS A;  5IMF A;  2NVL A;  3KTL A;  4ZL7 A;  5J4U A;  2QC7 A;  3TOT A;  4KSM A;  1TXX A;  4JRR A;  2WDU A;  2GST A;  2DMM A;  4K7N A;  3KD0 A;  5KN3 A;  5JCW A;  2G0F A;  4Q5F A;  4YQU A;  3DYR A;  3G9B A;  3CRT A;  2VD0 A;  4KND A;  3L4N A;  2H76 A;  3UMA A;  2GLR A;  2RII A;  5C00 A;  13GS A;  3KJY A;  4PTS A;  4PX1 A;  1YY7 A;  4N0V A;  4BL7 A;  4IJ3 A;  3DKS A;  3D0Z A;  5B7C A;  4I5Q A;  2JAC A;  4OCE A;  3FR9 A;  4LA1 A;  5ECO B;  4PUR A;  1T1V A;  5AIS A;  3LQ7 A;  2M72 A;  2B5X A;  1SYX A;  2KP1 A;  2GSQ A;  2VCW A;  4WEY A;  4I2U A;  3VLN A;  1AQW A;  1T8E B;  5COH A;  4LMW A;  2LST A;  3EWL A;  3GL3 A;  1XWA A;  2DBC A;  2IFQ B;  1K0N A;  1W89 A;  3GSS A;  3HZ4 A;  3TKR A;  1JFU A;  5L71 A;  1HQO A;  4MK3 A;  2GZP A;  2IFQ A;  2VLU A;  4KE3 A;  2OE1 A;  1Y6E A;  4PUF C;  4PQ1 A;  3EU3 A;  4DVC A;  2F3M A;  3IPZ A;  4JE1 A;  5F06 A;  3QFA C;  3IC4 A;  1M0U A;  2H70 A;  3VWU A;  2HRK B;  3P90 A;  3HD5 A;  2CVK A;  3KCM A;  3CTG A;  1U6T A;  2ALB A;  1Z6M A;  2HRK A;  1WJK A;  3K8N A;  5G30 A;  5D73 A;  2D2Z A;  3M9J A;  1AW9 A;  2NBS A;  2KLX A;  2YV9 A;  4G10 A;  1MD4 A;  4PQH A;  2H1A A;  2TRX A;  3DVW A;  4KCA A;  1PX7 A;  3TRP A;  2CZ2 A;  1KEB A;  3H8Q A;  2CA8 A;  2XC2 A;  3EIN A;  2BTO T;  2CVB A;  1A8L A;  3E9J B;  4KF9 A;  1OC8 A;  1V98 A;  2O8V B;  4WBR D;  3MWH A;  1EV4 A;  5GST A;  5IMZ A;  1HNC A;  2VUP A;  4FYC A;  4CDO A;  1OE8 A;  2H1G A;  4HJ2 A;  1ILO A;  2RUF A;  4MF7 A;  3QOU A;  2LEG A;  3FZ5 A;  2HZE B;  5GZZ B;  1WPI A;  6GSX A;  5H5Q A;  5KN2 A;  2IMI A;  2HZE A;  3MNG A;  4G2E A;  2H6Y A;  1RK4 A;  2JZR A;  3F4R A;  1ZMA A;  5CAX A;  4IQ1 A;  3RDW A;  1GTU A;  5INY A;  3LXT A;  4AGS A;  2HQT A;  2F8F A;  4ZXG A;  2VOC A;  1G0T A;  1I5G A;  3UBK A;  1F3A A;  3PGT A;  3GRX A;  4HOJ A;  2K18 A;  5ECS A;  1DE2 A;  1BX9 A;  4TR0 A;  2JAD A;  3ISO A;  3IDV A;  4O32 A;  2FGX A;  2IPA A;  4HU7 A;  1TOF A;  4USS A;  1PKZ A;  4TW5 A;  4GF0 A;  2H0I A;  4EUY A;  1HNA A;  4QL7 A;  3S9F A;  5ECI B;  1NM3 A;  3KEB A;  2R5G A;  4J57 E;  1OYJ A;  5F0G A;  3A2V A;  1O85 A;  1Q98 A;  4F03 A;  2F51 A;  4EO3 A;  2N5B A;  2HNL A;  2GQM A;  1GNE A;  10GS A;  3WD6 A;  3KGK A;  3QCP A;  4KAE A;  4IHU A;  1UVZ A;  4OFT A;  4POM A;  3QDN A;  1ZZY A;  3IHQ A;  4ECC A;  5AIX A;  3P8W A;  3C7M A;  4LMV A;  1JLW A;  2DJ2 A;  3M0F A;  3TKS C;  3UL3 A;  3FR3 A;  1DE1 A;  1EP8 A;  2L6C A;  2PUK C;  1K3L A;  1N8J A;  3I43 A;  5CYY A;  3VUR A;  1MDI A;  2C1Y A;  4GCI A;  3DWV A;  2AHE A;  5GSS A;  2K8S A;  1ZOF A;  5B6N A;  3KP9 A;  2MMA A;  3ME8 A;  1SL0 B;  3F63 A;  5AN1 A;  2NPB A;  4O7H A;  3IRA A;  2C80 A;  5E4W A;  2OAC A;  1GUM A;  4MJA A;  1SKR B;  3FY7 A;  2E2M A;  3HA9 A;  1YEX A;  1X9M B;  2HRN A;  1WOU A;  17GS A;  1TRV A;  4HS1 A;  5HQP A;  1VGL A;  1AAZ A;  3TJB A;  5HFG A;  1A2J A;  6GSU A;  3GUS A;  3IA1 A;  4ILF A;  2R37 A;  2RM5 A;  1LU4 A;  3RHB A;  1F2E A;  3ZML A;  2EIR A;  1A0F A;  3GA4 A;  2FLS A;  1XW9 A;  2JSZ A;  3G7J A;  3I69 A;  3DML A;  2OJL A;  1R26 A;  6GSY A;  2HT9 A;  4HU9 A;  2YP6 A;  3QR6 A;  4NWY A;  2ON5 A;  2FNO A;  1RW1 A;  4XIH A;  1SJI A;  4XRD A;  4ISD A;  2VCV A;  1VRS D;  8GSS A;  4X1U A;  2J9H A;  2HSM B;  4H86 A;  3FHK A;  2AJQ B;  1XBS A;  3HHV A;  2HSM A;  4KW6 A;  4WBJ A;  1FO5 A;  1FW1 A;  4MJE A;  3US3 A;  5J41 A;  1GNW A;  5IMC A;  4F0B A;  5CRD A;  3PPU A;  2I1U A;  5ECH B;  4MDC A;  3VPQ A;  3WGX A;  5KEJ A;  1TRU A;  3GKK A;  4TN8 A;  2WGR A;  3GH9 A;  3GTU B;  5IPH A;  2R6K A;  1BJX A;  2C4J A;  3L9V A;  3O76 A;  4JU5 A;  4L0U A;  2R2J A;  3GTU A;  3TJK A;  2KHP A;  1URM A;  4ZB9 A;  3QD9 A;  1ON4 A;  4ZB6 A;  3A3T A;  1WIK A;  3GNJ A;  4BVX A;  1GL8 A;  3DIE A;  5DJL A;  4KDX A;  1V9W A;  2GQL A;  1SJZ A;  1TK8 B;  4HI7 A;  2L4Q A;  2VL9 A;  4TR4 A;  5ID2 B;  1ST9 A;  2HLS A;  4XS4 B;  2L4C A;  5EPF A;  2L5O A;  2MBT A;  4G9H A;  1ERW A;  5DDL A;  5ID2 A;  3WGD A;  1S3C A;  1C72 A;  4K6X A;  4XS4 A;  4POL A;  2MYG A;  1B8X A;  3WYW A;  2O85 A;  2PWJ A;  3W8J A;  4MJB A;  2YZU A;  3KM6 A;  1J0F A;  3O6T A;  3TJJ A;  2YZH A;  3W6G A;  2YNX A;  2VM1 A;  3C71 A;  1OC9 B;  2LS5 A;  4Q5R A;  4J56 E;  4MF6 A;  1AIU A;  4G0I A;  5HFK A;  2K9F A;  1OC9 A;  3CSJ A;  4F0C A;  1S3A A;  2X8H A;  1UC7 A;  2H71 A;  3FEU A;  4HZ2 A;  5JCU A;  1GRX A;  2H66 A;  3Q18 A;  6GST A;  1M99 A;  1K0D A;  2TRC P;  4YH2 A;  4XCS A;  5F07 A;  3R2Q A;  5CRW A;  4MH2 A;  4OD7 A;  1UN2 A;  4YQV A;  1XOA A;  4RI7 A;  2C0E A;  5DBQ A;  3GYK A;  1UA5 A;  3EMX A;  1U3I A;  1JZO A;  1T3B A;  3FZA A;  3QFB C;  5A4V A;  3ZFB A;  4ZIJ A;  1XPV A;  4TOP A;  3BJ5 A;  4HQZ A;  2E2G A;  1PA3 A;  3LSZ A;  4GTU A;  2FWE A;  11GS A;  2DIZ A;  2FA8 A;  1XOB A;  1GUH A;  4JZQ A;  4MZC A;  1M2D A;  1JZW A;  4N11 A;  3CMI A;  1GP1 A;  2M46 A;  5ABR A;  2HZF A;  20GS A;  4K9Z A;  1X5E A;  2BMX A;  3BCK A;  4MF5 A;  3VWW A;  3FR6 A;  3HDC A;  1U3A A;  2DJK A;  2PER A;  2I9H A;  1ZGN A;  5IMD A;  3APQ A;  3FYG A;  3EUR A;  2IWT A;  2YWO A;  5CRH A;  2AAW A;  1PMT A;  3TUE A;  3F9U A;  5IOX A;  3GV1 A;  