4EDZA

Crystal structure of hh-pgds with water displacing inhibitor
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Investigation of the binding pocket of human hematopoietic prostaglandin (PG) D2 synthase (hH-PGDS): a tale of two waters.
pubmed doi rcsb
molecule keywords Hematopoietic prostaglandin D synthase
molecule tags Isomerase/isomerase inhibitor
source organism Homo sapiens
total genus 70
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4edzA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4edzA01
1ZGNA 4TR1B 3QFBC 4HJMA 3Q74A 3US3A 5DJMA 4XIHA 1AQVA 1JZRA 1FB6A 1THOA 3J7Yk 3L0HA 3I9V2 2EC4A 4OCFA 3E0UA 1N8JA 3U5RE 4MJEA 3FR3A 2ON5A 2RIIA 1XW5A 2PU9C 1O73A 2VCXA 3MAKA 2UZ8A 3VWXA 2F8AA 5IQYA 4CHSA 2N5AA 1YQ1A 4TN8A 4ZL7A 1ILOA 3HJOA 4L0WA 1SD9A 3CBUA 2CVDA 1KEBA 2CAQA 4TVEA 4BA7A 5B6NA 1XXUA 2KHPA 1PX6A 1WMJA 1GSYA 1G7EA 2VL9A 5CREA 1R5AA 4I2UA 2VL2A 3CRUA 3G7YA 5D8IA 3TUEA 4HDEA 1TKDB 1SK1A 4MF7A 1A23A 3MSZA 1RQMA 4MJAA 1PRXA 5G30A 3UIWA 2R3XA 2HZFA 2RLIA 4G10A 11GSA 1M0UA 5IMAA 2C0DA 4POBA 2H66A 1EV9A 4ZBAA 2JZRA 4OO4A 3QAWA 5KN2A 4TXVA 2OACA 3TKPA 1ERVA 4NAXA 1TW9A 3TKQA 2CQ9A 3KM6A 5AGYA 1VF1A 5DQSA 2JU5A 2MYGA 2YNXA 4K6XA 4DSSA 3CTGA 3GL3A 1AQXA 1VGLA 1EEMA 1ZL9A 2CAIA 4TR1A 2GQLA 4I8BA 3ERFA 2GVPA 3G7JA 2FD3A 1AUCA 2VUPA 4POLA 1GSUA 1HNAA 3C1SA 1R4WA 1O81A 3M8NA 2H0HA 5AIVA 2IFQB 1SKWB 3HVVA 4HQSA 2NPBA 2I81A 2E2MA 1JLVA 3FEUA 4ZL9A 4ULXA 5KEJA 4MDCA 4KNDA 3DWVA 3TRXA 1PN9A 2HT9A 2B5XA 4Q5FA 4OD7A 2CV4A 3D4MA 2HRFA 4Q5QA 3L9VA 3FYGA 3UAPA 2C4JA 4IKHA 2CX4A 2CVKA 2OBKA 4PGTA 2LTKA 2LS5A 2VCTA 2J9HA 3DYRA 1OC3A 2YJHA 4Z7XA 1X9SB 1A8YA 4EUYA 5G2ZA 2D2ZA 3JCML 2FWGA 4FIWA 3RPPA 1WJKA 3GRXA 5F8BA 5ECSA 14GSA 1GWCA 3FHKA 1PKZA 2ZCTA 2WS2A 3ZFBA 4KCEA 4RI6A 4GSSA 4ISDA 4F2IA 4MZCA 5B6MA 3IAS2 4G0IA 3HD5A 3UL3A 3GSTA 2WJUA 2GS3A 5ABRA 1NHYA 3ZFLA 2H1BA 2K6VA 1XOBA 2IWTA 1SL2B 5FWGA 4JU5A 3CMIA 3P7XA 1TU8A 4NV2A 5LCZA 2V41A 2PN8A 5CNWA 4RQRA 3O76A 1M7TA 5KN1A 1U3IA 1QGVA 1TRVA 3DVXA 2WDUA 1LU4A 1SYXA 1TI3A 1XIYA 2TRCP 2IFQA 5DBQA 2I1UA 4JR4A 2CA8A 1DE2A 4TW5A 3EU3A 3TKSA 4HZ4A 3GKXA 2C3TA 1PL2A 3R3EA 2H73A 4PNGA 3BCKA 1YEPA 3VPQA 3FY7A 4I5QA 3F3QA 5ENUA 5DALA 5ECLB 2NBSA 4ZIJA 1HNCA 1MEKA 4J57E 4K2DA 4DSRA 3N5OA 2RUFA 2XBQA 3VPTA 1R26A 1AQWA 4GXZA 3W8JA 4G0KA 1USBA 5IMZA 16GSA 3C73A 4EE0A 2H76A 1LJRA 2OJLA 2BTOT 5IMCA 1Z9HA 4JE1A 3DGQA 1XOAA 3RHCA 2O87A 3HVSA 3IHQA 4DSQA 2VD1A 1SL1B 3D21A 4IQ1A 3OR5A 2LSTA 1U6TA 5ECIB 2YN1A 4MZWA 4LMWA 2H30A 4PTSA 1HNBA 4YAVA 5HFIA 5J9BA 4POMA 4TXOB 5JWOB 4OMVA 3PPUA 3KIJA 1CQGA 2FHEA 3O3TA 1SJZA 2LJAA 2K18A 5IOXA 3EVIA 4KX4A 4WETA 5IOWA 4BPYA 1TP9A 1AC1A 3L9UA 5D9WA 4HEA2 5EVOA 3D0ZA 3WT1A 2CX3A 3A2VA 4BVXB 2I3YA 2G2QA 2JL4A 1XPVA 2YWIA 2YANA 5H5RA 3LJRA 1Z6NA 1B9YC 1JFUA 1AW9A 5CO3A 2NVLA 3TDGA 1RW1A 4PURA 2B5YA 2LUSA 4K1FA 2VCQA 1B4PA 3A3TA 2OE0A 1TXXA 4PQ1A 4HI7A 5IMDA 1BG5A 1OVNA 4MA9A 1JHBA 2F8FA 4EC0A 1TK8B 4V2NA 3HCZA 4P3YB 5GSSA 4FYBA 3GFKA 5F0GA 3C7MA 2O8VB 5J9CA 5HFGA 2EIRA 1QXHA 4NPBA 4WR4A 2GZPA 3PGTA 4IJIA 3HXSA 4KF9A 2YP6A 3GIXA 5JCGA 4KUNA 1GRXA 4ZBDA 2H0GA 2GSRA 4OO5A 1EV4A 3TRPA 3H4KA 2H72A 2DIZA 2LRTA 2PGTA 4TXOA 1GTBA 2PVQA 4IP1A 1E6BA 2TIRA 2O85A 1I5GA 3CYNA 1WIKA 4MPFA 5AIXA 3DKSA 4KCAA 4KB3A 4F0BA 3C1RA 4DEJA 5ECOB 5LNKe 3KP9A 1AAZA 2GLRA 4GCIA 5CRGA 3VWWA 4BVXA 3AY8A 1EOHA 2GSQA 4E8EA 4HOJA 2H71A 4I97A 2OE1A 2YJ7A 4O92A 4D73B 3GKNA 3ZIJA 5F06A 1M2AA 4J2FA 1QMVA 5G5FA 4N30A 1ERUA 1JLWA 1UC7A 3TCOA 3NIVA 2HYXA 3QMXA 2JZSA 4GQCA 2ZNMA 3FKFA 4V1Ag 1K3LA 5J3RA 4L5LA 5HR2A 3IK9A 5J5NA 5C00A 3O6TA 4K7IA 2K8VA 5BMUA 2KOKA 5G5EA 2XPDA 4K0NA 2F9SA 2DJJA 3LXZA 4LLRA 3ZVJA 2XHFA 2GSSA 4TRXA 3RDWA 5DQYA 2PMTA 2H1AA 3MNGA 2L59A 3GL5A 2VL3A 1XWCA 1VRSD 2I4AA 4JEDA 2MMZA 1TK5B 2VAFA 5HQPA 2OA7A 3GSSA 5IO0A 2LRNA 5GAND 3QCPA 5DDLA 3F6DA 2X64A 2YWNA 4FYCA 2WB9A 4ID0A 3UJ1A 3VI5A 5IIZA 1TOFA 1W89A 3BOAA 1KNGA 4OFNA 5AN1A 4XHMA 5D9XA 4CW9A 2H01A 1THXA 1H4OA 4MPGA 1MDJA 1V98A 2MMNA 4KH7A 2YZUA 1GUMA 4JR6A 3LORA 2KP1A 3TKSE 1F2EA 5GZZB 2Z9SA 2QKEA 4ML6A 4D73A 5A4WA 3FZ5A 3A2XA 1TDIA 4OFMA 2B7KA 2IIYA 5CYYA 3KZQA 3H93A 3HJPA 1SKRB 1OC9B 3F0IA 2FA8A 3E9JB 1Y25A 2YCDA 3ZIVA 5ECHB 5KN0A 3GYKA 4K9ZA 4HU9A 2B1LA 4G0LA 2C0EA 5B7CA 1OAZA 2DJ1A 2L4QA 19GSA 4N10A 2VCZA 4XS6A 2R6KA 3UEMA 4FH8A 1O85A 1GL8A 5A4VA 1PL1A 2M80A 1T3BA 1WWJA 3KXOA 3UOMA 4YQMA 2V1MA 4GSTA 2DMLA 2DC5A 4ECBA 4NHWA 2HI7A 4ZILA 2IMFA 3IR4A 3VURA 2PBJA 5INYA 3BCIA 2N5BA 1WRYA 1EGOA 1X5DA 4KW6A 3J7Yb 2AYTA 4N0VA 4GF0A 3DXBA 4WF4A 3DIEA 1GUKA 2MZCA 2FUG2 5E59A 3VLNA 18GSA 1FVJA 3IBHA 2KLXA 1V57A 2FWHA 2DJ3A 2VLTA 3D4TA 4ZBBA 5A4UA 5F07A 5B8BA 3APOA 1GTUA 4K7NA 4BVYB 2QGVA 2J23A 2C80A 1ON4A 3EC3A 2HZEB 4FO5A 1K0BA 2JADA 1WP0A 3NOFA 4MF6A 4EKZA 2H74A 1OC9A 2AAWA 3IAM2 5EY6A 3M1GA 5GAPD 1K0DA 3GUSA 3WYWA 1S3AA 1SL0B 1XWBA 3TKSC 2IJYA 3KTBA 3HY2A 4XCSA 1E2YA 1XZOA 1QQ2A 3GHAA 5G31A 1SK2A 1VF4A 4ZB6A 1A2LA 5CRDA 4FQUA 4YQUA 5KN3A 3ERGA 1O8XA 3EE2A 3EMXA 4IBPA 3IC4A 2R2JA 1PKWA 2H0IA 1YDKA 1T00A 3CRTA 1OE8A 2X8HA 5FT3A 3I69A 2M72A 2C0FA 3GURA 4XTSA 1X9MB 1CQHA 3C8EA 5IPGA 3C71A 1EZKA 2WZ9A 3VWVA 3HJMA 3MWHA 5HR1A 1F37A 1J9BA 3UBLA 1U87A 2YPMA 2E0QA 5EPFA 2ON7A 3KGKA 4YH2A 5ECNB 1BX9A 2GQKA 2CZ2A 4WKWA 3IV4A 2MMAA 2PVOC 2GZZA 2A4VA 4H86A 2FY6A 2WULA 3IDVA 1FB0A 3CTFA 1HQOA 1X5CA 1M99A 3QFAC 5AISA 2C1YA 1V2AA 2HZEA 2LQOA 3QAGA 3Q6OA 2LNTA 2RM5A 3WGEA 3FZ9A 4FYUA 2LJKA 3ED3A 1QUWA 1B4QA 3F4TA 4O5RA 1TRUA 5DAKB 2WGRA 2AHEA 1VF2A 3QD9A 3H79A 1XW6A 1SENA 4MZBA 3EURA 4DVCA 2GTUA 4L8EA 1KTEA 3HZ4A 3CSHA 1DUGA 4KA0A 2EIQA 2ES7A 2DJ0A 1OC8A 2JSZA 1PA3A 3PR8A 1QFNA 1XFLA 3TB2A 2RM6A 2LQQA 4QL7A 2WFCA 2HXKA 4ECCA 4ZL8A 2HNLA 5IO2A 2P5RA 2H19A 2HSNB 4IELA 1TI1A 1PQNA 3CSJA 4RI7A 3CSIA 1AIUA 2FWFA 3Q19A 1ZZYA 2L57A 4PQHA 4OFTA 3LYKA 3P90A 3UARA 3IOSA 1SU9A 3BJ5A 3I43A 3K8NA 2CT6A 2ZUPA 3KD0A 2CVBA 5HR0A 2LNSA 5CRHA 2KUCA 2EIOA 3A2WA 4XS4B 2K8SA 3EU4A 2HLSA 3HZ8A 2B3SA 1MDKA 2M46A 6GSXA 1HYUA 5L71A 1R5PA 3W6GA 4BL7B 17GSA 4I2TA 1V9WA 2DIYA 1Z7PA 4ECIA 1B48A 1XVWA 1URMA 1B9XC 3ZVJD 4IS0A 1GSQA 5ECRB 3D22A 