2YJH A;  3H1N A;  2EC4 A;  5IOW A;  3UIW A;  2VL2 A;  4OO5 A;  4Q5N A;  4KX4 A;  1SK2 A;  3IC8 A;  3J7Y b;  3D21 A;  1EP7 A;  1T4Z A;  2ZCT A;  5D8I A;  3L9S A;  5C04 A;  2X8C A;  2YPM A;  2JU5 A;  3U6V A;  2QKE A;  4O5R A;  3SBC A;  3TKS E;  1TI3 A;  2GS3 A;  2X99 A;  1H4O A;  1OE7 A;  5B8A A;  2C0F A;  3SWL A;  4OMV A;  2OKA A;  1V58 A;  3LXZ A;  1GSU A;  2H1B A;  1QGV A;  1TK5 B;  4IP6 A;  3IAS 2;  1ZCP A;  1V2A A;  1YKA A;  2V41 A;  3BOA A;  4YQM A;  3MSZ A;  2X64 A;  3D4T A;  3APO A;  3F6D A;  5F8B A;  4LLR A;  2GGT A;  4DSR A;  3J7Y k;  3AY8 A;  3Q6O A;  4NXI A;  1Z7R A;  3JCM L;  1OKT A;  1SL1 B;  2LUS A;  4XS6 A;  4MZW A;  3A2X A;  2OE3 A;  2VLV A;  3C1S A;  1YQ1 A;  1AXD A;  5ECQ B;  1BAY A;  2VL3 A;  1ZYE A;  3FRC A;  4ACS A;  4ML6 A;  1YF1 A;  1M2A A;  3EMP A;  3QAW A;  4MPF A;  3LEF A;  1TRW A;  2OBK A;  3HJO A;  1A2L A;  3IBH A;  2DLX A;  2H72 A;  3I6A A;  3R3E A;  2H6X A;  2WS2 A;  1MD3 A;  3VWV A;  3H93 A;  3ZMK A;  1XWG A;  1LJR A;  3F4T A;  1O7U A;  3VFI A;  1EGO A;  1FG4 A;  2YV7 A;  3CXG A;  2PN8 A;  2IL3 A;  2N5F A;  3ZVJ A;  1FVK A;  3ZZX A;  3TGZ A;  2WRT A;  3L9U A;  3PR8 A;  2DJ3 A;  4IP1 A;  1PKW A;  4TR3 A;  4NV5 A;  4BPY A;  2MMN A;  1OKD A;  3TDG A;  2GSS A;  1K3O A;  5IQY A;  5ECR B;  1GUK A;  1XWK A;  4MP4 A;  4EKZ A;  4NPB A;  1TDI A;  1IYI A;  5AIV A;  2YOI A;  4WF5 A;  4GQF A;  3HJP A;  5ELA A;  1ERU A;  4BWS A;  1M9B A;  1YKC A;  5J9B A;  2AB6 A;  5ECP B;  2FUG 2;  3D22 A;  4V1A g;  1I9D A;  1G7O A;  2JL4 A;  5JCG A;  2ES7 A;  2H1D A;  18GS A;  2JSY A;  3GHA A;  3VI7 A;  3HY2 A;  1A2M A;  3LYP A;  2EIO A;  4EE0 A;  3RPP A;  3LYK A;  4TXV A;  1MTC A;  1TW9 A;  1THO A;  1CQH A;  2LV3 A;  2TIR A;  3QAG A;  2XHF A;  2YCD A;  1K0A A;  3TJF A;  1YF0 A;  4AJ7 A;  5JWR B;  1TK0 B;  1LBK A;  5A4W A;  2DC5 A;  5IIZ A;  5IMA A;  4F82 A;  3IK7 A;  2A2R A;  3FKF A;  1GLP A;  3LWA A;  1KNG A;  2NDO A;  5FT3 A;  4K1F A;  1Z9H A;  3DVX A;  2KP2 A;  5F05 A;  1GSS A;  1QFN A;  4ZBD A;  3NOF A;  3NIV A;  2B1L A;  3MAK A;  2VD1 A;  2FWF A;  1XZO A;  3A2W A;  3LG6 A;  5FWG A;  1M7T A;  5CNW A;  1DBY A;  2GTU A;  1Y25 A;  1SD8 A;  1V57 A;  4MJC A;  1SK1 A;  3ZLP A;  4ID0 A;  5G2Z A;  4L5L A;  1JHB A;  4F9Z A;  2UZ8 A;  4ZL9 A;  1FHE A;  1EGR A;  3D4M A;  4MA9 A;  2B5Y A;  3GKM A;  3IXR A;  4P3Y B;  4IVF A;  2HXK A;  3BCI A;  2WCI A;  4EDZ A;  1Q4J A;  3GX0 A;  1T4Y A;  2HRA A;  4XRA A;  1WMJ A;  2LNS A;  3TB2 A;  1BYE A;  3GST A;  4CHS A;  1SEN A;  1VF2 A;  1W4V A;  4HEA 2;  4PNF A;  4G19 A;  1XW5 A;  4MH3 A;  4IW9 A;  1EZK A;  3FK8 A;  1R5A A;  3GMF A;  4JBB A;  2GT5 A;  3HZ8 A;  2VCX A;  1EV9 A;  1PGT A;  2C0D A;  5LNK e;  3KZQ A;  5H5S A;  2DJJ A;  1K0B A;  1O8W A;  2A2S A;  2OAD A;  3RBT A;  2C3T A;  2L5L A;  1QXH A;  1S3D A;  3DD3 A;  3M8N A;  5B8B A;  5E59 A;  4NHZ A;  2H19 A;  2FWG A;  5ECM B;  1F37 A;  2IJY A;  2LRN A;  1YJ6 A;  4I6X A;  3ERG A;  3QAV A;  3IAM 2;  2H30 A;  4TR1 B;  3KIJ A;  2LRC A;  1ACV A;  2P5Q A;  4EVM A;  3NZN A;  2ZNM A;  1ZL9 A;  5CRG A;  4WKW A;  2PU9 C;  1MDK A;  2VM2 A;  1SKS B;  4IS0 A;  2ON7 A;  3Q74 A;  3WGE A;  4KDY A;  3WT1 A;  2AUV A;  2XBQ A;  3GKX A;  4IBP A;  2IIY A;  1XIY A;  3VI5 A;  2DJ0 A;  7GSS A;  2E7P A;  2RUE A;  1YDK A;  5J3R A;  3TKQ A;  5H5R A;  3KTB A;  3ME7 A;  3GKN A;  3UVH A;  3ERW A;  4K8M A;  9GSS A;  1EEM A;  4FYB A;  4EXJ A;  5D9W A;  2K8V A;  2LJK A;  2VIM A;  3TCO A;  1PSQ A;  4L8E A;  3ZFL A;  1WP0 A;  4BA7 A;  1J08 A;  3HVX A;  2OBI A;  3IK9 A;  3P7X A;  1EWX A;  4OWY A;  4RQX A;  2HI7 A;  2XBI A;  2F8A A;  2HE3 A;  1Z6N A;  2HRF A;  1HNB A;  1WWJ A;  4N0Z A;  2VCZ A;  4KCE A;  2REM A;  4G0K A;  2YWM A;  1X9S B;  3UOM A;  2LQO A;  4XS1 A;  1PRX A;  2G2Q A;  3UAP A;  2ZUP A;  2PVO C;  3O3T A;  1VF3 A;  4X43 A;  4TXO B;  1GWC A;  1T7P B;  1U88 A;  2H74 A;  4ULX A;  4WR4 A;  2B6M A;  4TXO A;  2HYX A;  5ECK B;  2KOK A;  4EL1 A;  2P31 A;  4IKH A;  1B9X C;  1R4W A;  4GWR A;  2PVQ A;  16GS A;  4JED A;  6GSS A;  3UEM A;  2CT6 A;  1TJD A;  3KH9 A;  1QMV A;  1GTB A;  5KN0 A;  3ZRD A;  3ZIV A;  1N2A A;  2RM6 A;  5BMU A;  4V2L A;  2IMK A;  1EEJ A;  4EC0 A;  3TOU A;  1KBN A;  1TP9 A;  3RHC A;  1EOG A;  1JZD A;  4Z7X A;  3Q19 A;  4KUN A;  4ECJ A;  3HVS A;  1SK0 A;  4WF4 A;  2QSI A;  2O89 A;  5B6M A;  5DQS A;  1VF4 A;  5HR0 A;  2E0Q A;  2P0G A;  3GX8 A;  4NAX A;  2Z9S A;  4KGI A;  2B1K A;  2C3N A;  3UBL A;  2EIQ A;  2YWN A;  2CV4 A;  2WZ9 A;  4F2I A;  3EYT A;  1PD2 1;  3IOS A;  4D73 B;  5DVB A;  1ZYQ B;  3TJG A;  4PNG A;  4BL7 B;  1G6W A;  4D73 A;  5G1L A;  1TTZ A;  4TVE A;  4XTS A;  2LQQ A;  2CZ3 A;  1TU7 A;  3DEX A;  3DRN A;  3A5W A;  4DSQ A;  1O6J A;  2LNT A;  3HVV A;  1B48 A;  5GAN D;  4O92 A;  1NHY A;  3DGQ A;  5ENU A;  1K3Y A;  2JZT A;  3TRQ A;  5CO3 A;  1VF1 A;  1PN9 A;  2H01 A;  2V6O A;  4I8B A;  1AUC A;  1MDJ A;  1BED A;  2KUC A;  2FWH A;  3HCZ A;  3BBY A; 
#chains in the Genus database with same CATH topology
 3OR5 A;  3E0U A;  3LFL A;  5J5N A;  4FYU A;  1ML6 A;  5A5H B;  1NSW A;  3U5R E;  4N30 A;  1V40 A;  1O73 A;  1PQN A;  2O7K A;  2YN1 A;  1GSD A;  4ECI A;  1O81 A;  3MIX A;  1TU8 A;  4IGJ A;  1DSB A;  4K0N A;  4X0X A;  1K0O A;  2FA4 A;  1OC3 A;  3IE3 A;  2GSR A;  1FB6 A;  3GL5 A;  4AJ8 A;  1GSQ A;  3E3E A;  1X0R A;  2OE0 A;  3LJR A;  3M9K A;  2CVD A;  2V6K A;  2HSN B;  2FCH A;  3EE2 A;  1GSE A;  3TKS A;  4PXO A;  4WET A;  1AQV A;  2HSN A;  2YJ7 A;  4ZBB A;  3KH7 A;  19GS A;  3F6F A;  2F9S A;  5IO0 A;  1K0M A;  2PMT A;  4Q5Q A;  1ERT A;  1FB0 A;  5AGY A;  5IO2 A;  3TRX A;  1WE0 A;  4YKF A;  5ECN B;  3CBU A;  4GXZ A;  3DXB A;  2I81 A;  2H73 A;  5DAL B;  4OFM A;  2OA7 A;  2LTK A;  4V2M A;  5D96 A;  4HDE A;  5JWQ B;  4XHM A;  3KP8 A;  2L59 A;  5DAL A;  2X8G A;  2LJA A;  4K0G A;  3PIN A;  4DSS B;  3RPN A;  2H8L A;  1JLV A;  3C8E A;  5GAP D;  5ECL B;  4OCF A;  2CX4 A;  4DSS A;  4IJI A;  1TKD B;  2AYT A;  4RQR A;  5A5K A;  3M3M A;  3WT2 A;  5G1K A;  1AQX A;  2GVP A;  4X4J A;  2VAF A;  2XPE A;  1K0C A;  4LL4 B;  4CW9 A;  2O87 A;  1JZR A;  2DSA A;  1Z5Y E;  4V2N A;  3N5O A;  1KTE A;  2K6V A;  1YEP A;  1A24 A;  2VCQ A;  5HFI A;  2XPD A;  2VL2 C;  4MAB A;  1NHO A;  4HZ4 A;  4N3Z A;  1Z7P A;  1XW6 A;  3M1G A;  3L0H A;  5DJM A;  4PGT A;  4WXT A;  5CRE A;  3F3Q A;  3VPT A;  3HJM A;  3FZ4 A;  2M80 A;  4TRX A;  4WR5 A;  1SL2 B;  4ZB8 A;  4PUA A;  2B5E A;  3VWX A;  2DJ1 A;  1WRY A;  4GSS A;  4AF2 A;  1FVJ A;  4W66 A;  2IMF A;  4MMM A;  4BWQ A;  3IV4 A;  2R3X A;  1USB A;  1F3B A;  1SKW B;  2FD3 A;  4JR6 A;  4E8E A;  4QL9 A;  3ZVJ D;  4OO4 A;  5FHI A;  1M2B A;  1XCC A;  1Z3E A;  4HUA A;  2FHE A;  4QQ7 A;  5DQY A;  4GST A;  2WW3 A;  3H4K A;  2PGT A;  1U87 A;  2YAN A;  1XWB A;  4MPG A;  3BD2 A;  1DUG A;  1SYR A;  5IMV A;  2WJU A;  3D5J A;  2V32 A;  1THX A;  5G5F A;  2LRT A;  2LKU A;  5HR3 A;  3P2A A;  3RAZ A;  3ZIJ A;  3FW2 A;  1I1I P;  1GH2 A;  2IMD A;  1A0R P;  4ZL8 A;  2MMO A;  2A4H A;  2B7K A;  1F9M A;  3KXO A;  3ED3 A;  3F3R A;  4AI6 A;  2NTO A;  5ELG A;  1HYU A;  4MLY A;  5A4U A;  3HKR A;  1HD2 A;  1QUW A;  1AC1 A;  1X5C A;  1S3R A;  3LOR A;  1TRS A;  3CSH A;  4ZBA A;  1IYH A;  3EU4 A;  2A2P A;  2MZC A;  1FAA A;  5CP1 A;  5G31 A;  12GS A;  2HSY A;  4N10 A;  2LJR A;  1GSF A;  3GIX A;  1X9W B;  6GSV A;  4L5O A;  2C0G A;  4ML1 A;  5EVO A;  3EC3 A;  5HR2 A;  2VLT A;  4GLT A;  2BJX A;  3IR4 A;  1MEK A;  4GRF A;  3HMJ G;  2JZS A;  3G7I A;  5D9V A;  5IM9 A;  1A8Y A;  5DAK B;  1T00 A;  2HFD A;  2V1M A;  2VO4 A;  2DIY A;  4FQU A;  1CQG A;  4IN0 A;  4EF0 A;  4POB A;  5DAK A;  1SU9 A;  2L57 A;  2FY6 A;  4O5U A;  1OAZ A;  5J40 A;  4G0L A;  3ZYW A;  1XFL A;  4FO5 A;  2I4A A;  2GZZ A;  1R7H A;  4Z2R A;  3GN3 A;  3FZ9 A;  1E6B A;  4FH8 A;  5J9C A;  4POK A;  4E8H A;  4NMU A;  4IQA A;  4MCU A;  1BG5 A;  3CRU A;  5JWO B;  1B4P A;  4HSC X;  2V2G A;  4YAP A;  4K7I A;  2QGV A;  4DEJ A;  3QPM A;  4KA0 A;  2MMZ A;  3N9J A;  1M9A A;  4BVY B;  2CQ9 A;  1XXU A;  4E68 A;  1FOV A;  3F8U A;  4BVY A;  4K7O A;  3V1W A;  3TKP A;  4TR1 A;  3ERF A;  4GQC A;  3CSI A;  2H0H A;  4YAV A;  5D9T A;  1OVN A;  1F6M C;  5DCH A;  1PX6 A;  2PPT A;  1E2Y A;  4J2F A;  3CYN A;  5DCG A;  5J4Y A;  4MZB A;  3GFK A;  2MBS A;  6GSW A;  2IME A;  3UVT A;  2PBJ A;  2B7J A;  4NHW A;  2L6D A;  3RGB C;  4FIW A;  2CAQ A;  1GLQ A;  3UAR A;  2EFH A;  2RLI A;  4TKY A;  4GSN A;  2WVY A;  2WUL A;  5LD0 A;  1B9Y C;  4PI2 C;  1G6Y A;  2C8U A;  3QMX A;  4BVX B;  4LL1 B;  3C73 A;  4JR4 A;  4I2T A;  5EY6 A;  5IPG A;  4PQI A;  5D9X A;  1SJ6 A;  3PH9 A;  3UJ1 A;  1ZYP A;  1XVQ A;  3ZTL A;  1O8X A;  22GS A;  2AV4 A;  3D6I A;  3HYP A;  2A4V A;  4AJ6 A;  1X5D A;  1XVW A;  3L78 A;  3F4S A;  3F0I A;  3H79 A;  3W8S A;  1PL1 A;  4CY8 A;  5G5E A;  1XWC A;  3MDK A;  2R4V A;  2CX3 A;  3TU3 B;  2VCT A;  2YWI A;  14GS A;  2GZY A;  1RQM A;  1J9B A;  2J23 A;  4ECB A;  4KH7 A;  3APS A;  5D93 A;  1B4Q A;  3EVI A;  2H75 A;  2WB9 A;  5HR1 A;  2P5R A;  1GTA A;  1BQ7 A;  1PL2 A;  3CTF A;  4HJM A;  4KDU A;  2DML A;  1GSY A;  4L0W A;  2HSH A;  1G7E A;  1EOH A;  3HXS A;  2C3Q A;  1ABA A;  1GTI A;  2GT6 A;  1SD9 A;  1TI1 A;  3LGC A;  1NW2 A;  2H1L A;  4EDY A;  2N5A A;  2GQK A;  2H0G A;  3VK9 A;  5EL8 A;  3G7Y A;  3ZL5 A;  2CAI A;  3ZRE A;  2I3Y A;  3KMO A;  4KSO A;  5LCZ A;  1A23 A;  3ZIT A;  1ERV A;  1GUL A;  1QK8 A;  1R5P A;  4V1A p;  5KN1 A;  4KB3 A;  2H6Z A;  1QQ2 A;  2IN3 A;  3I9V 2;  3GUR A;  4I97 A;  3KMN A;  2B3S A;  3GH6 A;  4OFN A;  4K2D A;  3C1R A;  4NV2 A;  1YZX A;  3RFR C;  4RI6 A;  4ZIL A;  2WFC A;  2GDR A;  4IEL A;  4RUV A;  1H75 A;  4HQS A;  5IMF A;  2NVL A;  3KTL A;  4ZL7 A;  5J4U A;  2QC7 A;  3TOT A;  4KSM A;  1TXX A;  4JRR A;  2WDU A;  2GST A;  2DMM A;  4K7N A;  2O36 A;  3KD0 A;  5KN3 A;  5JCW A;  2G0F A;  4Q5F A;  4YQU A;  3DYR A;  3G9B A;  3CRT A;  2VD0 A;  4KND A;  3L4N A;  2H76 A;  3UMA A;  2GLR A;  4G01 A;  2RII A;  13GS A;  5C00 A;  3KJY A;  1S4B P;  4PTS A;  4PX1 A;  1YY7 A;  4N0V A;  4BL7 A;  5J4V A;  4IJ3 A;  3DKS A;  3D0Z A;  5B7C A;  4I5Q A;  2JAC A;  4OCE A;  3FR9 A;  4LA1 A;  5ECO B;  4PUR A;  1T1V A;  5AIS A;  3LQ7 A;  2M72 A;  2B5X A;  1SYX A;  2KP1 A;  2GSQ A;  2VCW A;  4WEY A;  4I2U A;  3VLN A;  1AQW A;  