1WE0A 2GT6A 2G0FA 2I9HA 5D9VA 5COHA 2IN3A 2AJQB 5DAKA 4MMMA 2H6XA 1YF0A 1G6YA 1K0MA 3QAVA 3HA9A 1SJ6A 1BAYA 1SK0A 3RHBA 3WGXA 1RK4A 3ME7A 1QK8A 2FNOA 1MTCA 3M0FA 4JRRA 2HRKB 1ZYEA 2BJXA 5FHIA 3L9SA 2VLVA 4OWYA 3U6VA 4XRDA 1M2DA 1IYIA 4F82A 3LYPA 1U88A 2VIMA 2X8GA 5ECKB 4LMVA 2P5QA 1M2BA 3TGZA 1T1VA 3L4NA 1Y6EA 4XS4A 3G7IA 5H5QA 3TOTA 2PUKC 2ALBA 1JZDA 1GTAA 2V6KA 6GSUA 4EF0A 2H1DA 5D73A 2BMXA 3EWLA 3LWAA 4HJ2A 1NSWA 5G1KA 3P8WA 4BL7A 3TJJA 2PERA 3HHVA 4GRFA 2H6ZA 1M9AA 4MJBA 3APQA 2GT5A 4E8HA 3DMLA 3QR6A 2XPEA 3KMNA 5HR3A 4K8MA 1FG4A 4O7HA 2JZTA 12GSA 3GKMA 1SD8A 1A8LA 2HRNA 4X1UA 5H5SA 1NW2A 1K0OA 4Q5RA 2IMIA 3BD2A 3GNJA 2HSHA 1ERTA 4MP4A 2H70A 1IYHA 2AB6A 1BEDA 2MBTA 5J4UA 1FAAA 4BWQA 2O7KA 3S9FA 1T4ZA 1X5EA 4WF5A 1F3BA 2X8CA 1K0AA 3L78A 1G6WA 3RAZA 3D6IA 1GTIA 2E2GA 1J0FA 1EEJA 2HRKA 3H1NA 1GSSA 1GP1A 3UVTA 2LKUA 1PGTA 1ZYQB 2VO4A 3E3EA 5JCUA 1X9WB 1GUHA 1XW9A 1SYRA 2X99A 4WR5A 1TU7A 6GSYA 1JZOA 2NDOA 1OKDA 4NWYA 3F6FA 5IM9A 1Q4JA 1A2MA 4ACSA 4N11A 2HSMB 1Z5YE 4I6XA 2GQMA 2B6MA 2OADA 2A2SA 3PH9A 4IW9A 4KDUA 3SWLA 3VFIA 1PX7A 1GH2A 2FLSA 2VOCA 1M9BA 1N2AA 2HRAA 2DMMA 2DSAA 1BJXA 1TRWA 2CZ3A 4BWSA 1Z3EA 1J08A 1WOUA 4EVMA 4PX1A 4MJCA 1G7OA 1EOGA 2B5EA 4IJ3A 1YY7A 1TK0B 1K3OA 2LV3A 4O32A 2MMOA 3F63A 4POKA 4GQFA 4GSNA 5J41A 1YKAA 1X0RA 1F3AA 3GA4A 3APSA 1MD3A 4MCUA 3KMOA 3GN3A 1I9DA 1ERWA 4JZQA 3IE3A 1Z7RA 4EL1A 4IQAA 1F6MC 4F0CA 2IMEA 4AGSA 3N9JA 1GSFA 4X43A 2DLXA 2VM1A 5DCHA 4GWRA 3FR6A 4F03A 3GX8A 1MD4A 2C0GA 2FA4A 2GZYA 1DSBA 1S3CA 2K9FA 4KSMA 1W4VA 3IA1A 2VCWA 1U3AA 4NXIA 2HSMA 5ECQB 5E4WA 5B8AA 3F4RA 5ELGA 4K7OA 4IGJA 5GSTA 1T7PB 1DBYA 1GLQA 2IMDA 2LJRA 3QPMA 2AUVA 3IPZA 3M3MA 2H6YA 4RQXA 5EL8A 4EDYA 5D93A 2FGXA 1FVKA 4HU7A 1BYEA 4IHUA 2VCVA 3LQ7A 4TKYA 3UMAA 3TJGA 4LL1B 2A2RA 3KH9A 3P2AA 3ZL5A 4TR0A 5CP1A 2B1KA 4YQVA 1K3YA 3TOUA 2OBIA 3WT2A 4EXJA 1UA5A 3R2QA 4RUVA 1EP7A 3EINA 3G9BA 1NM3A 4WBRD 3ZITA 2GGTA 4IVFA 3KJYA 4LL4B 5DALB 1SJIA 4TR3A 2WRTA 2QC7A 2YV7A 1YEXA 4HQZA 1ABAA 1OYJA 4L5OA 4QQ7A 4MLYA 4MABA 5D9TA 4MH2A 5ID2B 2DJKA 8GSSA 4V2LA 3EYTA 3DEXA 4XS1A 1FO5A 3W8SA 1GSEA 1VF3A 3GMFA 3NZNA 3LSZA 1K0NA 2B7JA 1EGRA 3ZREA 3RPNA 1OE7A 3WGDA 3FZ4A 4AJ7A 2QSIA 10GSA 1A0FA 1YJ6A 3ME8A 1NHOA 6GSWA 4YAPA 3M9JA 3F4SA 2IPAA 1WPIA 4HZ2A 2PWJA 4TOPA 1ML6A 2YV9A 4JBBA 3ERWA 4BVYA 2IL3A 1DE1A 4J56E 4ZB8A 3DRNA 1EP8A 2YWMA 1XWAA 1XBSA 1T4YA 1XVQA 4AJ8A 4AJ6A 1HD2A 1F9MA 4GTUA 5A5KA 4KSOA 2YWOA 4PUFC 2HFDA 4KAEA 1O8WA 4QL9A 2P31A 2FWEA 1GULA 2PPTA 3LGCA 2FCHA 2V32A 2P0GA 1FW1A 2E7PA 2R37A 4MK3A 4NHZA 4KGIA 4KDXA 1S3DA 4V2MA 5ID2A 3ZZXA 3LG6A 1Z6MA 3WD6A 2R5GA 3EMPA 3QDNA 2C3QA 5ECPB 1MDIA 4G2EA 3FZAA 5JCWA 3VWUA 5C04A 3ZMLA 6GSSA 2LRCA 2V6OA 4G9HA 2YZHA 2GSTA 3ZTLA 2OKAA 3M9KA 3GX0A 4N0ZA 2WCIA 1YF1A 2O89A 1FHEA 13GSA 3VK9A 1G0TA 3HVXA 9GSSA 3A5WA 3IXRA 3ZRDA 2MBSA 3GTUB 2OE3A 2C3NA 3PINA 2H75A 4ZB9A 2NTOA 1BQ7A 2XBIA 4X0XA 2VD0A 1ZOFA 4USSA 1OKTA 2F3MA 1V58A 4PUAA 3SBCA 4AF2A 3FRCA 4F9ZA 2HE3A 3HDCA 3DD3A 2DJ2A 2KP2A 4KDYA 1LBKA 4ML1A 1K0CA 4OCEA 3QOUA 3Q18A 3GV1A 1A24A 5JWQB 4NV5A 1ST9A 3ZYWA 3ZLPA 2L6CA 3KTLA 3LFLA 2L6DA 2AV4A 4WBJA 1YZXA 4ECJA 3LEFA 3HKRA 3GH9A 5F05A 5IMVA 1R7HA 2RUEA 1H75A 3FK8A 1AXDA 4G19A 1A2JA 2IMKA 1PSQA 4IP6A 2GDRA 3H8QA 2F51A 1GSDA 2HSYA 1FOVA 2VLUA 3GKKA 4MF5A 4IN0A 4PXOA 1XWKA 1TRSA 1ZMAA 4L0UA 3UBKA 1GNEA 3GH6A 2H1GA 3F9UA 4GLTA 5DVBA 1PMTA 1GNWA 3IK7A 2JACA 5DJLA 1YKCA 1TTZA 3UVHA 5G1LA 2H8LA 3IC8A 5JWRB 1ACVA 3GTUA 3F8UA 3TKRA 1GLPA 3D5JA 2HQTA 1EWXA 3KCMA 3KP8A 4KE3A 4WEYA 4K0GA 2DBCA 4MH3A 4LA1A 4Q5NA 1A0RP 20GSA 1UN2A 1JZWA 4EO3A 1UVZA 5DCGA 6GSTA 1KBNA 4TR4A 3FW2A 3DVWA 3ISOA 1Q98A 2L5OA 5IMFA 4PQIA 4CDOA 2JSYA 1ZCPA 3KH7A 4ZXGA 1XCCA 5IPHA 4PNFA 4XRAA 3TJKA 5ECMB 3FR9A 2C8UA 1T8EB 3TJFA 5ELAA 2L4CA 2R4VA 2XC2A 1O7UA 2TRXA 3RBTA 3F3RA 4HUAA 5CRWA 4V1Ap 2YOIA 3VI7A 3V1WA 2REMA 1SKSB 1PD21 3I6AA 2V2GA 1XWGA 2LEGA 3BBYA 4HS1A 5HFKA 7GSSA 3HYPA 3IRAA 1V40A 3ZMKA 3KEBA 22GSA 3CXGA 2N5FA 3MDKA 2VL2C 1C72A 3LXTA 5CAXA 4EDZA 2L5LA 1O6JA 3TRQA 1B8XA 4DSSB 4NMUA 2VM2A 5D96A 5LD0A 4ILFA 6GSVA 1TJDA 4WXTA 3TJBA
chains in the Genus database with same CATH superfamily
1ZGNA 4TR1B 3QFBC 4HJMA 3Q74A 3US3A 5DJMA 4XIHA 1AQVA 1JZRA 1FB6A 1THOA 3J7Yk 3L0HA 3I9V2 2EC4A 4OCFA 3E0UA 1N8JA 3U5RE 4MJEA 3FR3A 2ON5A 2RIIA 1XW5A 2PU9C 1O73A 2VCXA 3MAKA 2UZ8A 3VWXA 2F8AA 5IQYA 4CHSA 2N5AA 1YQ1A 4TN8A 4ZL7A 1ILOA 3HJOA 4L0WA 1SD9A 3CBUA 2CVDA 1KEBA 2CAQA 4TVEA 4BA7A 5B6NA 1XXUA 2KHPA 1PX6A 1WMJA 1GSYA 1G7EA 2VL9A 1M3JA 5CREA 1R5AA 4I2UA 2VL2A 3CRUA 3G7YA 5D8IA 3TUEA 4HDEA 1TKDB 1SK1A 4MF7A 1A23A 3MSZA 1RQMA 4MJAA 1PRXA 5G30A 3UIWA 2R3XA 2HZFA 2RLIA 4G10A 11GSA 1M0UA 5IMAA 2C0DA 4POBA 2H66A 1EV9A 4ZBAA 2JZRA 4OO4A 2WVXA 3QAWA 5KN2A 4TXVA 2OACA 3TKPA 1ERVA 4NAXA 1TW9A 3TKQA 2CQ9A 3KM6A 5AGYA 1VF1A 5DQSA 2JU5A 2MYGA 1SVMA 2YNXA 4K6XA 4DSSA 3CTGA 3GL3A 1AQXA 1VGLA 1EEMA 1ZL9A 2CAIA 4TR1A 2GQLA 4I8BA 3ERFA 2GVPA 3G7JA 2FD3A 1AUCA 5A5HB 2VUPA 4POLA 1GSUA 1HNAA 3C1SA 1R4WA 1O81A 3M8NA 2H0HA 5AIVA 2IFQB 1SKWB 1S4BP 3HVVA 4HQSA 2NPBA 2I81A 2E2MA 1JLVA 3FEUA 4ZL9A 4ULXA 5KEJA 4MDCA 4KNDA 3DWVA 3TRXA 1PN9A 2HT9A 2B5XA 4Q5FA 4OD7A 2CV4A 3D4MA 2HRFA 4Q5QA 3L9VA 3FYGA 3UAPA 2C4JA 4IKHA 2CX4A 2CVKA 2OBKA 4PGTA 2LTKA 2LS5A 2VCTA 2J9HA 3DYRA 1OC3A 2YJHA 5KOWA 4Z7XA 1X9SB 1A8YA 4EUYA 5G2ZA 2D2ZA 3JCML 2FWGA 4FIWA 3RPPA 1WJKA 3GRXA 5F8BA 5ECSA 14GSA 1GWCA 3FHKA 1PKZA 2ZCTA 2WS2A 3ZFBA 4KCEA 2WVYA 4RI6A 4GSSA 4ISDA 4F2IA 4MZCA 5B6MA 3IAS2 4G0IA 3HD5A 3UL3A 3GSTA 2WJUA 2GS3A 5ABRA 1NHYA 3ZFLA 2H1BA 2K6VA 1XOBA 2IWTA 1SL2B 5FWGA 4JU5A 3CMIA 3P7XA 1TU8A 4NV2A 5LCZA 5J40A 2V41A 2PN8A 5A5HA 5CNWA 4RQRA 3O76A 1M7TA 5KN1A 1U3IA 1QGVA 1TRVA 3DVXA 2WDUA 1LU4A 1SYXA 1TI3A 1XIYA 2TRCP 2IFQA 5DBQA 2I1UA 4JR4A 2CA8A 1DE2A 4TW5A 3EU3A 3TKSA 4HZ4A 3GKXA 2C3TA 1PL2A 3R3EA 2H73A 4PNGA 3BCKA 1YEPA 3VPQA 3FY7A 3RFRC 4I5QA 3F3QA 5ENUA 5DALA 5ECLB 2NBSA 4K5SA 4ZIJA 1HNCA 1MEKA 4J57E 4K2DA 4DSRA 3N5OA 2RUFA 2XBQA 3VPTA 1R26A 1AQWA 4GXZA 3W8JA 4G0KA 1USBA 5IMZA 16GSA 3C73A 4EE0A 2QA2A 2H76A 1LJRA 2OJLA 2BTOT 5IMCA 1Z9HA 4JE1A 3DGQA 1XOAA 3RHCA 2O87A 3HVSA 3IHQA 4DSQA 2VD1A 1SL1B 3D21A 4IQ1A 2X49A 3OR5A 2LSTA 2OT3A 1U6TA 5ECIB 2YN1A 4MZWA 4O5UA 4LMWA 2H30A 4PTSA 1HNBA 4YAVA 5HFIA 4CY8A 5J9BA 4POMA 4TXOB 5JWOB 4OMVA 3PPUA 3KIJA 1CQGA 2FHEA 3O3TA 1SJZA 2LJAA 2K18A 5IOXA 5A1NB 3EVIA 2WVZA 4KX4A 4WETA 5IOWA 4BPYA 1TP9A 3HMJG 1AC1A 3L9UA 1YVLA 5D9WA 4HEA2 5EVOA 3D0ZA 3WT1A 2CX3A 2WW1A 3A2VA 4BVXB 2I3YA 2G2QA 2EFDA 2JL4A 5J4VA 1XPVA 2YWIA 2YANA 5H5RA 3LJRA 1Z6NA 1B9YC 1JFUA 1AW9A 5CO3A 2NVLA 3TDGA 1RW1A 4PURA 2B5YA 2LUSA 4K1FA 2VCQA 1B4PA 3A3TA 2OE0A 1TXXA 4PQ1A 4HI7A 4W66A 5IMDA 1BG5A 4PI2C 1OVNA 4MA9A 5BMUB 1JHBA 2F8FA 4EC0A 1TK8B 4V2NA 3HCZA 4P3YB 5GSSA 4FYBA 3GFKA 5F0GA 3C7MA 2O8VB 5J9CA 5HFGA 2EIRA 1QXHA 4NPBA 4WR4A 2DKIA 2GZPA 3PGTA 4IJIA 3HXSA 4KF9A 2YP6A 3GIXA 5JCGA 4KUNA 1GRXA 4ZBDA 2H0GA 2GSRA 2WW0A 4OO5A 2O36A 1EV4A 3TRPA 3H4KA 2H72A 2DIZA 2LRTA 2PGTA 4TXOA 1GTBA 2PVQA 4IP1A 1E6BA 2TIRA 2O85A 1I5GA 5A1NA 3CYNA 1WIKA 4MPFA 5AIXA 3DKSA 4KCAA 4KB3A 4F0BA 3C1RA 4DEJA 5ECOB 5LNKe 3FMWA 3KP9A 1AAZA 2GLRA 4GCIA 2DKHA 5CRGA 3VWWA 4G01A 4BVXA 3AY8A 1EOHA 2GSQA 4E8EA 4HOJA 2H71A 4I97A 2OE1A 2YJ7A 4O92A 4D73B 3GKNA 3ZIJA 5F06A 1M2AA 4J2FA 1QMVA 5G5FA 4N30A 1ERUA 1JLWA 1UC7A 2EFCA 2R0GA 3TCOA 2WZSA 3NIVA 2HYXA 3QMXA 2JZSA 4GQCA 2ZNMA 3FKFA 4V1Ag 1K3LA 5J3RA 3HVNA 4L5LA 5HR2A 3IK9A 5J5NA 5C00A 3O6TA 4K7IA 2K8VA 5BMUA 3A5IA 2KOKA 5G5EA 2XPDA 4K0NA 2F9SA 2DJJA 3LXZA 4LLRA 3ZVJA 2XHFA 2GSSA 4TRXA 3RDWA 5DQYA 2PMTA 2H1AA 3MNGA 2L59A 3GL5A 2VL3A 1XWCA 1VRSD 2I4AA 4JEDA 2MMZA 1TK5B 2VAFA 5HQPA 2OA7A 3GSSA 5IO0A 4K2XA 2LRNA 5GAND 3QCPA 4GDFA 4EIPA 5DDLA 3F6DA 2X64A 2YWNA 4FYCA 2WB9A 4ID0A 3UJ1A 3VI5A 5IIZA 1TOFA 1W89A 3BOAA 1KNGA 4OFNA 3CHXC 5AN1A 2A4HA 4XHMA 5D9XA 4CW9A 2H01A 1THXA 1H4OA 4MPGA 1MDJA 4Z2UA 1V98A 2MMNA 4KH7A 2YZUA 1GUMA 4JR6A 5J47A 3LORA 2KP1A 3TKSE 1F2EA 5GZZB 2Z9SA 2QKEA 4ML6A 4D73A 5A4WA 3FZ5A 3A2XA 1TDIA 4OFMA 2B7KA 2IIYA 5CYYA 3KZQA 3HJPA 3H93A 1SKRB 1OC9B 3F0IA 2FA8A 3E9JB 1Y25A 2YCDA 3ZIVA 5ECHB 5KN0A 1XG8A 3GYKA 4K9ZA 4HU9A 2B1LA 4G0LA 4CY6A 2C0EA 5B7CA 1OAZA 2DJ1A 4MNNA 2L4QA 19GSA 4N10A 2VCZA 4XS6A 2R6KA 3UEMA 4FH8A 1O85A 1GL8A 5A4VA 1PL1A 2M80A 1T3BA 1WWJA 1N25A 3KXOA 3UOMA 4YQMA 2V1MA 4GSTA 2DMLA 2DC5A 4ECBA 1S3RA 4NHWA 2HI7A 4ZILA 2IMFA 3IR4A 3VURA 2PBJA 5INYA 3BCIA 2N5BA 1WRYA 1EGOA 1X5DA 4KW6A 3J7Yb 2AYTA 4AI6A 4N0VA 4GF0A 3DXBA 4WF4A 3DIEA 1GUKA 2MZCA 2FUG2 5E59A 3VLNA 18GSA 1FVJA 3IBHA 2KLXA 1V57A 2FWHA 2DJ3A 2VLTA 3D4TA 4ZBBA 5A4UA 5F07A 5B8BA 3APOA 3CWGA 4A5PA 1GTUA 4K7NA 4BVYB 2QGVA 2J23A 2C80A 1ON4A 3EC3A 2HZEB 4FO5A 1K0BA 2JADA 1WP0A 3NOFA 4MF6A 4EKZA 2H74A 1OC9A 4PHZC 2AAWA 3IAM2 5EY6A 3M1GA 5GAPD 1K0DA 3GUSA 3WYWA 1S3AA 1SL0B 1BF5A 1XWBA 3TKSC 2IJYA 3KTBA 3HY2A 4XCSA 1E2YA 1XZOA 1QQ2A 3GHAA 1M3IA 5G31A 1SK2A 1VF4A 4ZB6A 1A2LA 5CRDA 4FQUA 4YQUA 5KN3A 3ERGA 1O8XA 3EE2A 3EMXA 4IBPA 3IC4A 2R2JA 1PKWA 2H0IA 1YDKA 1T00A 3CRTA 1OE8A 2X8HA 5FT3A 3I69A 2M72A 2C0FA 3GURA 4XTSA 1X9MB 1CQHA 3C8EA 5IPGA 3C71A 1EZKA 2WZ9A 3VWVA 3TU3B 3HJMA 3MWHA 5HR1A 1ZYNA 1F37A 1J9BA 3UBLA 1U87A 2YPMA 2E0QA 5EPFA 2ON7A 3KGKA 4YH2A 2QA1A 5ECNB 1BX9A 2GQKA 2CZ2A 4WKWA 3IV4A 2MMAA 2PVOC 2GZZA 2A4VA 4H86A 2FY6A 2WULA 3IDVA 1FB0A 3CTFA 1HQOA 1X5CA 4HSCX 1M99A 3QFAC 5AISA 2C1YA 1V2AA 2HZEA 2LQOA 3QAGA 3Q6OA 2LNTA 2RM5A 3WGEA 3FZ9A 4FYUA 2LJKA 3ED3A 1QUWA 1B4QA 3F4TA 4O5RA 4BIKA 1TRUA 5DAKB 2WGRA 5A34B 2AHEA 1VF2A 3QD9A 3H79A 2EFEA 1XW6A 1SENA 4MZBA 3EURA 4DVCA 2GTUA 4L8EA 1KTEA 3HZ4A 3CSHA 1DUGA 4KA0A 2EIQA 2ES7A 2DJ0A 1OC8A 2JSZA 1PA3A 3PR8A 1QFNA 1XFLA 2UV8G 3IHGA 3TB2A 2RM6A 2LQQA 4QL7A 2WFCA 2HXKA 4ECCA 4ZL8A 2HNLA 5IO2A 2P5RA 2H19A 2HSNB 4IELA 1TI1A 1PQNA 3CSJA 4RI7A 3CSIA 1AIUA 2FWFA 3Q19A 1ZZYA 2L57A 4PQHA 4OFTA 3LYKA 3P90A 3UARA 3IOSA 1SU9A 3BJ5A 3I43A 3K8NA 2CT6A 2ZUPA 3KD0A 2CVBA 5HR0A 2EFHA 2LNSA 5CRHA 2KUCA 2EIOA 3A2WA 4XS4B 2K8SA 3EU4A 2HLSA 3HZ8A 2B3SA 4AKXB 2VKZG 1MDKA 2M46A 6GSXA 1HYUA 5L71A 1R5PA 3W6GA 4BL7B 17GSA 4I2TA 1V9WA 2DIYA 2WW2A 1Z7PA 4ECIA 1B48A 1XVWA 1URMA 1B9XC 3ZVJD 4IS0A 1GSQA 5ECRB 3D22A 1WE0A 2GT6A 1PN0A 2G0FA 2I9HA 5D9VA 5COHA 2IN3A 2AJQB 5DAKA 4MMMA 2H6XA 5A34A 1YF0A 1G6YA 1K0MA 3QAVA 3HA9A 1SJ6A 1BAYA 1SK0A 3RHBA 3WGXA 1RK4A 3ME7A 1FOHA 1QK8A 2FNOA 1MTCA 3M0FA 4JRRA 2HRKB 1ZYEA 2BJXA 5FHIA 3L9SA 2VLVA 4OWYA 3U6VA 2HSNA 4XRDA 1M2DA 1IYIA 4F82A 4Z2RA 3LYPA 1U88A 2VIMA 2X8GA 5ECKB 4LMVA 2P5QA 1M2BA 3TGZA 1T1VA 3RGBC 3L4NA 1Y6EA 4XS4A 3G7IA 5H5QA 3TOTA 2PUKC 3CQFA 2ALBA 1JZDA 1GTAA 2V6KA 6GSUA 4EF0A 2H1DA 5D73A 2BMXA 3EWLA 3LWAA 4HJ2A 1NSWA 5G1KA 3P8WA 4BL7A 2H1LA 3TJJA 2PERA 3HHVA 4GRFA 2H6ZA 1M9AA 4MJBA 3APQA 2GT5A 4E8HA 3DMLA 3QR6A 2XPEA 3KMNA 4N3ZA 5HR3A 4K8MA 1FG4A 4O7HA 2JZTA 12GSA 3GKMA 4PI0C 1SD8A 1A8LA 2HRNA 4X1UA 5H5SA 1NW2A 1K0OA 4Q5RA 2IMIA 3BD2A 3GNJA 2HSHA 1ERTA 4MP4A 2H70A 1IYHA 2AB6A 1BEDA 2MBTA 5J4UA 1FAAA 4Z2TA 4BWQA 2O7KA 3S9FA 1T4ZA 1X5EA 4WF5A 2X8CA 2X4AA 1F3BA 1K0AA 3L78A 1G6WA 5KOXA 3RAZA 3D6IA 1GTIA 2E2GA 1J0FA 2O5VA 1EEJA 2HRKA 3H1NA 1GSSA 1GP1A 3UVTA 2LKUA 1PGTA 1ZYQB 2VO4A 3E3EA 5JCUA 1X9WB 1GUHA 1XW9A 1SYRA 2X99A 4WR5A 1TU7A 6GSYA 1JZOA 2NDOA 1OKDA 4NWYA 3F6FA 5IM9A 1Q4JA 1A2MA 4ACSA 4N11A 2HSMB 4O5QA 1Z5YE 4I6XA 2GQMA 2B6MA 2OADA 2A2SA 3PH9A 4IW9A 4EIQA 4KDUA 3SWLA 3VFIA 1PX7A 1GH2A 2FLSA 4K5RA 2VOCA 1M9BA 1N2AA 2HRAA 2DMMA 2DSAA 1BJXA 1TRWA 2CZ3A 4BWSA 1Z3EA 1J08A 1WOUA 4EVMA 4PX1A 4MJCA 1G7OA 1EOGA 4YKGA 2B5EA 4IJ3A 1YY7A 1TK0B 1K3OA 4QMKA 2LV3A 4O32A 2MMOA 4FXYP 3F63A 4AKIA 4POKA 4GQFA 4GSNA 5J41A 1YKAA 1X0RA 1F3AA 1I1IP 3GA4A 3APSA 1MD3A 2R0CA 4MCUA 3KMOA 3GN3A 1I9DA 1ERWA 4JZQA 3IE3A 1PFOA 1Z7RA 4EL1A 4IQAA 1F6MC 4F0CA 2IMEA 4AGSA 3N9JA 1GSFA 4X43A 2DLXA 2VM1A 5DCHA 4GWRA 3FR6A 4F03A 3GX8A 1MD4A 2C0GA 2FA4A 2GZYA 1DSBA 1S3CA 2K9FA 4KSMA 1W4VA 3IA1A 2VCWA 1U3AA 4NXIA 2HSMA 5ECQB 5E4WA 5B8AA 3F4RA 5ELGA 3MYDA 4IGJA 4K7OA 5GSTA 1T7PB 1DBYA 1GLQA 2IMDA 2LJRA 3QPMA 2AUVA 3IPZA 3M3MA 2H6YA 4RQXA 5EL8A 4EDYA 5D93A 2FGXA 1FVKA 4HU7A 1BYEA 4AKHA 4IHUA 2VCVA 3LQ7A 4TKYA 3UMAA 3TJGA 4LL1B 2A2RA 3KH9A 3P2AA 3ZL5A 4TR0A 5CP1A 1YEWC 2B1KA 4YQVA 1K3YA 3TOUA 2OBIA 3WT2A 4EXJA 1UA5A 3R2QA 