1T8E B;  5COH A;  4LMW A;  2LST A;  3EWL A;  3GL3 A;  2WW0 A;  1XWA A;  2DBC A;  2IFQ B;  1K0N A;  5A5H A;  1W89 A;  3GSS A;  3HZ4 A;  3TKR A;  1JFU A;  5L71 A;  1HQO A;  4MK3 A;  2GZP A;  2IFQ A;  2VLU A;  4KE3 A;  2OE1 A;  1Y6E A;  4PUF C;  4PQ1 A;  3EU3 A;  4DVC A;  2F3M A;  3IPZ A;  4JE1 A;  5F06 A;  3QFA C;  3IC4 A;  1M0U A;  2H70 A;  3VWU A;  2HRK B;  3P90 A;  3HD5 A;  2CVK A;  3KCM A;  4PHZ C;  3CTG A;  1U6T A;  2ALB A;  1Z6M A;  2HRK A;  1WJK A;  3K8N A;  5G30 A;  4YKG A;  3IHG A;  5D73 A;  2D2Z A;  3M9J A;  1AW9 A;  2NBS A;  2KLX A;  2YV9 A;  4G10 A;  1MD4 A;  4PQH A;  2H1A A;  2TRX A;  3DVW A;  4KCA A;  1PX7 A;  3TRP A;  2CZ2 A;  1KEB A;  3H8Q A;  2CA8 A;  2XC2 A;  3EIN A;  2BTO T;  4A5P A;  2CVB A;  1A8L A;  3E9J B;  4KF9 A;  1OC8 A;  1V98 A;  2O8V B;  4WBR D;  3MWH A;  1EV4 A;  5GST A;  5IMZ A;  1HNC A;  2VUP A;  4FYC A;  4CDO A;  1OE8 A;  2H1G A;  4HJ2 A;  1ILO A;  2RUF A;  4MF7 A;  3QOU A;  2LEG A;  3FZ5 A;  2HZE B;  5GZZ B;  1WPI A;  6GSX A;  5H5Q A;  5KN2 A;  2IMI A;  2HZE A;  3MNG A;  4G2E A;  2H6Y A;  1RK4 A;  2JZR A;  3F4R A;  1ZMA A;  5CAX A;  2O3E A;  4IQ1 A;  3RDW A;  1GTU A;  5INY A;  3LXT A;  4AGS A;  2HQT A;  2F8F A;  4ZXG A;  2VOC A;  1G0T A;  1I5G A;  3UBK A;  1F3A A;  2X4A A;  3PGT A;  3FMW A;  3GRX A;  4HOJ A;  2K18 A;  5ECS A;  1DE2 A;  1BX9 A;  2EFD A;  4TR0 A;  2JAD A;  4ICY A;  3ISO A;  3IDV A;  4O32 A;  2FGX A;  2IPA A;  4HU7 A;  1TOF A;  4USS A;  1PKZ A;  4TW5 A;  4GF0 A;  1TXU A;  2H0I A;  4EUY A;  1HNA A;  4QL7 A;  3S9F A;  5ECI B;  1NM3 A;  3KEB A;  2R5G A;  4J57 E;  1OYJ A;  5F0G A;  3A2V A;  1O85 A;  1Q98 A;  4F03 A;  2F51 A;  4EO3 A;  2N5B A;  2HNL A;  2GQM A;  1GNE A;  10GS A;  3WD6 A;  3KGK A;  3QCP A;  4KAE A;  4IHU A;  5KOX A;  1UVZ A;  4OFT A;  4POM A;  3QDN A;  1ZZY A;  3IHQ A;  4ECC A;  5AIX A;  3P8W A;  3C7M A;  4LMV A;  1JLW A;  2DJ2 A;  3M0F A;  3CWG A;  3TKS C;  3UL3 A;  3FR3 A;  1DE1 A;  1EP8 A;  2L6C A;  2PUK C;  1K3L A;  1N8J A;  3I43 A;  5CYY A;  3VUR A;  1MDI A;  2C1Y A;  4GCI A;  3DWV A;  2AHE A;  4QMK A;  5GSS A;  2K8S A;  1ZOF A;  5B6N A;  3KP9 A;  2MMA A;  3ME8 A;  1SL0 B;  3F63 A;  5AN1 A;  2NPB A;  4O7H A;  3IRA A;  2C80 A;  5E4W A;  2OAC A;  1GUM A;  1BF5 A;  4MJA A;  1SKR B;  4PI0 C;  3FY7 A;  2E2M A;  3HA9 A;  1YEX A;  1X9M B;  2HRN A;  1WOU A;  4AKI A;  1XG8 A;  17GS A;  1TRV A;  4HS1 A;  5HQP A;  1VGL A;  1AAZ A;  3TJB A;  5HFG A;  1A2J A;  6GSU A;  3GUS A;  3IA1 A;  4ILF A;  2R37 A;  2RM5 A;  1LU4 A;  3RHB A;  1F2E A;  3ZML A;  2EIR A;  1A0F A;  3GA4 A;  2FLS A;  1XW9 A;  2JSZ A;  3G7J A;  3I69 A;  3DML A;  2OJL A;  4K5R A;  1R26 A;  6GSY A;  2HT9 A;  4HU9 A;  2YP6 A;  3QR6 A;  4NWY A;  2ON5 A;  2EFE A;  2FNO A;  1RW1 A;  4XIH A;  1SJI A;  4XRD A;  4ISD A;  2VCV A;  1VRS D;  8GSS A;  4X1U A;  2J9H A;  2HSM B;  4H86 A;  3FHK A;  1SVL A;  2AJQ B;  1XBS A;  3HHV A;  2HSM A;  4KW6 A;  4WBJ A;  1FO5 A;  1FW1 A;  1Y1U A;  4MJE A;  3US3 A;  5J41 A;  1GNW A;  5IMC A;  4F0B A;  5CRD A;  3PPU A;  2QA1 A;  2I1U A;  5ECH B;  4MDC A;  3VPQ A;  3WGX A;  5KEJ A;  1TRU A;  3GKK A;  4TN8 A;  2WGR A;  3GH9 A;  2DKH A;  3GTU B;  5IPH A;  2R6K A;  1BJX A;  2C4J A;  3L9V A;  3O76 A;  4JU5 A;  5A1N B;  4L0U A;  2R2J A;  3GTU A;  3TJK A;  2KHP A;  1URM A;  4ZB9 A;  3QD9 A;  1ON4 A;  4ZB6 A;  3A3T A;  1N25 A;  1WIK A;  3GNJ A;  4BVX A;  5A1N A;  2R0C A;  1GL8 A;  3DIE A;  5DJL A;  4KDX A;  1V9W A;  2GQL A;  2VKZ G;  1SJZ A;  1TK8 B;  4HI7 A;  2L4Q A;  2VL9 A;  4TR4 A;  5ID2 B;  1ST9 A;  2HLS A;  4XS4 B;  2L4C A;  5EPF A;  2L5O A;  2QA2 A;  2MBT A;  4G9H A;  1ERW A;  5DDL A;  5ID2 A;  3WGD A;  1S3C A;  1C72 A;  4K6X A;  4XS4 A;  4POL A;  2MYG A;  1B8X A;  3WYW A;  2O85 A;  2PWJ A;  3W8J A;  4MJB A;  4K5S A;  2YZU A;  3KM6 A;  1J0F A;  3O6T A;  3TJJ A;  2YZH A;  3W6G A;  2YNX A;  2VM1 A;  3C71 A;  1OC9 B;  2LS5 A;  4Q5R A;  4J56 E;  1FOH A;  4MF6 A;  1AIU A;  4G0I A;  5HFK A;  2K9F A;  1OC9 A;  3CSJ A;  4F0C A;  1S3A A;  2X8H A;  1UC7 A;  2H71 A;  3FEU A;  4HZ2 A;  5JCU A;  1GRX A;  2H66 A;  3Q18 A;  6GST A;  1M99 A;  1PN0 A;  1K0D A;  2TRC P;  4YH2 A;  4XCS A;  5F07 A;  3R2Q A;  5CRW A;  2WVZ A;  4MH2 A;  4OD7 A;  1UN2 A;  4YQV A;  1XOA A;  2WVX B;  4RI7 A;  2C0E A;  5DBQ A;  3GYK A;  4GDF A;  1UA5 A;  3EMX A;  1U3I A;  1M3J A;  1JZO A;  1T3B A;  2WVX A;  3FZA A;  3QFB C;  5A4V A;  3ZFB A;  4ZIJ A;  1XPV A;  4MNN A;  4TOP A;  4AKG A;  3BJ5 A;  4HQZ A;  2E2G A;  1PA3 A;  3LSZ A;  4GTU A;  2FWE A;  11GS A;  2DIZ A;  2FA8 A;  1XOB A;  4Z2U A;  1GUH A;  4JZQ A;  4MZC A;  5BRT A;  1M2D A;  1JZW A;  4N11 A;  3CMI A;  1GP1 A;  2M46 A;  4O5Q A;  5ABR A;  2HZF A;  20GS A;  4K9Z A;  1X5E A;  2BMX A;  3BCK A;  4MF5 A;  3VWW A;  3FR6 A;  3HDC A;  1U3A A;  2DJK A;  2PER A;  2I9H A;  1ZGN A;  5IMD A;  3APQ A;  3FYG A;  3EUR A;  2IWT A;  2YWO A;  5CRH A;  2AAW A;  1PMT A;  3TUE A;  3F9U A;  5IOX A;  3GV1 A;  2YJH A;  3H1N A;  2EC4 A;  5IOW A;  3UIW A;  2VL2 A;  4OO5 A;  4Q5N A;  4KX4 A;  1SK2 A;  3IC8 A;  3J7Y b;  3D21 A;  1EP7 A;  1T4Z A;  2ZCT A;  5D8I A;  3L9S A;  5C04 A;  