4RUVA 1EP7A 3EINA 3G9BA 1NM3A 4WBRD 3ZITA 5BRTA 2GGTA 4IVFA 1TXUA 3KJYA 4LL4B 5DALB 1SJIA 4TR3A 2WRTA 2QC7A 2YV7A 1YEXA 4HQZA 1ABAA 1OYJA 1SVLA 4L5OA 4QQ7A 4MLYA 4MABA 5D9TA 4MH2A 5ID2B 2DJKA 8GSSA 4V2LA 3EYTA 3DEXA 4XS1A 1FO5A 3W8SA 1GSEA 1VF3A 3GMFA 3NZNA 3LSZA 1K0NA 2B7JA 1EGRA 3ZREA 3RPNA 1OE7A 4AKGA 3WGDA 3FZ4A 4AJ7A 2QSIA 10GSA 1A0FA 1YJ6A 3ME8A 1NHOA 6GSWA 4YAPA 3M9JA 3F4SA 2IPAA 1WPIA 4HZ2A 2PWJA 4TOPA 1ML6A 2YV9A 4JBBA 3ERWA 4BVYA 2IL3A 1DE1A 4J56E 4ZB8A 3DRNA 1EP8A 2YWMA 1XWAA 1XBSA 1T4YA 1XVQA 4AJ8A 4AJ6A 1HD2A 2A2PA 1F9MA 4GTUA 5A5KA 4KSOA 2YWOA 4PUFC 2HFDA 4KAEA 1O8WA 4QL9A 2P31A 2FWEA 1GULA 2PPTA 3LGCA 2FCHA 2V32A 2P0GA 1FW1A 2O3EA 2E7PA 2R37A 4MK3A 4X4JA 4NHZA 4KGIA 4KDXA 1S3DA 4V2MA 5ID2A 3ZZXA 3LG6A 1Z6MA 3WD6A 2R5GA 3EMPA 3QDNA 2C3QA 5ECPB 1MDIA 4G2EA 3FZAA 5JCWA 3VWUA 5C04A 3ZMLA 6GSSA 2LRCA 2V6OA 4G9HA 2YZHA 2GSTA 3ZTLA 2OKAA 3M9KA 3GX0A 4N0ZA 2WCIA 1YF1A 2O89A 1FHEA 13GSA 3VK9A 1G0TA 3HVXA 9GSSA 3A5WA 3IXRA 3ZRDA 2MBSA 3GTUB 2OE3A 2C3NA 3PINA 2H75A 4ZB9A 2NTOA 1BQ7A 2XBIA 4ZB7A 4X0XA 2VD0A 1ZOFA 4ICYA 4USSA 1OKTA 2F3MA 1V58A 4PUAA 3SBCA 4AF2A 3FRCA 4F9ZA 2HE3A 3HDCA 3DD3A 2DJ2A 2KP2A 4KDYA 1LBKA 4ML1A 1K0CA 4OCEA 2WW3A 3QOUA 3Q18A 3GV1A 1A24A 5JWQB 4NV5A 1ST9A 3ZYWA 1SVOA 3ZLPA 4E68A 2L6CA 3KTLA 3LFLA 2L6DA 2AV4A 4WBJA 1YZXA 4ECJA 3LEFA 3HKRA 3GH9A 5F05A 5IMVA 1R7HA 2RUEA 1H75A 3LW9A 3FK8A 1BG1A 1AXDA 4G19A 1A2JA 2IMKA 1PSQA 4IP6A 2GDRA 3H8QA 2F51A 1GSDA 2HSYA 1FOVA 2VLUA 3GKKA 4MF5A 4IN0A 4PXOA 1XWKA 1TRSA 1ZMAA 4L0UA 3UBKA 1GNEA 3GH6A 2H1GA 3F9UA 4GLTA 5DVBA 1PMTA 1GNWA 3IK7A 2JACA 5DJLA 1YKCA 1TTZA 3UVHA 5G1LA 2H8LA 3IC8A 5JWRB 1ACVA 3GTUA 3F8UA 3MIXA 3TKRA 1GLPA 3D5JA 2HQTA 1Y1UA 1EWXA 3KCMA 3KP8A 4KE3A 4WEYA 4K0GA 2DBCA 4MH3A 4LA1A 4Q5NA 1A0RP 20GSA 1UN2A 1JZWA 4EO3A 1UVZA 5DCGA 6GSTA 1KBNA 4TR4A 3FW2A 3DVWA 3ISOA 1Q98A 2L5OA 5IMFA 4PQIA 4CDOA 2JSYA 1ZCPA 3KH7A 4ZXGA 1XCCA 5IPHA 4PNFA 4XRAA 3TJKA 5ECMB 3FR9A 2C8UA 1T8EB 3TJFA 5ELAA 2L4CA 2R4VA 2XC2A 1O7UA 2TRXA 3RBTA 3F3RA 4HUAA 5CRWA 4V1Ap 2YOIA 3VI7A 3V1WA 2REMA 1SKSB 1PD21 2R0PA 3I6AA 2V2GA 1XWGA 2LEGA 3BBYA 4HS1A 5J4YA 5HFKA 2WVXB 7GSSA 1ZYPA 3HYPA 3IRAA 1V40A 3ZMKA 3EPTA 3KEBA 4YKFA 22GSA 3CXGA 2N5FA 3MDKA 2VL2C 1C72A 3LXTA 5CAXA 4EDZA 2L5LA 1O6JA 3TRQA 1B8XA 4DSSB 4NMUA 2VM2A 5D96A 5LD0A 4ILFA 6GSVA 1TJDA 4WXTA 3TJBA
chains in the Genus database with same CATH topology
1ZGNA 4TR1B 3QFBC 4HJMA 3Q74A 3US3A 5DJMA 4XIHA 1AQVA 1JZRA 1FB6A 1THOA 3J7Yk 3L0HA 3I9V2 2EC4A 4OCFA 3E0UA 1N8JA 3U5RE 4MJEA 3FR3A 2ON5A 2RIIA 1XW5A 2PU9C 1O73A 2VCXA 3MAKA 2UZ8A 3VWXA 2F8AA 5IQYA 4CHSA 2N5AA 1YQ1A 4TN8A 4ZL7A 1ILOA 3HJOA 4L0WA 1SD9A 3CBUA 2CVDA 1KEBA 2CAQA 4TVEA 4BA7A 5B6NA 1XXUA 2KHPA 1PX6A 1WMJA 1GSYA 1G7EA 2VL9A 5CREA 1R5AA 4I2UA 2VL2A 3CRUA 3G7YA 5D8IA 3TUEA 4HDEA 1TKDB 1SK1A 4MF7A 1A23A 3MSZA 1RQMA 4MJAA 1PRXA 5G30A 3UIWA 2R3XA 2HZFA 2RLIA 4G10A 11GSA 1M0UA 5IMAA 2C0DA 4POBA 2H66A 1EV9A 4ZBAA 2JZRA 4OO4A 3QAWA 5KN2A 4TXVA 2OACA 3TKPA 1ERVA 4NAXA 1TW9A 3TKQA 2CQ9A 3KM6A 5AGYA 1VF1A 5DQSA 2JU5A 2MYGA 1SVMA 2YNXA 4K6XA 4DSSA 3CTGA 3GL3A 1AQXA 1VGLA 1EEMA 1ZL9A 2CAIA 4TR1A 2GQLA 4I8BA 3ERFA 2GVPA 3G7JA 2FD3A 1AUCA 5A5HB 2VUPA 4POLA 1GSUA 1HNAA 3C1SA 1R4WA 1O81A 3M8NA 2H0HA 5AIVA 2IFQB 1SKWB 3HVVA 4HQSA 2NPBA 2I81A 2E2MA 1JLVA 3FEUA 4ZL9A 4ULXA 5KEJA 4MDCA 4KNDA 3DWVA 3TRXA 1PN9A 2HT9A 2B5XA 4Q5FA 4OD7A 2CV4A 3D4MA 2HRFA 4Q5QA 3L9VA 3FYGA 3UAPA 2C4JA 4IKHA 2CX4A 2CVKA 2OBKA 4PGTA 2LTKA 2LS5A 2VCTA 2J9HA 3DYRA 1OC3A 2YJHA 5KOWA 4Z7XA 1X9SB 1A8YA 4EUYA 5G2ZA 2D2ZA 3JCML 2FWGA 4FIWA 3RPPA 1WJKA 3GRXA 5F8BA 5ECSA 14GSA 1GWCA 3FHKA 1PKZA 2ZCTA 2WS2A 3ZFBA 4KCEA 4RI6A 4GSSA 4ISDA 4F2IA 4MZCA 5B6MA 3IAS2 4G0IA 3HD5A 3UL3A 3GSTA 2WJUA 2GS3A 5ABRA 1NHYA 3ZFLA 2H1BA 2K6VA 1XOBA 2IWTA 1SL2B 5FWGA 4JU5A 3CMIA 3P7XA 1TU8A 4NV2A 5LCZA 5J40A 2V41A 2PN8A 5A5HA 5CNWA 4RQRA 3O76A 1M7TA 5KN1A 1U3IA 1QGVA 1TRVA 3DVXA 2WDUA 1LU4A 1SYXA 1TI3A 1XIYA 2TRCP 2IFQA 5DBQA 2I1UA 4JR4A 2CA8A 1DE2A 4TW5A 3EU3A 3TKSA 4HZ4A 3GKXA 2C3TA 1PL2A 3R3EA 2H73A 4PNGA 3BCKA 1YEPA 3VPQA 3FY7A 4I5QA 3F3QA 5ENUA 5DALA 5ECLB 2NBSA 4K5SA 4ZIJA 1HNCA 1MEKA 4J57E 4K2DA 4DSRA 3N5OA 2RUFA 2XBQA 3VPTA 1R26A 1AQWA 4GXZA 3W8JA 4G0KA 1USBA 5IMZA 16GSA 3C73A 4EE0A 2QA2A 2H76A 1LJRA 2OJLA 2BTOT 5IMCA 1Z9HA 4JE1A 3DGQA 1XOAA 3RHCA 2O87A 3HVSA 3IHQA 4DSQA 2VD1A 1SL1B 3D21A 4IQ1A 2X49A 3OR5A 2LSTA 2OT3A 1U6TA 5ECIB 2YN1A 4MZWA 4O5UA 4LMWA 2H30A 4PTSA 1HNBA 4YAVA 5HFIA 4CY8A 5J9BA 4POMA 4TXOB 5JWOB 4OMVA 3PPUA 3KIJA 1CQGA 2FHEA 3O3TA 1SJZA 2LJAA 2K18A 5IOXA 5A1NB 3EVIA 4KX4A 4WETA 5IOWA 4BPYA 1TP9A 3HMJG 1AC1A 3L9UA 1YVLA 5D9WA 4HEA2 5EVOA 3D0ZA 3WT1A 2CX3A 3A2VA 4BVXB 2I3YA 2G2QA 2EFDA 2JL4A 5J4VA 1XPVA 2YWIA 2YANA 5H5RA 3LJRA 1Z6NA 1B9YC 1JFUA 1AW9A 5CO3A 2NVLA 3TDGA 1RW1A 4PURA 2B5YA 2LUSA 4K1FA 2VCQA 1B4PA 3A3TA 2OE0A 1TXXA 4PQ1A 4HI7A 4W66A 5IMDA 1BG5A 1OVNA 4MA9A 5BMUB 1JHBA 2F8FA 4EC0A 1TK8B 4V2NA 3HCZA 4P3YB 5GSSA 4FYBA 3GFKA 5F0GA 3C7MA 2O8VB 5J9CA 5HFGA 2EIRA 1QXHA 4NPBA 4WR4A 2DKIA 2GZPA 3PGTA 4IJIA 3HXSA 4KF9A 2YP6A 3GIXA 5JCGA 4KUNA 1GRXA 4ZBDA 2H0GA 2GSRA 4OO5A 1EV4A 3TRPA 3H4KA 2H72A 2DIZA 2LRTA 2PGTA 4TXOA 1GTBA 2PVQA 4IP1A 1E6BA 2TIRA 2O85A 1I5GA 5A1NA 3CYNA 1WIKA 4MPFA 5AIXA 3DKSA 4KCAA 4KB3A 4F0BA 3C1RA 4DEJA 5ECOB 5LNKe 3FMWA 3KP9A 1AAZA 2GLRA 4GCIA 2DKHA 5CRGA 3VWWA 4G01A 4BVXA 3AY8A 1EOHA 2GSQA 4E8EA 4HOJA 2H71A 4I97A 2OE1A 2YJ7A 4O92A 4D73B 3GKNA 3ZIJA 5F06A 1M2AA 4J2FA 1QMVA 5G5FA 4N30A 1ERUA 1JLWA 1UC7A 2EFCA 2R0GA 3TCOA 3NIVA 2HYXA 3QMXA 2JZSA 4GQCA 2ZNMA 3FKFA 4V1Ag 1K3LA 5J3RA 4L5LA 5HR2A 3IK9A 5J5NA 5C00A 3O6TA 4K7IA 2K8VA 5BMUA 3A5IA 2KOKA 5G5EA 2XPDA 4K0NA 2F9SA 2DJJA 3LXZA 4LLRA 3ZVJA 2XHFA 2GSSA 4TRXA 3RDWA 5DQYA 2PMTA 2H1AA 3MNGA 2L59A 3GL5A 2VL3A 1XWCA 1VRSD 2I4AA 4JEDA 2MMZA 1TK5B 2VAFA 5HQPA 2OA7A 3GSSA 5IO0A 4K2XA 2LRNA 5GAND 3QCPA 4GDFA 4EIPA 5DDLA 3F6DA 2X64A 2YWNA 4FYCA 2WB9A 4ID0A 3UJ1A 3VI5A 5IIZA 1TOFA 1W89A 3BOAA 1KNGA 4OFNA 5AN1A 2A4HA 4XHMA 5D9XA 4CW9A 2H01A 1THXA 1H4OA 4MPGA 1MDJA 4Z2UA 1V98A 2MMNA 4KH7A 2YZUA 1GUMA 4JR6A 5J47A 3LORA 2KP1A 3TKSE 1F2EA 5GZZB 2Z9SA 2QKEA 4ML6A 4D73A 5A4WA 3FZ5A 3A2XA 1TDIA 4OFMA 2B7KA 2IIYA 5CYYA 3KZQA 3H93A 3HJPA 1SKRB 1OC9B 3F0IA 2FA8A 3E9JB 1Y25A 2YCDA 3ZIVA 5ECHB 5KN0A 3GYKA 4K9ZA 4HU9A 2B1LA 4G0LA 4CY6A 2C0EA 5B7CA 1OAZA 2DJ1A 4MNNA 2L4QA 19GSA 4N10A 2VCZA 4XS6A 2R6KA 3UEMA 4FH8A 1O85A 1GL8A 5A4VA 1PL1A 2M80A 1T3BA 1WWJA 1N25A 3KXOA 3UOMA 4YQMA 2V1MA 4GSTA 2DMLA 2DC5A 4ECBA 4NHWA 2HI7A 4ZILA 2IMFA 3IR4A 3VURA 2PBJA 5INYA 3BCIA 2N5BA 1WRYA 1EGOA 1X5DA 4KW6A 3J7Yb 2AYTA 4AI6A 4N0VA 4GF0A 3DXBA 4WF4A 3DIEA 1GUKA 2MZCA 2FUG2 5E59A 3VLNA 18GSA 1FVJA 3IBHA 2KLXA 1V57A 2FWHA 2DJ3A 2VLTA 3D4TA 4ZBBA 5A4UA 5F07A 5B8BA 3APOA 3CWGA 4A5PA 1GTUA 4K7NA 4BVYB 2QGVA 2J23A 2C80A 1ON4A 3EC3A 2HZEB 4FO5A 1K0BA 2JADA 1WP0A 3NOFA 4MF6A 4EKZA 2H74A 1OC9A 2AAWA 3IAM2 5EY6A 3M1GA 5GAPD 1K0DA 3GUSA 3WYWA 1S3AA 1SL0B 1BF5A 1XWBA 3TKSC 2IJYA 3KTBA 3HY2A 4XCSA 1E2YA 1XZOA 1QQ2A 3GHAA 5G31A 1SK2A 1VF4A 4ZB6A 1A2LA 5CRDA 4FQUA 4YQUA 5KN3A 3ERGA 1O8XA 3EE2A 3EMXA 4IBPA 3IC4A 2R2JA 1PKWA 2H0IA 1YDKA 1T00A 3CRTA 1OE8A 2X8HA 5FT3A 3I69A 2M72A 2C0FA 3GURA 4XTSA 1X9MB 1CQHA 3C8EA 5IPGA 3C71A 1EZKA 2WZ9A 3VWVA 3TU3B 3HJMA 3MWHA 5HR1A 1ZYNA 1F37A 1J9BA 3UBLA 1U87A 2YPMA 2E0QA 5EPFA 2ON7A 3KGKA 4YH2A 2QA1A 5ECNB 1BX9A 2GQKA 2CZ2A 4WKWA 3IV4A 2MMAA 2PVOC 2GZZA 2A4VA 4H86A 2FY6A 2WULA 3IDVA 1FB0A 3CTFA 1HQOA 1X5CA 1M99A 3QFAC 5AISA 2C1YA 1V2AA 2HZEA 2LQOA 3QAGA 3Q6OA 2LNTA 2RM5A 3WGEA 3FZ9A 4FYUA 2LJKA 3ED3A 1QUWA 1B4QA 3F4TA 4O5RA 1TRUA 5DAKB 2WGRA 5A34B 2AHEA 1VF2A 3QD9A 3H79A 2EFEA 1XW6A 1SENA 4MZBA 3EURA 4DVCA 2GTUA 4L8EA 1KTEA 3HZ4A 3CSHA 1DUGA 4KA0A 2EIQA 2ES7A 2DJ0A 1OC8A 2JSZA 1PA3A 3PR8A 1QFNA 1XFLA 2UV8G 3IHGA 3TB2A 2RM6A 2LQQA 4QL7A 2WFCA 2HXKA 4ECCA 4ZL8A 2HNLA 5IO2A 2P5RA 2H19A 2HSNB 4IELA 1TI1A 1PQNA 3CSJA 4RI7A 3CSIA 1AIUA 2FWFA 3Q19A 1ZZYA 2L57A 4PQHA 4OFTA 3LYKA 3P90A 3UARA 3IOSA 1SU9A 3BJ5A 3I43A 3K8NA 2CT6A 2ZUPA 3KD0A 2CVBA 5HR0A 2EFHA 2LNSA 5CRHA 2KUCA 2EIOA 3A2WA 4XS4B 2K8SA 3EU4A 2HLSA 3HZ8A 2B3SA 4AKXB 2VKZG 1MDKA 2M46A 6GSXA 1HYUA 5L71A 1R5PA 3W6GA 4BL7B 17GSA 4I2TA 1V9WA 2DIYA 1Z7PA 4ECIA 1B48A 1XVWA 1URMA 1B9XC 3ZVJD 4IS0A 1GSQA 5ECRB 3D22A 1WE0A 2GT6A 1PN0A 2G0FA 2I9HA 5D9VA 5COHA 2IN3A 2AJQB 5DAKA 4MMMA 2H6XA 5A34A 1YF0A 1G6YA 1K0MA 3QAVA 3HA9A 1SJ6A 1BAYA 1SK0A 3RHBA 3WGXA 1RK4A 3ME7A 1FOHA 1QK8A 2FNOA 1MTCA 3M0FA 4JRRA 2HRKB 1ZYEA 2BJXA 5FHIA 3L9SA 2VLVA 4OWYA 3U6VA 2HSNA 4XRDA 1M2DA 1IYIA 4F82A 4Z2RA 3LYPA 1U88A 2VIMA 2X8GA 5ECKB 4LMVA 2P5QA 1M2BA 3TGZA 1T1VA 3L4NA 1Y6EA 4XS4A 3G7IA 5H5QA 3TOTA 2PUKC 2ALBA 1JZDA 1GTAA 2V6KA 6GSUA 4EF0A 2H1DA 5D73A 2BMXA 3EWLA 3LWAA 4HJ2A 1NSWA 5G1KA 3P8WA 4BL7A 2H1LA 3TJJA 2PERA 3HHVA 4GRFA 2H6ZA 1M9AA 4MJBA 3APQA 2GT5A 4E8HA 3DMLA 3QR6A 2XPEA 3KMNA 4N3ZA 5HR3A 4K8MA 1FG4A 4O7HA 2JZTA 12GSA 3GKMA 1SD8A 1A8LA 2HRNA 4X1UA 5H5SA 1NW2A 1K0OA 4Q5RA 2IMIA 3BD2A 3GNJA 2HSHA 1ERTA 4MP4A 2H70A 1IYHA 2AB6A 1BEDA 2MBTA 5J4UA 1FAAA 4Z2TA 4BWQA 2O7KA 3S9FA 1T4ZA 1X5EA 4WF5A 2X8CA 2X4AA 1F3BA 1K0AA 3L78A 1G6WA 5KOXA 3RAZA 3D6IA 1GTIA 2E2GA 1J0FA 2O5VA 1EEJA 2HRKA 3H1NA 1GSSA 1GP1A 3UVTA 2LKUA 1PGTA 1ZYQB 2VO4A 3E3EA 5JCUA 1X9WB 1GUHA 1XW9A 1SYRA 2X99A 4WR5A 1TU7A 6GSYA 1JZOA 2NDOA 1OKDA 4NWYA 3F6FA 5IM9A 1Q4JA 1A2MA 4ACSA 4N11A 2HSMB 4O5QA 1Z5YE 4I6XA 2GQMA 2B6MA 2OADA 2A2SA 3PH9A 4IW9A 4EIQA 4KDUA 3SWLA 3VFIA 1PX7A 1GH2A 2FLSA 4K5RA 2VOCA 1M9BA 1N2AA 2HRAA 2DMMA 2DSAA 1BJXA 1TRWA 2CZ3A 4BWSA 1Z3EA 1J08A 1WOUA 4EVMA 4PX1A 4MJCA 1G7OA 1EOGA 4YKGA 2B5EA 4IJ3A 1YY7A 1TK0B 1K3OA 4QMKA 2LV3A 4O32A 2MMOA 3F63A 4AKIA 4POKA 4GQFA 4GSNA 5J41A 1YKAA 1X0RA 1F3AA 3GA4A 3APSA 1MD3A 2R0CA 4MCUA 3KMOA 3GN3A 1I9DA 1ERWA 4JZQA 3IE3A 1Z7RA 4EL1A 4IQAA 1F6MC 4F0CA 2IMEA 4AGSA 3N9JA 1GSFA 4X43A 2DLXA 2VM1A 5DCHA 4GWRA 3FR6A 4F03A 3GX8A 1MD4A 2C0GA 2FA4A 2GZYA 1DSBA 1S3CA 2K9FA 4KSMA 1W4VA 3IA1A 2VCWA 1U3AA 4NXIA 2HSMA 5ECQB 5E4WA 5B8AA 3F4RA 5ELGA 3MYDA 4IGJA 4K7OA 5GSTA 1T7PB 1DBYA 1GLQA 2IMDA 2LJRA 3QPMA 2AUVA 3IPZA 3M3MA 2H6YA 4RQXA 5EL8A 4EDYA 5D93A 2FGXA 1FVKA 4HU7A 1BYEA 4AKHA 4IHUA 2VCVA 3LQ7A 4TKYA 3UMAA 3TJGA 4LL1B 2A2RA 3KH9A 3P2AA 3ZL5A 4TR0A 5CP1A 2B1KA 4YQVA 1K3YA 3TOUA 2OBIA 3WT2A 4EXJA 1UA5A 3R2QA 4RUVA 1EP7A 3EINA 3G9BA 1NM3A 4WBRD 3ZITA 5BRTA 2GGTA 4IVFA 1TXUA 3KJYA 4LL4B 5DALB 1SJIA 4TR3A 2WRTA 2QC7A 2YV7A 1YEXA 4HQZA 1ABAA 1OYJA 1SVLA 4L5OA 4QQ7A 4MLYA 4MABA 5D9TA 4MH2A 5ID2B 2DJKA 8GSSA 4V2LA 3EYTA 3DEXA 4XS1A 1FO5A 3W8SA 1GSEA 1VF3A 3GMFA 3NZNA 3LSZA 1K0NA 2B7JA 1EGRA 3ZREA 3RPNA 1OE7A 4AKGA 3WGDA 3FZ4A 4AJ7A 2QSIA 10GSA 1A0FA 1YJ6A 3ME8A 1NHOA 6GSWA 4YAPA 3M9JA 3F4SA 2IPAA 1WPIA 4HZ2A 2PWJA 4TOPA 1ML6A 2YV9A 4JBBA 3ERWA 4BVYA 2IL3A 1DE1A 4J56E 4ZB8A 3DRNA 1EP8A 2YWMA 1XWAA 1XBSA 1T4YA 1XVQA 4AJ8A 4AJ6A 1HD2A 2A2PA 1F9MA 4GTUA 5A5KA 4KSOA 2YWOA 4PUFC 2HFDA 4KAEA 1O8WA 4QL9A 2P31A 2FWEA 1GULA 2PPTA 3LGCA 2FCHA 2V32A 2P0GA 1FW1A 2E7PA 2R37A 4MK3A 4X4JA 4NHZA 4KGIA 4KDXA 1S3DA 4V2MA 5ID2A 3ZZXA 3LG6A 1Z6MA 3WD6A 2R5GA 3EMPA 3QDNA 2C3QA 5ECPB 1MDIA 4G2EA 3FZAA 5JCWA 3VWUA 5C04A 3ZMLA 6GSSA 2LRCA 2V6OA 4G9HA 2YZHA 2GSTA 3ZTLA 2OKAA 3M9KA 3GX0A 4N0ZA 2WCIA 1YF1A 2O89A 1FHEA 13GSA 3VK9A 1G0TA 3HVXA 9GSSA 3A5WA 3IXRA 3ZRDA 2MBSA 3GTUB 2OE3A 2C3NA 3PINA 2H75A 4ZB9A 2NTOA 1BQ7A 2XBIA 4ZB7A 4X0XA 2VD0A 1ZOFA 4ICYA 4USSA 1OKTA 2F3MA 1V58A 4PUAA 3SBCA 4AF2A 3FRCA 4F9ZA 2HE3A 3HDCA 3DD3A 2DJ2A 2KP2A 4KDYA 1LBKA 4ML1A 1K0CA 4OCEA 3QOUA 3Q18A 3GV1A 1A24A 5JWQB 4NV5A 1ST9A 3ZYWA 1SVOA 3ZLPA 4E68A 2L6CA 3KTLA 3LFLA 2L6DA 2AV4A 4WBJA 1YZXA 4ECJA 3LEFA 3HKRA 3GH9A 5F05A 5IMVA 1R7HA 2RUEA 1H75A 3LW9A 3FK8A 1BG1A 1AXDA 4G19A 1A2JA 2IMKA 1PSQA 4IP6A 2GDRA 3H8QA 2F51A 1GSDA 2HSYA 1FOVA 2VLUA 3GKKA 4MF5A 4IN0A 4PXOA 1XWKA 1TRSA 1ZMAA 4L0UA 3UBKA 1GNEA 3GH6A 2H1GA 3F9UA 4GLTA 5DVBA 1PMTA 1GNWA 3IK7A 2JACA 5DJLA 1YKCA 1TTZA 3UVHA 5G1LA 2H8LA 3IC8A 5JWRB 1ACVA 3GTUA 3F8UA 3MIXA 3TKRA 1GLPA 3D5JA 2HQTA 1Y1UA 1EWXA 3KCMA 3KP8A 4KE3A 4WEYA 4K0GA 2DBCA 4MH3A 4LA1A 4Q5NA 1A0RP 20GSA 1UN2A 1JZWA 4EO3A 1UVZA 5DCGA 6GSTA 1KBNA 4TR4A 3FW2A 3DVWA 3ISOA 1Q98A 2L5OA 5IMFA 4PQIA 4CDOA 2JSYA 1ZCPA 3KH7A 4ZXGA 1XCCA 5IPHA 