2X8C A;  2YPM A;  2JU5 A;  3U6V A;  2QKE A;  1PFO A;  4O5R A;  3SBC A;  3TKS E;  1TI3 A;  2GS3 A;  2X99 A;  1H4O A;  1OE7 A;  5B8A A;  2C0F A;  3SWL A;  4OMV A;  2OKA A;  1V58 A;  3LXZ A;  1GSU A;  2H1B A;  1SVM A;  4EIQ A;  1QGV A;  1TK5 B;  4IP6 A;  3IAS 2;  1ZCP A;  4K2X A;  1V2A A;  1YKA A;  2V41 A;  3BOA A;  4YQM A;  3MSZ A;  2X64 A;  3D4T A;  3APO A;  3F6D A;  5F8B A;  4LLR A;  2GGT A;  4DSR A;  3J7Y k;  3AY8 A;  3Q6O A;  4NXI A;  1Z7R A;  3JCM L;  1OKT A;  1SL1 B;  2LUS A;  4XS6 A;  4MZW A;  3A2X A;  2OE3 A;  2VLV A;  3C1S A;  1YQ1 A;  1AXD A;  5ECQ B;  1BAY A;  2VL3 A;  1ZYE A;  3FRC A;  4ACS A;  4ML6 A;  1YF1 A;  1M2A A;  3EMP A;  3QAW A;  4MPF A;  3LEF A;  1TRW A;  2OBK A;  3HJO A;  1A2L A;  3IBH A;  2DLX A;  2H72 A;  3I6A A;  3R3E A;  2H6X A;  2WS2 A;  5J47 A;  2R0G A;  1MD3 A;  3VWV A;  3H93 A;  3ZMK A;  1XWG A;  1LJR A;  3F4T A;  1O7U A;  3VFI A;  1EGO A;  1FG4 A;  2YV7 A;  3CXG A;  2PN8 A;  2IL3 A;  2N5F A;  2WW1 A;  3ZVJ A;  1FVK A;  3ZZX A;  3TGZ A;  2WRT A;  3L9U A;  3A5I A;  3PR8 A;  2DJ3 A;  4IP1 A;  1PKW A;  4TR3 A;  4NV5 A;  4BPY A;  2MMN A;  1OKD A;  3TDG A;  2GSS A;  1K3O A;  2OT3 A;  5IQY A;  5ECR B;  2R0P A;  1GUK A;  1M3I A;  1XWK A;  4MP4 A;  4EKZ A;  4NPB A;  1TDI A;  1IYI A;  5AIV A;  2YOI A;  4WF5 A;  4GQF A;  3HJP A;  3HVN A;  5ELA A;  1ERU A;  4BWS A;  1M9B A;  1YKC A;  5J9B A;  2AB6 A;  5ECP B;  2FUG 2;  3D22 A;  4V1A g;  1I9D A;  1G7O A;  2JL4 A;  5JCG A;  2ES7 A;  2H1D A;  18GS A;  2JSY A;  3GHA A;  3VI7 A;  3HY2 A;  1A2M A;  3LYP A;  2EIO A;  4EE0 A;  3RPP A;  3LYK A;  4TXV A;  1MTC A;  1TW9 A;  1THO A;  2UV8 G;  1CQH A;  2LV3 A;  2TIR A;  3QAG A;  2DKI A;  2XHF A;  2YCD A;  1K0A A;  3TJF A;  1YF0 A;  4AJ7 A;  5JWR B;  1TK0 B;  1LBK A;  5A4W A;  2DC5 A;  5IIZ A;  5IMA A;  4F82 A;  3IK7 A;  2A2R A;  3FKF A;  3MYD A;  1GLP A;  3LWA A;  1KNG A;  2NDO A;  4BIK A;  5FT3 A;  4K1F A;  1Z9H A;  3DVX A;  2KP2 A;  5F05 A;  1GSS A;  1QFN A;  4ZBD A;  3NOF A;  3NIV A;  2B1L A;  3MAK A;  2VD1 A;  2FWF A;  1XZO A;  3EPT A;  3A2W A;  3LG6 A;  5FWG A;  1M7T A;  5CNW A;  1DBY A;  2GTU A;  1Y25 A;  1SD8 A;  1YEW C;  1V57 A;  4MJC A;  1SK1 A;  3ZLP A;  4ID0 A;  5G2Z A;  4L5L A;  1JHB A;  4F9Z A;  2UZ8 A;  4ZL9 A;  1FHE A;  1EGR A;  3D4M A;  4MA9 A;  2B5Y A;  3GKM A;  3IXR A;  4P3Y B;  4IVF A;  2HXK A;  3BCI A;  2WCI A;  4EDZ A;  1Q4J A;  3GX0 A;  1T4Y A;  2HRA A;  4XRA A;  1WMJ A;  2LNS A;  4CY6 A;  3TB2 A;  1BYE A;  3GST A;  4CHS A;  1SEN A;  1VF2 A;  1W4V A;  4HEA 2;  4PNF A;  4G19 A;  1XW5 A;  4MH3 A;  4IW9 A;  1EZK A;  3FK8 A;  1R5A A;  3GMF A;  4JBB A;  2GT5 A;  3HZ8 A;  2VCX A;  1EV9 A;  1PGT A;  2C0D A;  5LNK e;  3KZQ A;  5H5S A;  2DJJ A;  2EFC A;  1K0B A;  1O8W A;  2A2S A;  2OAD A;  3RBT A;  2C3T A;  2L5L A;  1QXH A;  1S3D A;  3DD3 A;  3M8N A;  5B8B A;  5E59 A;  4NHZ A;  2H19 A;  2FWG A;  5ECM B;  1F37 A;  2IJY A;  2LRN A;  1YJ6 A;  4I6X A;  3ERG A;  3QAV A;  5KOW A;  4EIP A;  3IAM 2;  2H30 A;  4TR1 B;  3KIJ A;  4AKH A;  2LRC A;  1ACV A;  2P5Q A;  4EVM A;  3NZN A;  2ZNM A;  1ZL9 A;  3LW9 A;  5CRG A;  4WKW A;  2PU9 C;  1MDK A;  2VM2 A;  1SKS B;  4IS0 A;  2ON7 A;  3Q74 A;  3WGE A;  4KDY A;  3WT1 A;  2AUV A;  2XBQ A;  3GKX A;  4IBP A;  2IIY A;  1XIY A;  3VI5 A;  2DJ0 A;  7GSS A;  2E7P A;  2RUE A;  1YDK A;  5J3R A;  3TKQ A;  5H5R A;  3KTB A;  3ME7 A;  3GKN A;  3UVH A;  3ERW A;  4K8M A;  9GSS A;  1EEM A;  1ZYN A;  4FYB A;  4EXJ A;  4Z2T A;  5D9W A;  2K8V A;  2LJK A;  2VIM A;  3TCO A;  1PSQ A;  4L8E A;  3ZFL A;  1WP0 A;  4BA7 A;  1J08 A;  1BG1 A;  3HVX A;  2OBI A;  3IK9 A;  3P7X A;  1EWX A;  4OWY A;  4RQX A;  2HI7 A;  5A34 B;  2XBI A;  2F8A A;  2HE3 A;  1Z6N A;  2HRF A;  1HNB A;  5A34 A;  1WWJ A;  4N0Z A;  2VCZ A;  4KCE A;  2REM A;  4G0K A;  2YWM A;  1YVL A;  1SVO A;  1X9S B;  3UOM A;  2O5V A;  2LQO A;  4XS1 A;  1PRX A;  2G2Q A;  3UAP A;  2ZUP A;  2PVO C;  3O3T A;  1VF3 A;  4X43 A;  4TXO B;  2WW2 A;  1GWC A;  1T7P B;  1U88 A;  2H74 A;  4ULX A;  4WR4 A;  2B6M A;  4TXO A;  2HYX A;  5ECK B;  2KOK A;  4EL1 A;  2P31 A;  4IKH A;  1B9X C;  1R4W A;  4GWR A;  2PVQ A;  16GS A;  4JED A;  6GSS A;  3UEM A;  2CT6 A;  1TJD A;  3KH9 A;  1QMV A;  5BMU B;  1GTB A;  5KN0 A;  3ZRD A;  3ZIV A;  1N2A A;  2RM6 A;  5BMU A;  4V2L A;  2IMK A;  1EEJ A;  4AKX B;  4EC0 A;  3TOU A;  1KBN A;  1TP9 A;  3RHC A;  1EOG A;  1JZD A;  4Z7X A;  3Q19 A;  2WZS A;  4KUN A;  4ECJ A;  3HVS A;  1SK0 A;  4WF4 A;  2QSI A;  2O89 A;  5B6M A;  5DQS A;  1VF4 A;  5HR0 A;  3CHX C;  3CQF A;  2E0Q A;  2P0G A;  3GX8 A;  4NAX A;  2Z9S A;  4KGI A;  2B1K A;  2C3N A;  3UBL A;  2EIQ A;  2YWN A;  2CV4 A;  2WZ9 A;  4F2I A;  3EYT A;  1PD2 1;  3IOS A;  4D73 B;  5DVB A;  1ZYQ B;  3TJG A;  4PNG A;  4BL7 B;  1G6W A;  4D73 A;  5G1L A;  1TTZ A;  4TVE A;  4XTS A;  2LQQ A;  2CZ3 A;  1TU7 A;  3DEX A;  3DRN A;  3A5W A;  4DSQ A;  1O6J A;  2LNT A;  3HVV A;  1B48 A;  5GAN D;  2X49 A;  4O92 A;  1NHY A;  3DGQ A;  5ENU A;  1K3Y A;  4FXY P;  4ZB7 A;  2JZT A;  3TRQ A;  5CO3 A;  1VF1 A;  1PN9 A;  2H01 A;  2V6O A;  4I8B A;  1AUC A;  1MDJ A;  1BED A;  2KUC A;  2FWH A;  3HCZ A;  3BBY A; 
#chains in the Genus database with same CATH homology
 3OR5 A;  3E0U A;  3LFL A;  5J5N A;  4FYU A;  1ML6 A;  5A5H B;  1NSW A;  3U5R E;  4N30 A;  1V40 A;  1O73 A;  1PQN A;  2O7K A;  2YN1 A;  1GSD A;  4ECI A;  1O81 A;  3MIX A;  1TU8 A;  4IGJ A;  1DSB A;  4K0N A;  4X0X A;  1K0O A;  2FA4 A;  1OC3 A;  3IE3 A;  2GSR A;  1FB6 A;  3GL5 A;  4AJ8 A;  1GSQ A;  3E3E A;  1X0R A;  2OE0 A;  3LJR A;  3M9K A;  2CVD A;  2V6K A;  2HSN B;  2FCH A;  3EE2 A;  1GSE A;  3TKS A;  4PXO A;  4WET A;  1AQV A;  2HSN A;  2YJ7 A;  4ZBB A;  3KH7 A;  19GS A;  3F6F A;  2F9S A;  5IO0 A;  1K0M A;  2PMT A;  4Q5Q A;  1ERT A;  1FB0 A;  5AGY A;  5IO2 A;  3TRX A;  1WE0 A;  4YKF A;  5ECN B;  3CBU A;  4GXZ A;  3DXB A;  2I81 A;  2H73 A;  5DAL B;  4OFM A;  2OA7 A;  2LTK A;  4V2M A;  5D96 A;  4HDE A;  5JWQ B;  4XHM A;  3KP8 A;  2L59 A;  5DAL A;  2X8G A;  2LJA A;  4K0G A;  3PIN A;  4DSS B;  3RPN A;  2H8L A;  1JLV A;  3C8E A;  5GAP D;  5ECL B;  4OCF A;  2CX4 A;  4DSS A;  4IJI A;  1TKD B;  2AYT A;  4RQR A;  5A5K A;  3M3M A;  3WT2 A;  5G1K A;  1AQX A;  2GVP A;  4X4J A;  2VAF A;  2XPE A;  1K0C A;  4LL4 B;  4CW9 A;  2O87 A;  1JZR A;  2DSA A;  1Z5Y E;  4V2N A;  3N5O A;  1KTE A;  2K6V A;  1YEP A;  1A24 A;  2VCQ A;  5HFI A;  2XPD A;  2VL2 C;  4MAB A;  1NHO A;  4HZ4 A;  4N3Z A;  1Z7P A;  1XW6 A;  3M1G A;  3L0H A;  5DJM A;  4PGT A;  4WXT A;  5CRE A;  3F3Q A;  3VPT A;  3HJM A;  3FZ4 A;  2M80 A;  4TRX A;  4WR5 A;  1SL2 B;  4ZB8 A;  4PUA A;  2B5E A;  3VWX A;  2DJ1 A;  1WRY A;  4GSS A;  4AF2 A;  1FVJ A;  4W66 A;  2IMF A;  4MMM A;  4BWQ A;  3IV4 A;  2R3X A;  1USB A;  1F3B A;  1SKW B;  2FD3 A;  4JR6 A;  4E8E A;  4QL9 A;  3ZVJ D;  4OO4 A;  5FHI A;  1M2B A;  1XCC A;  1Z3E A;  4HUA A;  2FHE A;  4QQ7 A;  5DQY A;  4GST A;  3H4K A;  2PGT A;  1U87 A;  2YAN A;  1XWB A;  4MPG A;  3BD2 A;  1DUG A;  1SYR A;  5IMV A;  2WJU A;  3D5J A;  2V32 A;  1THX A;  5G5F A;  2LRT A;  2LKU A;  5HR3 A;  3P2A A;  3RAZ A;  3ZIJ A;  3FW2 A;  1GH2 A;  2IMD A;  1A0R P;  4ZL8 A;  2MMO A;  2A4H A;  2B7K A;  1F9M A;  3KXO A;  3ED3 A;  3F3R A;  4AI6 A;  2NTO A;  5ELG A;  1HYU A;  4MLY A;  5A4U A;  3HKR A;  1HD2 A;  1QUW A;  1AC1 A;  1X5C A;  3LOR A;  1TRS A;  3CSH A;  4ZBA A;  1IYH A;  3EU4 A;  2A2P A;  2MZC A;  1FAA A;  5CP1 A;  5G31 A;  12GS A;  2HSY A;  4N10 A;  2LJR A;  1GSF A;  3GIX A;  1X9W B;  6GSV A;  4L5O A;  2C0G A;  4ML1 A;  5EVO A;  3EC3 A;  5HR2 A;  2VLT A;  4GLT A;  2BJX A;  3IR4 A;  1MEK A;  4GRF A;  3HMJ G;  2JZS A;  3G7I A;  5D9V A;  5IM9 A;  1A8Y A;  5DAK B;  1T00 A;  2HFD A;  2V1M A;  2VO4 A;  2DIY A;  4FQU A;  1CQG A;  4IN0 A;  4EF0 A;  4POB A;  5DAK A;  1SU9 A;  2L57 A;  2FY6 A;  4O5U A;  1OAZ A;  5J40 A;  4G0L A;  3ZYW A;  1XFL A;  4FO5 A;  2I4A A;  2GZZ A;  1R7H A;  4Z2R A;  3GN3 A;  3FZ9 A;  1E6B A;  4FH8 A;  5J9C A;  4POK A;  4E8H A;  4NMU A;  4IQA A;  4MCU A;  1BG5 A;  3CRU A;  5JWO B;  1B4P A;  2V2G A;  4YAP A;  4K7I A;  2QGV A;  4DEJ A;  3QPM A;  4KA0 A;  2MMZ A;  3N9J A;  1M9A A;  4BVY B;  2CQ9 A;  1XXU A;  4E68 A;  1FOV A;  3F8U A;  4BVY A;  4K7O A;  3V1W A;  3TKP A;  4TR1 A;  3ERF A;  4GQC A;  3CSI A;  2H0H A;  4YAV A;  5D9T A;  1OVN A;  1F6M C;  5DCH A;  1PX6 A;  2PPT A;  1E2Y A;  4J2F A;  3CYN A;  5DCG A;  5J4Y A;  4MZB A;  3GFK A;  2MBS A;  6GSW A;  2IME A;  3UVT A;  2PBJ A;  2B7J A;  4NHW A;  2L6D A;  4FIW A;  2CAQ A;  1GLQ A;  3UAR A;  2EFH A;  2RLI A;  4TKY A;  4GSN A;  2WUL A;  5LD0 A;  1B9Y C;  1G6Y A;  2C8U A;  3QMX A;  4BVX B;  4LL1 B;  3C73 A;  4JR4 A;  4I2T A;  5EY6 A;  5IPG A;  4PQI A;  5D9X A;  1SJ6 A;  3PH9 A;  3UJ1 A;  1ZYP A;  1XVQ A;  3ZTL A;  1O8X A;  22GS A;  2AV4 A;  3D6I A;  3HYP A;  2A4V A;  4AJ6 A;  1X5D A;  1XVW A;  3L78 A;  3F4S A;  3F0I A;  3H79 A;  3W8S A;  1PL1 A;  4CY8 A;  5G5E A;  1XWC A;  3MDK A;  2R4V A;  2CX3 A;  3TU3 B;  2VCT A;  2YWI A;  14GS A;  2GZY A;  1RQM A;  1J9B A;  2J23 A;  4ECB A;  4KH7 A;  3APS A;  5D93 A;  1B4Q A;  3EVI A;  2H75 A;  2WB9 A;  5HR1 A;  2P5R A;  1GTA A;  1BQ7 A;  1PL2 A;  3CTF A;  4HJM A;  4KDU A;  2DML A;  1GSY A;  4L0W A;  2HSH A;  1G7E A;  1EOH A;  3HXS A;  2C3Q A;  1ABA A;  1GTI A;  2GT6 A;  1SD9 A;  1TI1 A;  3LGC A;  1NW2 A;  2H1L A;  4EDY A;  2N5A A;  2GQK A;  2H0G A;  3VK9 A;  5EL8 A;  3G7Y A;  3ZL5 A;  2CAI A;  3ZRE A;  2I3Y A;  3KMO A;  4KSO A;  5LCZ A;  1A23 A;  3ZIT A;  1ERV A;  1GUL A;  1QK8 A;  1R5P A;  4V1A p;  5KN1 A;  4KB3 A;  2H6Z A;  1QQ2 A;  2IN3 A;  3I9V 2;  3GUR A;  4I97 A;  3KMN A;  2B3S A;  3GH6 A;  4OFN A;  4K2D A;  3C1R A;  4NV2 A;  1YZX A;  4RI6 A;  4ZIL A;  2WFC A;  2GDR A;  4IEL A;  4RUV A;  1H75 A;  4HQS A;  5IMF A;  2NVL A;  3KTL A;  4ZL7 A;  5J4U A;  2QC7 A;  3TOT A;  4KSM A;  1TXX A;  4JRR A;  2WDU A;  2GST A;  2DMM A;  4K7N A;  3KD0 A;  5KN3 A;  5JCW A;  2G0F A;  4Q5F A;  4YQU A;  3DYR A;  3G9B A;  3CRT A;  2VD0 A;  4KND A;  3L4N A;  2H76 A;  3UMA A;  2GLR A;  4G01 A;  2RII A;  13GS A;  5C00 A;  3KJY A;  4PTS A;  4PX1 A;  1YY7 A;  4N0V A;  4BL7 A;  5J4V A;  4IJ3 A;  3DKS A;  3D0Z A;  5B7C A;  4I5Q A;  2JAC A;  4OCE A;  3FR9 A;  4LA1 A;  5ECO B;  4PUR A;  1T1V