4PNFA 4XRAA 3TJKA 5ECMB 3FR9A 2C8UA 1T8EB 3TJFA 5ELAA 2L4CA 2R4VA 2XC2A 1O7UA 2TRXA 3RBTA 3F3RA 4HUAA 5CRWA 4V1Ap 2YOIA 3VI7A 3V1WA 2REMA 1SKSB 1PD21 2R0PA 3I6AA 2V2GA 1XWGA 2LEGA 3BBYA 4HS1A 5J4YA 5HFKA 7GSSA 1ZYPA 3HYPA 3IRAA 1V40A 3ZMKA 3EPTA 3KEBA 4YKFA 22GSA 3CXGA 2N5FA 3MDKA 2VL2C 1C72A 3LXTA 5CAXA 4EDZA 2L5LA 1O6JA 3TRQA 1B8XA 4DSSB 4NMUA 2VM2A 5D96A 5LD0A 4ILFA 6GSVA 1TJDA 4WXTA 3TJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZGN A;  4TR1 B;  3QFB C;  4HJM A;  3Q74 A;  3US3 A;  5DJM A;  4XIH A;  1AQV A;  1JZR A;  1FB6 A;  1THO A;  3J7Y k;  3L0H A;  3I9V 2;  2EC4 A;  4OCF A;  3E0U A;  1N8J A;  3U5R E;  4MJE A;  3FR3 A;  2ON5 A;  2RII A;  1XW5 A;  2PU9 C;  1O73 A;  2VCX A;  3MAK A;  2UZ8 A;  3VWX A;  2F8A A;  5IQY A;  4CHS A;  2N5A A;  1YQ1 A;  4TN8 A;  4ZL7 A;  1ILO A;  3HJO A;  4L0W A;  1SD9 A;  3CBU A;  2CVD A;  1KEB A;  2CAQ A;  4TVE A;  4BA7 A;  5B6N A;  1XXU A;  2KHP A;  1PX6 A;  1WMJ A;  1GSY A;  1G7E A;  2VL9 A;  5CRE A;  1R5A A;  4I2U A;  2VL2 A;  3CRU A;  3G7Y A;  5D8I A;  3TUE A;  4HDE A;  1TKD B;  1SK1 A;  4MF7 A;  1A23 A;  3MSZ A;  1RQM A;  4MJA A;  1PRX A;  5G30 A;  3UIW A;  2R3X A;  2HZF A;  2RLI A;  4G10 A;  11GS A;  1M0U A;  5IMA A;  2C0D A;  4POB A;  2H66 A;  1EV9 A;  4ZBA A;  2JZR A;  4OO4 A;  3QAW A;  5KN2 A;  4TXV A;  2OAC A;  3TKP A;  1ERV A;  4NAX A;  1TW9 A;  3TKQ A;  2CQ9 A;  3KM6 A;  5AGY A;  1VF1 A;  5DQS A;  2JU5 A;  2MYG A;  2YNX A;  4K6X A;  4DSS A;  3CTG A;  3GL3 A;  1AQX A;  1VGL A;  1EEM A;  1ZL9 A;  2CAI A;  4TR1 A;  2GQL A;  4I8B A;  3ERF A;  2GVP A;  3G7J A;  2FD3 A;  1AUC A;  2VUP A;  4POL A;  1GSU A;  1HNA A;  3C1S A;  1R4W A;  1O81 A;  3M8N A;  2H0H A;  5AIV A;  2IFQ B;  1SKW B;  3HVV A;  4HQS A;  2NPB A;  2I81 A;  2E2M A;  1JLV A;  3FEU A;  4ZL9 A;  4ULX A;  5KEJ A;  4MDC A;  4KND A;  3DWV A;  3TRX A;  1PN9 A;  2HT9 A;  2B5X A;  4Q5F A;  4OD7 A;  2CV4 A;  3D4M A;  2HRF A;  4Q5Q A;  3L9V A;  3FYG A;  3UAP A;  2C4J A;  4IKH A;  2CX4 A;  2CVK A;  2OBK A;  4PGT A;  2LTK A;  2LS5 A;  2VCT A;  2J9H A;  3DYR A;  1OC3 A;  2YJH A;  4Z7X A;  1X9S B;  1A8Y A;  4EUY A;  5G2Z A;  2D2Z A;  3JCM L;  2FWG A;  4FIW A;  3RPP A;  1WJK A;  3GRX A;  5F8B A;  5ECS A;  14GS A;  1GWC A;  3FHK A;  1PKZ A;  2ZCT A;  2WS2 A;  3ZFB A;  4KCE A;  4RI6 A;  4GSS A;  4ISD A;  4F2I A;  4MZC A;  5B6M A;  3IAS 2;  4G0I A;  3HD5 A;  3UL3 A;  3GST A;  2WJU A;  2GS3 A;  5ABR A;  1NHY A;  3ZFL A;  2H1B A;  2K6V A;  1XOB A;  2IWT A;  1SL2 B;  5FWG A;  4JU5 A;  3CMI A;  3P7X A;  1TU8 A;  4NV2 A;  5LCZ A;  2V41 A;  2PN8 A;  5CNW A;  4RQR A;  3O76 A;  1M7T A;  5KN1 A;  1U3I A;  1QGV A;  1TRV A;  3DVX A;  2WDU A;  1LU4 A;  1SYX A;  1TI3 A;  1XIY A;  2TRC P;  2IFQ A;  5DBQ A;  2I1U A;  4JR4 A;  2CA8 A;  1DE2 A;  4TW5 A;  3EU3 A;  3TKS A;  4HZ4 A;  3GKX A;  2C3T A;  1PL2 A;  3R3E A;  2H73 A;  4PNG A;  3BCK A;  1YEP A;  3VPQ A;  3FY7 A;  4I5Q A;  3F3Q A;  5ENU A;  5DAL A;  5ECL B;  2NBS A;  4ZIJ A;  1HNC A;  1MEK A;  4J57 E;  4K2D A;  4DSR A;  3N5O A;  2RUF A;  2XBQ A;  3VPT A;  1R26 A;  1AQW A;  4GXZ A;  3W8J A;  4G0K A;  1USB A;  5IMZ A;  16GS A;  3C73 A;  4EE0 A;  2H76 A;  1LJR A;  2OJL A;  2BTO T;  5IMC A;  1Z9H A;  4JE1 A;  3DGQ A;  1XOA A;  3RHC A;  2O87 A;  3HVS A;  3IHQ A;  4DSQ A;  2VD1 A;  1SL1 B;  3D21 A;  4IQ1 A;  3OR5 A;  2LST A;  1U6T A;  5ECI B;  2YN1 A;  4MZW A;  4LMW A;  2H30 A;  4PTS A;  1HNB A;  4YAV A;  5HFI A;  5J9B A;  4POM A;  4TXO B;  5JWO B;  4OMV A;  3PPU A;  3KIJ A;  1CQG A;  2FHE A;  3O3T A;  1SJZ A;  2LJA A;  2K18 A;  5IOX A;  3EVI A;  4KX4 A;  4WET A;  5IOW A;  4BPY A;  1TP9 A;  1AC1 A;  3L9U A;  5D9W A;  4HEA 2;  5EVO A;  3D0Z A;  3WT1 A;  2CX3 A;  3A2V A;  4BVX B;  2I3Y A;  2G2Q A;  2JL4 A;  1XPV A;  2YWI A;  2YAN A;  5H5R A;  3LJR A;  1Z6N A;  1B9Y C;  1JFU A;  1AW9 A;  5CO3 A;  2NVL A;  3TDG A;  1RW1 A;  4PUR A;  2B5Y A;  2LUS A;  4K1F A;  2VCQ A;  1B4P A;  3A3T A;  2OE0 A;  1TXX A;  4PQ1 A;  4HI7 A;  5IMD A;  1BG5 A;  1OVN A;  4MA9 A;  1JHB A;  2F8F A;  4EC0 A;  1TK8 B;  4V2N A;  3HCZ A;  4P3Y B;  5GSS A;  4FYB A;  3GFK A;  5F0G A;  3C7M A;  2O8V B;  5J9C A;  5HFG A;  2EIR A;  1QXH A;  4NPB A;  4WR4 A;  2GZP A;  3PGT A;  4IJI A;  3HXS A;  4KF9 A;  2YP6 A;  3GIX A;  5JCG A;  4KUN A;  1GRX A;  4ZBD A;  2H0G A;  2GSR A;  4OO5 A;  1EV4 A;  3TRP A;  3H4K A;  2H72 A;  2DIZ A;  2LRT A;  2PGT A;  4TXO A;  1GTB A;  2PVQ A;  4IP1 A;  1E6B A;  2TIR A;  2O85 A;  1I5G A;  3CYN A;  1WIK A;  4MPF A;  5AIX A;  3DKS A;  4KCA A;  4KB3 A;  4F0B A;  3C1R A;  4DEJ A;  5ECO B;  5LNK e;  3KP9 A;  1AAZ A;  2GLR A;  4GCI A;  5CRG A;  3VWW A;  4BVX A;  3AY8 A;  1EOH A;  2GSQ A;  4E8E A;  4HOJ A;  2H71 A;  4I97 A;  2OE1 A;  2YJ7 A;  4O92 A;  4D73 B;  3GKN A;  3ZIJ A;  5F06 A;  1M2A A;  4J2F A;  1QMV A;  5G5F A;  4N30 A;  1ERU A;  1JLW A;  1UC7 A;  3TCO A;  3NIV A;  2HYX A;  3QMX A;  2JZS A;  4GQC A;  2ZNM A;  3FKF A;  4V1A g;  1K3L A;  5J3R A;  4L5L A;  5HR2 A;  3IK9 A;  5J5N A;  5C00 A;  3O6T A;  4K7I A;  2K8V A;  5BMU A;  2KOK A;  5G5E A;  2XPD A;  4K0N A;  2F9S A;  2DJJ A;  3LXZ A;  4LLR A;  3ZVJ A;  2XHF A;  2GSS A;  4TRX A;  3RDW A;  5DQY A;  2PMT A;  2H1A A;  3MNG A;  2L59 A;  3GL5 A;  2VL3 A;  1XWC A;  1VRS D;  2I4A A;  4JED A;  2MMZ A;  1TK5 B;  2VAF A;  5HQP A;  2OA7 A;  3GSS A;  5IO0 A;  2LRN A;  5GAN D;  3QCP A;  5DDL A;  3F6D A;  2X64 A;  2YWN A;  4FYC A;  2WB9 A;  4ID0 A;  3UJ1 A;  3VI5 A;  5IIZ A;  1TOF A;  1W89 A;  3BOA A;  1KNG A;  4OFN A;  5AN1 A;  4XHM A;  5D9X A;  4CW9 A;  2H01 A;  1THX A;  1H4O A;  4MPG A;  1MDJ A;  1V98 A;  2MMN A;  4KH7 A;  2YZU A;  1GUM A;  4JR6 A;  3LOR A;  2KP1 A;  3TKS E;  1F2E A;  5GZZ B;  2Z9S A;  2QKE A;  4ML6 A;  4D73 A;  5A4W A;  3FZ5 A;  3A2X A;  1TDI A;  4OFM A;  2B7K A;  2IIY A;  5CYY A;  3KZQ A;  3H93 A;  3HJP A;  1SKR B;  1OC9 B;  3F0I A;  2FA8 A;  3E9J B;  1Y25 A;  2YCD A;  3ZIV A;  5ECH B;  5KN0 A;  3GYK A;  4K9Z A;  4HU9 A;  2B1L A;  4G0L A;  2C0E A;  5B7C A;  1OAZ A;  2DJ1 A;  2L4Q A;  19GS A;  4N10 A;  2VCZ A;  4XS6 A;  2R6K A;  3UEM A;  4FH8 A;  1O85 A;  1GL8 A;  5A4V A;  1PL1 A;  2M80 A;  1T3B A;  1WWJ A;  3KXO A;  3UOM A;  4YQM A;  2V1M A;  4GST A;  2DML A;  2DC5 A;  4ECB A;  4NHW A;  2HI7 A;  4ZIL A;  2IMF A;  3IR4 A;  3VUR A;  2PBJ A;  5INY A;  3BCI A;  2N5B A;  1WRY A;  1EGO A;  1X5D A;  4KW6 A;  3J7Y b;  2AYT A;  4N0V A;  4GF0 A;  3DXB A;  4WF4 A;  3DIE A;  1GUK A;  2MZC A;  2FUG 2;  5E59 A;  3VLN A;  18GS A;  1FVJ A;  3IBH A;  2KLX A;  1V57 A;  2FWH A;  2DJ3 A;  2VLT A;  3D4T A;  4ZBB A;  5A4U A;  5F07 A;  5B8B A;  3APO A;  1GTU A;  4K7N A;  4BVY B;  2QGV A;  2J23 A;  2C80 A;  1ON4 A;  3EC3 A;  2HZE B;  4FO5 A;  1K0B A;  2JAD A;  1WP0 A;  3NOF A;  4MF6 A;  4EKZ A;  2H74 A;  1OC9 A;  2AAW A;  3IAM 2;  5EY6 A;  3M1G A;  5GAP D;  1K0D A;  3GUS A;  3WYW A;  1S3A A;  1SL0 B;  1XWB A;  3TKS C;  2IJY A;  3KTB A;  3HY2 A;  4XCS A;  1E2Y A;  1XZO A;  1QQ2 A;  3GHA A;  5G31 A;  1SK2 A;  1VF4 A;  4ZB6 A;  1A2L A;  5CRD A;  4FQU A;  4YQU A;  5KN3 A;  3ERG A;  1O8X A;  3EE2 A;  3EMX A;  4IBP A;  3IC4 A;  2R2J A;  1PKW A;  2H0I A;  1YDK A;  1T00 A;  3CRT A;  1OE8 A;  2X8H A;  5FT3 A;  3I69 A;  2M72 A;  2C0F A;  3GUR A;  4XTS A;  1X9M B;  1CQH A;  3C8E A;  5IPG A;  3C71 A;  1EZK A;  2WZ9 A;  3VWV A;  3HJM A;  3MWH A;  5HR1 A;  1F37 A;  1J9B A;  3UBL A;  1U87 A;  2YPM A;  2E0Q A;  5EPF A;  2ON7 A;  3KGK A;  4YH2 A;  5ECN B;  1BX9 A;  2GQK A;  2CZ2 A;  4WKW A;  3IV4 A;  2MMA A;  2PVO C;  2GZZ A;  2A4V A;  4H86 A;  2FY6 A;  2WUL A;  3IDV A;  1FB0 A;  3CTF A;  1HQO A;  1X5C A;  1M99 A;  3QFA C;  5AIS A;  2C1Y A;  1V2A A;  2HZE A;  2LQO A;  3QAG A;  3Q6O A;  2LNT A;  2RM5 A;  3WGE A;  3FZ9 A;  4FYU A;  2LJK A;  3ED3 A;  1QUW A;  1B4Q A;  3F4T A;  4O5R A;  1TRU A;  5DAK B;  2WGR A;  2AHE A;  1VF2 A;  3QD9 A;  3H79 A;  1XW6 A;  1SEN A;  4MZB A;  3EUR A;  4DVC A;  2GTU A;  4L8E A;  1KTE A;  3HZ4 A;  3CSH A;  1DUG A;  4KA0 A;  2EIQ A;  2ES7 A;  2DJ0 A;  1OC8 A;  2JSZ A;  1PA3 A;  3PR8 A;  1QFN A;  1XFL A;  3TB2 A;  2RM6 A;  2LQQ A;  4QL7 A;  2WFC A;  2HXK A;  4ECC A;  4ZL8 A;  2HNL A;  5IO2 A;  2P5R A;  2H19 A;  2HSN B;  4IEL A;  1TI1 A;  1PQN A;  3CSJ A;  4RI7 A;  3CSI A;  1AIU A;  2FWF A;  3Q19 A;  1ZZY A;  2L57 A;  4PQH A;  4OFT A;  3LYK A;  3P90 A;  3UAR A;  3IOS A;  1SU9 A;  3BJ5 A;  3I43 A;  3K8N A;  2CT6 A;  2ZUP A;  3KD0 A;  2CVB A;  5HR0 A;  2LNS A;  5CRH A;  2KUC A;  2EIO A;  3A2W A;  4XS4 B;  2K8S A;  3EU4 A;  2HLS A;  3HZ8 A;  2B3S A;  1MDK A;  2M46 A;  6GSX A;  1HYU A;  5L71 A;  1R5P A;  3W6G A;  4BL7 B;  17GS A;  4I2T A;  1V9W A;  2DIY A;  1Z7P A;  4ECI A;  1B48 A;  1XVW A;  1URM A;  1B9X C;  3ZVJ D;  4IS0 A;  1GSQ A;  5ECR B;  3D22 A;  1WE0 A;  2GT6 A;  2G0F A;  2I9H A;  5D9V A;  5COH A;  2IN3 A;  2AJQ B;  5DAK A;  4MMM A;  2H6X A;  1YF0 A;  1G6Y A;  1K0M A;  3QAV A;  3HA9 A;  1SJ6 A;  1BAY A;  1SK0 A;  3RHB A;  3WGX A;  1RK4 A;  3ME7 A;  1QK8 A;  2FNO A;  1MTC A;  3M0F A;  4JRR A;  2HRK B;  1ZYE A;  2BJX A;  5FHI A;  3L9S A;  2VLV A;  4OWY A;  3U6V A;  4XRD A;  1M2D A;  1IYI A;  4F82 A;  3LYP A;  1U88 A;  2VIM A;  2X8G A;  5ECK B;  4LMV A;  2P5Q A;  1M2B A;  3TGZ A;  1T1V A;  3L4N A;  1Y6E A;  4XS4 A;  3G7I A;  5H5Q A;  3TOT A;  2PUK C;  2ALB A;  1JZD A;  1GTA A;  2V6K A;  6GSU A;  4EF0 A;  2H1D A;  5D73 A;  2BMX A;  3EWL A;  3LWA A;  4HJ2 A;  1NSW A;  5G1K A;  3P8W A;  4BL7 A;  3TJJ A;  2PER A;  3HHV A;  4GRF A;  2H6Z A;  1M9A A;  4MJB A;  3APQ A;  2GT5 A;  4E8H A;  3DML A;  3QR6 A;  2XPE A;  3KMN A;  5HR3 A;  4K8M A;  1FG4 A;  4O7H A;  2JZT A;  12GS A;  3GKM A;  1SD8 A;  1A8L A;  2HRN A;  4X1U A;  5H5S A;  1NW2 A;  1K0O A;  4Q5R A;  2IMI A;  3BD2 A;  3GNJ A;  2HSH A;  1ERT A;  4MP4 A;  2H70 A;  1IYH A;  2AB6 A;  1BED A;  2MBT A;  5J4U A;  1FAA A;  4BWQ A;  2O7K A;  3S9F A;  1T4Z A;  1X5E A;  4WF5 A;  1F3B A;  2X8C A;  1K0A A;  3L78 A;  1G6W A;  3RAZ A;  3D6I A;  1GTI A;  2E2G A;  1J0F A;  1EEJ A;  2HRK A;  3H1N A;  1GSS A;  1GP1 A;  3UVT A;  2LKU A;  1PGT A;  1ZYQ B;  2VO4 A;  3E3E A;  5JCU A;  1X9W B;  1GUH A;  1XW9 A;  1SYR A;  2X99 A;  4WR5 A;  1TU7 A;  6GSY A;  1JZO A;  2NDO A;  1OKD A;  4NWY A;  3F6F A;  5IM9 A;  1Q4J A;  1A2M A;  4ACS A;  4N11 A;  2HSM B;  1Z5Y E;  4I6X A;  2GQM A;  2B6M A;  2OAD A;  2A2S A;  3PH9 A;  4IW9 A;  4KDU A;  3SWL A;  3VFI A;  1PX7 A;  1GH2 A;  2FLS A;  2VOC A;  1M9B A;  1N2A A;  2HRA A;  2DMM A;  2DSA A;  1BJX A;  1TRW A;  2CZ3 A;  4BWS A;  1Z3E A;  1J08 A;  1WOU A;  4EVM A;  4PX1 A;  4MJC A;  1G7O A;  1EOG A;  2B5E A;  4IJ3 A;  1YY7 A;  1TK0 B;  1K3O A;  2LV3 A;  4O32 A;  2MMO A;  3F63 A;  4POK A;  4GQF A;  4GSN A;  5J41 A;  1YKA A;  1X0R A;  1F3A A;  3GA4 A;  3APS A;  1MD3 A;  4MCU A;  3KMO A;  3GN3 A;  1I9D A;  1ERW A;  4JZQ A;  3IE3 A;  1Z7R A;  4EL1 A;  4IQA A;  1F6M C;  4F0C A;  2IME A;  4AGS A;  3N9J A;  1GSF A;  4X43 A;  2DLX A;  2VM1 A;  5DCH A;  4GWR A;  3FR6 A;  4F03 A;  3GX8 A;  1MD4 A;  2C0G A;  2FA4 A;  2GZY A;  1DSB A;  1S3C A;  2K9F A;  4KSM A;  1W4V A;  3IA1 A;  2VCW A;  1U3A A;  4NXI A;  2HSM A;  5ECQ B;  5E4W A;  5B8A A;  3F4R A;  5ELG A;  4K7O A;  4IGJ A;  5GST A;  1T7P B;  1DBY A;  1GLQ A;  2IMD A;  2LJR A;  3QPM A;  2AUV A;  3IPZ A;  3M3M A;  2H6Y A;  4RQX A;  5EL8 A;  4EDY A;  5D93 A;  2FGX A;  1FVK A;  4HU7 A;  1BYE A;  4IHU A;  2VCV A;  3LQ7 A;  4TKY A;  3UMA A;  3TJG A;  4LL1 B;  2A2R A;  3KH9 A;  3P2A A;  3ZL5 A;  4TR0 A;  5CP1 A;  2B1K A;  4YQV A;  1K3Y A;  3TOU A;  2OBI A;  3WT2 A;  4EXJ A;  1UA5 A;  3R2Q A;  4RUV A;  1EP7 A;  3EIN A;  3G9B A;  1NM3 A;  4WBR D;  3ZIT A;  2GGT A;  4IVF A;  3KJY A;  4LL4 B;  5DAL B;  1SJI A;  4TR3 A;  2WRT A;  2QC7 A;  2YV7 A;  1YEX A;  4HQZ A;  1ABA A;  1OYJ A;  4L5O A;  4QQ7 A;  4MLY A;  4MAB A;  5D9T A;  4MH2 A;  5ID2 B;  2DJK A;  8GSS A;  4V2L A;  3EYT A;  3DEX A;  4XS1 A;  1FO5 A;  3W8S A;  1GSE A;  1VF3 A;  3GMF A;  3NZN A;  3LSZ A;  1K0N A;  2B7J A;  1EGR A;  3ZRE A;  3RPN A;  1OE7 A;  3WGD A;  3FZ4 A;  4AJ7 A;  2QSI A;  10GS A;  1A0F A;  1YJ6 A;  3ME8 A;  1NHO A;  6GSW A;  4YAP A;  3M9J A;  3F4S A;  2IPA A;  