A;  5AIS A;  3LQ7 A;  2M72 A;  2B5X A;  1SYX A;  2KP1 A;  2GSQ A;  2VCW A;  4WEY A;  4I2U A;  3VLN A;  1AQW A;  1T8E B;  5COH A;  4LMW A;  2LST A;  3EWL A;  3GL3 A;  1XWA A;  2DBC A;  2IFQ B;  1K0N A;  5A5H A;  1W89 A;  3GSS A;  3HZ4 A;  3TKR A;  1JFU A;  5L71 A;  1HQO A;  4MK3 A;  2GZP A;  2IFQ A;  2VLU A;  4KE3 A;  2OE1 A;  1Y6E A;  4PUF C;  4PQ1 A;  3EU3 A;  4DVC A;  2F3M A;  3IPZ A;  4JE1 A;  5F06 A;  3QFA C;  3IC4 A;  1M0U A;  2H70 A;  3VWU A;  2HRK B;  3P90 A;  3HD5 A;  2CVK A;  3KCM A;  3CTG A;  1U6T A;  2ALB A;  1Z6M A;  2HRK A;  1WJK A;  3K8N A;  5G30 A;  4YKG A;  3IHG A;  5D73 A;  2D2Z A;  3M9J A;  1AW9 A;  2NBS A;  2KLX A;  2YV9 A;  4G10 A;  1MD4 A;  4PQH A;  2H1A A;  2TRX A;  3DVW A;  4KCA A;  1PX7 A;  3TRP A;  2CZ2 A;  1KEB A;  3H8Q A;  2CA8 A;  2XC2 A;  3EIN A;  2BTO T;  4A5P A;  2CVB A;  1A8L A;  3E9J B;  4KF9 A;  1OC8 A;  1V98 A;  2O8V B;  4WBR D;  3MWH A;  1EV4 A;  5GST A;  5IMZ A;  1HNC A;  2VUP A;  4FYC A;  4CDO A;  1OE8 A;  2H1G A;  4HJ2 A;  1ILO A;  2RUF A;  4MF7 A;  3QOU A;  2LEG A;  3FZ5 A;  2HZE B;  5GZZ B;  1WPI A;  6GSX A;  5H5Q A;  5KN2 A;  2IMI A;  2HZE A;  3MNG A;  4G2E A;  2H6Y A;  1RK4 A;  2JZR A;  3F4R A;  1ZMA A;  5CAX A;  4IQ1 A;  3RDW A;  1GTU A;  5INY A;  3LXT A;  4AGS A;  2HQT A;  2F8F A;  4ZXG A;  2VOC A;  1G0T A;  1I5G A;  3UBK A;  1F3A A;  2X4A A;  3PGT A;  3FMW A;  3GRX A;  4HOJ A;  2K18 A;  5ECS A;  1DE2 A;  1BX9 A;  2EFD A;  4TR0 A;  2JAD A;  4ICY A;  3ISO A;  3IDV A;  4O32 A;  2FGX A;  2IPA A;  4HU7 A;  1TOF A;  4USS A;  1PKZ A;  4TW5 A;  4GF0 A;  1TXU A;  2H0I A;  4EUY A;  1HNA A;  4QL7 A;  3S9F A;  5ECI B;  1NM3 A;  3KEB A;  2R5G A;  4J57 E;  1OYJ A;  5F0G A;  3A2V A;  1O85 A;  1Q98 A;  4F03 A;  2F51 A;  4EO3 A;  2N5B A;  2HNL A;  2GQM A;  1GNE A;  10GS A;  3WD6 A;  3KGK A;  3QCP A;  4KAE A;  4IHU A;  5KOX A;  1UVZ A;  4OFT A;  4POM A;  3QDN A;  1ZZY A;  3IHQ A;  4ECC A;  5AIX A;  3P8W A;  3C7M A;  4LMV A;  1JLW A;  2DJ2 A;  3M0F A;  3CWG A;  3TKS C;  3UL3 A;  3FR3 A;  1DE1 A;  1EP8 A;  2L6C A;  2PUK C;  1K3L A;  1N8J A;  3I43 A;  5CYY A;  3VUR A;  1MDI A;  2C1Y A;  4GCI A;  3DWV A;  2AHE A;  4QMK A;  5GSS A;  2K8S A;  1ZOF A;  5B6N A;  3KP9 A;  2MMA A;  3ME8 A;  1SL0 B;  3F63 A;  5AN1 A;  2NPB A;  4O7H A;  3IRA A;  2C80 A;  5E4W A;  2OAC A;  1GUM A;  1BF5 A;  4MJA A;  1SKR B;  3FY7 A;  2E2M A;  3HA9 A;  1YEX A;  1X9M B;  2HRN A;  1WOU A;  4AKI A;  17GS A;  1TRV A;  4HS1 A;  5HQP A;  1VGL A;  1AAZ A;  3TJB A;  5HFG A;  1A2J A;  6GSU A;  3GUS A;  3IA1 A;  4ILF A;  2R37 A;  2RM5 A;  1LU4 A;  3RHB A;  1F2E A;  3ZML A;  2EIR A;  1A0F A;  3GA4 A;  2FLS A;  1XW9 A;  2JSZ A;  3G7J A;  3I69 A;  3DML A;  2OJL A;  4K5R A;  1R26 A;  6GSY A;  2HT9 A;  4HU9 A;  2YP6 A;  3QR6 A;  4NWY A;  2ON5 A;  2EFE A;  2FNO A;  1RW1 A;  4XIH A;  1SJI A;  4XRD A;  4ISD A;  2VCV A;  1VRS D;  8GSS A;  4X1U A;  2J9H A;  2HSM B;  4H86 A;  3FHK A;  1SVL A;  2AJQ B;  1XBS A;  3HHV A;  2HSM A;  4KW6 A;  4WBJ A;  1FO5 A;  1FW1 A;  1Y1U A;  4MJE A;  3US3 A;  5J41 A;  1GNW A;  5IMC A;  4F0B A;  5CRD A;  3PPU A;  2QA1 A;  2I1U A;  5ECH B;  4MDC A;  3VPQ A;  3WGX A;  5KEJ A;  1TRU A;  3GKK A;  4TN8 A;  2WGR A;  3GH9 A;  2DKH A;  3GTU B;  5IPH A;  2R6K A;  1BJX A;  2C4J A;  3L9V A;  3O76 A;  4JU5 A;  5A1N B;  4L0U A;  2R2J A;  3GTU A;  3TJK A;  2KHP A;  1URM A;  4ZB9 A;  3QD9 A;  1ON4 A;  4ZB6 A;  3A3T A;  1N25 A;  1WIK A;  3GNJ A;  4BVX A;  5A1N A;  2R0C A;  1GL8 A;  3DIE A;  5DJL A;  4KDX A;  1V9W A;  2GQL A;  2VKZ G;  1SJZ A;  1TK8 B;  4HI7 A;  2L4Q A;  2VL9 A;  4TR4 A;  5ID2 B;  1ST9 A;  2HLS A;  4XS4 B;  2L4C A;  5EPF A;  2L5O A;  2QA2 A;  2MBT A;  4G9H A;  1ERW A;  5DDL A;  5ID2 A;  3WGD A;  1S3C A;  1C72 A;  4K6X A;  4XS4 A;  4POL A;  2MYG A;  1B8X A;  3WYW A;  2O85 A;  2PWJ A;  3W8J A;  4MJB A;  4K5S A;  2YZU A;  3KM6 A;  1J0F A;  3O6T A;  3TJJ A;  2YZH A;  3W6G A;  2YNX A;  2VM1 A;  3C71 A;  1OC9 B;  2LS5 A;  4Q5R A;  4J56 E;  1FOH A;  4MF6 A;  1AIU A;  4G0I A;  5HFK A;  2K9F A;  1OC9 A;  3CSJ A;  4F0C A;  1S3A A;  2X8H A;  1UC7 A;  2H71 A;  3FEU A;  4HZ2 A;  5JCU A;  1GRX A;  2H66 A;  3Q18 A;  6GST A;  1M99 A;  1PN0 A;  1K0D A;  2TRC P;  4YH2 A;  4XCS A;  5F07 A;  3R2Q A;  5CRW A;  4MH2 A;  4OD7 A;  1UN2 A;  4YQV A;  1XOA A;  4RI7 A;  2C0E A;  5DBQ A;  3GYK A;  4GDF A;  1UA5 A;  3EMX A;  1U3I A;  1JZO A;  1T3B A;  3FZA A;  3QFB C;  5A4V A;  3ZFB A;  4ZIJ A;  1XPV A;  4MNN A;  4TOP A;  4AKG A;  3BJ5 A;  4HQZ A;  2E2G A;  1PA3 A;  3LSZ A;  4GTU A;  2FWE A;  11GS A;  2DIZ A;  2FA8 A;  1XOB A;  4Z2U A;  1GUH A;  4JZQ A;  4MZC A;  5BRT A;  1M2D A;  1JZW A;  4N11 A;  3CMI A;  1GP1 A;  2M46 A;  4O5Q A;  5ABR A;  2HZF A;  20GS A;  4K9Z A;  1X5E A;  2BMX A;  3BCK A;  4MF5 A;  3VWW A;  3FR6 A;  3HDC A;  1U3A A;  2DJK A;  2PER A;  2I9H A;  1ZGN A;  5IMD A;  3APQ A;  3FYG A;  3EUR A;  2IWT A;  2YWO A;  5CRH A;  2AAW A;  1PMT A;  3TUE A;  3F9U A;  5IOX A;  3GV1 A;  2YJH A;  3H1N A;  2EC4 A;  5IOW A;  3UIW A;  2VL2 A;  4OO5 A;  4Q5N A;  4KX4 A;  1SK2 A;  3IC8 A;  3J7Y b;  3D21 A;  1EP7 A;  1T4Z A;  2ZCT A;  5D8I A;  3L9S A;  5C04 A;  2X8C A;  2YPM A;  2JU5 A;  3U6V A;  2QKE A;  4O5R A;  3SBC A;  3TKS E;  1TI3 A;  2GS3 A;  2X99 A;  1H4O A;  1OE7 A;  5B8A A;  2C0F A;  3SWL A;  4OMV A;  2OKA A;  1V58 A;  3LXZ A;  1GSU A;  2H1B A;  1SVM A;  4EIQ A;  1QGV A;  1TK5 B;  4IP6 A;  3IAS 2;  1ZCP A;  4K2X A;  1V2A A;  1YKA A;  2V41 A;  3BOA A;  4YQM A;  3MSZ A;  2X64 A;  3D4T A;  3APO A;  3F6D A;  5F8B A;  4LLR A;  2GGT A;  4DSR A;  3J7Y k;  3AY8 A;  3Q6O A;  4NXI A;  1Z7R A;  3JCM L;  1OKT A;  1SL1 B;  2LUS A;  4XS6 A;  4MZW A;  3A2X A;  2OE3 A;  2VLV A;  3C1S A;  1YQ1 A;  1AXD A;  5ECQ B;  1BAY A;  2VL3 A;  1ZYE A;  3FRC A;  4ACS A;  4ML6 A;  1YF1 A;  1M2A A;  3EMP A;  3QAW A;  4MPF A;  3LEF A;  1TRW A;  2OBK A;  3HJO A;  1A2L A;  3IBH A;  2DLX A;  2H72 A;  3I6A A;  3R3E A;  2H6X A;  2WS2 A;  5J47 A;  2R0G A;  1MD3 A;  3VWV A;  3H93 A;  3ZMK A;  1XWG A;  1LJR A;  3F4T A;  1O7U A;  3VFI A;  1EGO A;  1FG4 A;  2YV7 A;  3CXG A;  2PN8 A;  2IL3 A;  2N5F A;  3ZVJ A;  1FVK A;  3ZZX A;  3TGZ A;  2WRT A;  3L9U A;  3A5I A;  3PR8 A;  2DJ3 A;  4IP1 A;  1PKW A;  4TR3 A;  4NV5 A;  4BPY A;  2MMN A;  1OKD A;  3TDG A;  2GSS A;  1K3O A;  2OT3 A;  5IQY A;  5ECR B;  2R0P A;  1GUK A;  1XWK A;  4MP4 A;  4EKZ A;  4NPB A;  1TDI A;  1IYI A;  5AIV A;  2YOI A;  4WF5 A;  4GQF A;  3HJP A;  5ELA A;  1ERU A;  4BWS A;  1M9B A;  1YKC A;  5J9B A;  2AB6 A;  5ECP B;  2FUG 2;  3D22 A;  4V1A g;  1I9D A;  1G7O A;  2JL4 A;  5JCG A;  2ES7 A;  2H1D A;  18GS A;  2JSY A;  3GHA A;  3VI7 A;  3HY2 A;  1A2M A;  3LYP A;  2EIO A;  4EE0 A;  3RPP A;  3LYK A;  4TXV A;  1MTC A;  1TW9 A;  1THO A;  2UV8 G;  1CQH A;  2LV3 A;  2TIR A;  3QAG A;  2DKI A;  2XHF A;  2YCD A;  1K0A A;  3TJF A;  1YF0 A;  4AJ7 A;  5JWR B;  1TK0 B;  1LBK A;  5A4W A;  2DC5 A;  5IIZ A;  5IMA A;  4F82 A;  3IK7 A;  2A2R A;  3FKF A;  3MYD A;  1GLP A;  3LWA A;  1KNG A;  2NDO A;  5FT3 A;  4K1F A;  1Z9H A;  3DVX A;  2KP2 A;  5F05 A;  1GSS A;  1QFN A;  4ZBD A;  3NOF A;  3NIV A;  2B1L A;  3MAK A;  2VD1 A;  2FWF A;  1XZO A;  3EPT A;  3A2W A;  3LG6 A;  5FWG A;  1M7T A;  5CNW A;  1DBY A;  2GTU A;  1Y25 A;  1SD8 A;  1V57 A;  4MJC A;  1SK1 A;  3ZLP A;  4ID0 A;  5G2Z A;  4L5L A;  1JHB A;  4F9Z A;  2UZ8 A;  4ZL9 A;  1FHE A;  1EGR A;  3D4M A;  4MA9 A;  2B5Y A;  3GKM A;  3IXR A;  4P3Y B;  4IVF A;  2HXK A;  3BCI A;  2WCI A;  4EDZ A;  1Q4J A;  3GX0 A;  1T4Y A;  2HRA A;  4XRA A;  1WMJ A;  2LNS A;  4CY6 A;  3TB2 A;  1BYE A;  3GST A;  4CHS A;  1SEN A;  1VF2 A;  1W4V A;  4HEA 2;  4PNF A;  4G19 A;  1XW5 A;  4MH3 A;  4IW9 A;  1EZK A;  3FK8 A;  1R5A A;  3GMF A;  4JBB A;  2GT5 A;  3HZ8 A;  2VCX A;  1EV9 A;  1PGT A;  2C0D A;  5LNK e;  3KZQ A;  5H5S A;  2DJJ A;  2EFC A;  1K0B A;  1O8W A;  2A2S A;  2OAD A;  3RBT A;  2C3T A;  2L5L A;  1QXH A;  1S3D A;  3DD3 A;  3M8N A;  5B8B A;  5E59 A;  4NHZ A;  2H19 A;  2FWG A;  5ECM B;  1F37 A;  2IJY A;  2LRN A;  1YJ6 A;  4I6X A;  3ERG A;  3QAV A;  5KOW A;  4EIP A;  3IAM 2;  2H30 A;  4TR1 B;  3KIJ A;  4AKH A;  2LRC A;  1ACV A;  2P5Q A;  4EVM A;  3NZN A;  2ZNM A;  1ZL9 A;  3LW9 A;  5CRG A;  4WKW A;  2PU9 C;  1MDK A;  2VM2 A;  1SKS B;  4IS0 A;  2ON7 A;  3Q74 A;  3WGE A;  4KDY A;  3WT1 A;  2AUV A;  2XBQ A;  3GKX A;  4IBP A;  2IIY A;  1XIY A;  3VI5 A;  2DJ0 A;  7GSS A;  2E7P A;  2RUE A;  1YDK A;  5J3R A;  3TKQ A;  5H5R A;  3KTB A;  3ME7 A;  3GKN A;  3UVH A;  3ERW A;  4K8M A;  9GSS A;  1EEM A;  1ZYN A;  4FYB A;  4EXJ A;  4Z2T A;  5D9W A;  2K8V A;  2LJK A;  2VIM A;  3TCO A;  1PSQ A;  4L8E A;  3ZFL A;  1WP0 A;  4BA7 A;  1J08 A;  1BG1 A;  3HVX A;  2OBI A;  3IK9 A;  3P7X A;  1EWX A;  4OWY A;  4RQX A;  2HI7 A;  5A34 B;  2XBI A;  2F8A A;  2HE3 A;  1Z6N A;  2HRF A;  1HNB A;  5A34 A;  1WWJ A;  4N0Z A;  2VCZ A;  4KCE A;  2REM A;  4G0K A;  2YWM A;  1YVL A;  1SVO A;  1X9S B;  3UOM A;  2O5V A;  2LQO A;  4XS1 A;  1PRX A;  2G2Q A;  3UAP A;  2ZUP A;  2PVO C;  3O3T A;  1VF3 A;  4X43 A;  4TXO B;  1GWC A;  1T7P B;  1U88 A;  2H74 A;  4ULX A;  4WR4 A;  2B6M A;  4TXO A;  2HYX A;  5ECK B;  2KOK A;  4EL1 A;  2P31 A;  4IKH A;  1B9X C;  1R4W A;  4GWR A;  2PVQ A;  16GS A;  4JED A;  6GSS A;  3UEM A;  2CT6 A;  1TJD A;  3KH9 A;  1QMV A;  5BMU B;  1GTB A;  5KN0 A;  3ZRD A;  3ZIV A;  1N2A A;  2RM6 A;  5BMU A;  4V2L A;  2IMK A;  1EEJ A;  4AKX B;  4EC0 A;  3TOU A;  1KBN A;  1TP9 A;  3RHC A;  1EOG A;  1JZD A;  4Z7X A;  3Q19 A;  4KUN A;  4ECJ A;  3HVS A;  1SK0 A;  4WF4 A;  2QSI A;  2O89 A;  5B6M A;  5DQS A;  1VF4 A;  5HR0 A;  2E0Q A;  2P0G A;  3GX8 A;  4NAX A;  2Z9S A;  4KGI A;  2B1K A;  2C3N A;  3UBL A;  2EIQ A;  2YWN A;  2CV4 A;  2WZ9 A;  4F2I A;  3EYT A;  1PD2 1;  3IOS A;  4D73 B;  5DVB A;  1ZYQ B;  3TJG A;  4PNG A;  4BL7 B;  1G6W A;  4D73 A;  5G1L A;  1TTZ A;  4TVE A;  4XTS A;  2LQQ A;  2CZ3 A;  1TU7 A;  3DEX A;  3DRN A;  3A5W A;  4DSQ A;  1O6J A;  2LNT A;  3HVV A;  1B48 A;  5GAN D;  2X49 A;  4O92 A;  1NHY A;  3DGQ A;  5ENU A;  1K3Y A;  4ZB7 A;  2JZT A;  3TRQ A;  5CO3 A;  1VF1 A;  1PN9 A;  2H01 A;  2V6O A;  4I8B A;  1AUC A;  1MDJ A;  1BED A;  2KUC A;  2FWH A;  3HCZ A;  3BBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...