1WPI A;  4HZ2 A;  2PWJ A;  4TOP A;  1ML6 A;  2YV9 A;  4JBB A;  3ERW A;  4BVY A;  2IL3 A;  1DE1 A;  4J56 E;  4ZB8 A;  3DRN A;  1EP8 A;  2YWM A;  1XWA A;  1XBS A;  1T4Y A;  1XVQ A;  4AJ8 A;  4AJ6 A;  1HD2 A;  1F9M A;  4GTU A;  5A5K A;  4KSO A;  2YWO A;  4PUF C;  2HFD A;  4KAE A;  1O8W A;  4QL9 A;  2P31 A;  2FWE A;  1GUL A;  2PPT A;  3LGC A;  2FCH A;  2V32 A;  2P0G A;  1FW1 A;  2E7P A;  2R37 A;  4MK3 A;  4NHZ A;  4KGI A;  4KDX A;  1S3D A;  4V2M A;  5ID2 A;  3ZZX A;  3LG6 A;  1Z6M A;  3WD6 A;  2R5G A;  3EMP A;  3QDN A;  2C3Q A;  5ECP B;  1MDI A;  4G2E A;  3FZA A;  5JCW A;  3VWU A;  5C04 A;  3ZML A;  6GSS A;  2LRC A;  2V6O A;  4G9H A;  2YZH A;  2GST A;  3ZTL A;  2OKA A;  3M9K A;  3GX0 A;  4N0Z A;  2WCI A;  1YF1 A;  2O89 A;  1FHE A;  13GS A;  3VK9 A;  1G0T A;  3HVX A;  9GSS A;  3A5W A;  3IXR A;  3ZRD A;  2MBS A;  3GTU B;  2OE3 A;  2C3N A;  3PIN A;  2H75 A;  4ZB9 A;  2NTO A;  1BQ7 A;  2XBI A;  4X0X A;  2VD0 A;  1ZOF A;  4USS A;  1OKT A;  2F3M A;  1V58 A;  4PUA A;  3SBC A;  4AF2 A;  3FRC A;  4F9Z A;  2HE3 A;  3HDC A;  3DD3 A;  2DJ2 A;  2KP2 A;  4KDY A;  1LBK A;  4ML1 A;  1K0C A;  4OCE A;  3QOU A;  3Q18 A;  3GV1 A;  1A24 A;  5JWQ B;  4NV5 A;  1ST9 A;  3ZYW A;  3ZLP A;  2L6C A;  3KTL A;  3LFL A;  2L6D A;  2AV4 A;  4WBJ A;  1YZX A;  4ECJ A;  3LEF A;  3HKR A;  3GH9 A;  5F05 A;  5IMV A;  1R7H A;  2RUE A;  1H75 A;  3FK8 A;  1AXD A;  4G19 A;  1A2J A;  2IMK A;  1PSQ A;  4IP6 A;  2GDR A;  3H8Q A;  2F51 A;  1GSD A;  2HSY A;  1FOV A;  2VLU A;  3GKK A;  4MF5 A;  4IN0 A;  4PXO A;  1XWK A;  1TRS A;  1ZMA A;  4L0U A;  3UBK A;  1GNE A;  3GH6 A;  2H1G A;  3F9U A;  4GLT A;  5DVB A;  1PMT A;  1GNW A;  3IK7 A;  2JAC A;  5DJL A;  1YKC A;  1TTZ A;  3UVH A;  5G1L A;  2H8L A;  3IC8 A;  5JWR B;  1ACV A;  3GTU A;  3F8U A;  3TKR A;  1GLP A;  3D5J A;  2HQT A;  1EWX A;  3KCM A;  3KP8 A;  4KE3 A;  4WEY A;  4K0G A;  2DBC A;  4MH3 A;  4LA1 A;  4Q5N A;  1A0R P;  20GS A;  1UN2 A;  1JZW A;  4EO3 A;  1UVZ A;  5DCG A;  6GST A;  1KBN A;  4TR4 A;  3FW2 A;  3DVW A;  3ISO A;  1Q98 A;  2L5O A;  5IMF A;  4PQI A;  4CDO A;  2JSY A;  1ZCP A;  3KH7 A;  4ZXG A;  1XCC A;  5IPH A;  4PNF A;  4XRA A;  3TJK A;  5ECM B;  3FR9 A;  2C8U A;  1T8E B;  3TJF A;  5ELA A;  2L4C A;  2R4V A;  2XC2 A;  1O7U A;  2TRX A;  3RBT A;  3F3R A;  4HUA A;  5CRW A;  4V1A p;  2YOI A;  3VI7 A;  3V1W A;  2REM A;  1SKS B;  1PD2 1;  3I6A A;  2V2G A;  1XWG A;  2LEG A;  3BBY A;  4HS1 A;  5HFK A;  7GSS A;  3HYP A;  3IRA A;  1V40 A;  3ZMK A;  3KEB A;  22GS A;  3CXG A;  2N5F A;  3MDK A;  2VL2 C;  1C72 A;  3LXT A;  5CAX A;  4EDZ A;  2L5L A;  1O6J A;  3TRQ A;  1B8X A;  4DSS B;  4NMU A;  2VM2 A;  5D96 A;  5LD0 A;  4ILF A;  6GSV A;  1TJD A;  4WXT A;  3TJB A; 
#chains in the Genus database with same CATH topology
 1ZGN A;  4TR1 B;  3QFB C;  4HJM A;  3Q74 A;  3US3 A;  5DJM A;  4XIH A;  1AQV A;  1JZR A;  1FB6 A;  1THO A;  3J7Y k;  3L0H A;  3I9V 2;  2EC4 A;  4OCF A;  3E0U A;  1N8J A;  3U5R E;  4MJE A;  3FR3 A;  2ON5 A;  2RII A;  1XW5 A;  2PU9 C;  1O73 A;  2VCX A;  3MAK A;  2UZ8 A;  3VWX A;  2F8A A;  5IQY A;  4CHS A;  2N5A A;  1YQ1 A;  4TN8 A;  4ZL7 A;  1ILO A;  3HJO A;  4L0W A;  1SD9 A;  3CBU A;  2CVD A;  1KEB A;  2CAQ A;  4TVE A;  4BA7 A;  5B6N A;  1XXU A;  2KHP A;  1PX6 A;  1WMJ A;  1GSY A;  1G7E A;  2VL9 A;  1M3J A;  5CRE A;  1R5A A;  4I2U A;  2VL2 A;  3CRU A;  3G7Y A;  5D8I A;  3TUE A;  4HDE A;  1TKD B;  1SK1 A;  4MF7 A;  1A23 A;  3MSZ A;  1RQM A;  4MJA A;  1PRX A;  5G30 A;  3UIW A;  2R3X A;  2HZF A;  2RLI A;  4G10 A;  11GS A;  1M0U A;  5IMA A;  2C0D A;  4POB A;  2H66 A;  1EV9 A;  4ZBA A;  2JZR A;  4OO4 A;  2WVX A;  3QAW A;  5KN2 A;  4TXV A;  2OAC A;  3TKP A;  1ERV A;  4NAX A;  1TW9 A;  3TKQ A;  2CQ9 A;  3KM6 A;  5AGY A;  1VF1 A;  5DQS A;  2JU5 A;  2MYG A;  1SVM A;  2YNX A;  4K6X A;  4DSS A;  3CTG A;  3GL3 A;  1AQX A;  1VGL A;  1EEM A;  1ZL9 A;  2CAI A;  4TR1 A;  2GQL A;  4I8B A;  3ERF A;  2GVP A;  3G7J A;  2FD3 A;  1AUC A;  5A5H B;  2VUP A;  4POL A;  1GSU A;  1HNA A;  3C1S A;  1R4W A;  1O81 A;  3M8N A;  2H0H A;  5AIV A;  2IFQ B;  1SKW B;  1S4B P;  3HVV A;  4HQS A;  2NPB A;  2I81 A;  2E2M A;  1JLV A;  3FEU A;  4ZL9 A;  4ULX A;  5KEJ A;  4MDC A;  4KND A;  3DWV A;  3TRX A;  1PN9 A;  2HT9 A;  2B5X A;  4Q5F A;  4OD7 A;  2CV4 A;  3D4M A;  2HRF A;  4Q5Q A;  3L9V A;  3FYG A;  3UAP A;  2C4J A;  4IKH A;  2CX4 A;  2CVK A;  2OBK A;  4PGT A;  2LTK A;  2LS5 A;  2VCT A;  2J9H A;  3DYR A;  1OC3 A;  2YJH A;  5KOW A;  4Z7X A;  1X9S B;  1A8Y A;  4EUY A;  5G2Z A;  2D2Z A;  3JCM L;  2FWG A;  4FIW A;  3RPP A;  1WJK A;  3GRX A;  5F8B A;  5ECS A;  14GS A;  1GWC A;  3FHK A;  1PKZ A;  2ZCT A;  2WS2 A;  3ZFB A;  4KCE A;  2WVY A;  4RI6 A;  4GSS A;  4ISD A;  4F2I A;  4MZC A;  5B6M A;  3IAS 2;  4G0I A;  3HD5 A;  3UL3 A;  3GST A;  2WJU A;  2GS3 A;  5ABR A;  1NHY A;  3ZFL A;  2H1B A;  2K6V A;  1XOB A;  2IWT A;  1SL2 B;  5FWG A;  4JU5 A;  3CMI A;  3P7X A;  1TU8 A;  4NV2 A;  5LCZ A;  5J40 A;  2V41 A;  2PN8 A;  5A5H A;  5CNW A;  4RQR A;  3O76 A;  1M7T A;  5KN1 A;  1U3I A;  1QGV A;  1TRV A;  3DVX A;  2WDU A;  1LU4 A;  1SYX A;  1TI3 A;  1XIY A;  2TRC P;  2IFQ A;  5DBQ A;  2I1U A;  4JR4 A;  2CA8 A;  1DE2 A;  4TW5 A;  3EU3 A;  3TKS A;  4HZ4 A;  3GKX A;  2C3T A;  1PL2 A;  3R3E A;  2H73 A;  4PNG A;  3BCK A;  1YEP A;  3VPQ A;  3FY7 A;  3RFR C;  4I5Q A;  3F3Q A;  5ENU A;  5DAL A;  5ECL B;  2NBS A;  4K5S A;  4ZIJ A;  1HNC A;  1MEK A;  4J57 E;  4K2D A;  4DSR A;  3N5O A;  2RUF A;  2XBQ A;  3VPT A;  1R26 A;  1AQW A;  4GXZ A;  3W8J A;  4G0K A;  1USB A;  5IMZ A;  16GS A;  3C73 A;  4EE0 A;  2QA2 A;  2H76 A;  1LJR A;  2OJL A;  2BTO T;  5IMC A;  1Z9H A;  4JE1 A;  3DGQ A;  1XOA A;  3RHC A;  2O87 A;  3HVS A;  3IHQ A;  4DSQ A;  2VD1 A;  1SL1 B;  3D21 A;  4IQ1 A;  2X49 A;  3OR5 A;  2LST A;  2OT3 A;  1U6T A;  5ECI B;  2YN1 A;  4MZW A;  4O5U A;  4LMW A;  2H30 A;  4PTS A;  1HNB A;  4YAV A;  5HFI A;  4CY8 A;  5J9B A;  4POM A;  4TXO B;  5JWO B;  4OMV A;  3PPU A;  3KIJ A;  1CQG A;  2FHE A;  3O3T A;  1SJZ A;  2LJA A;  2K18 A;  5IOX A;  5A1N B;  3EVI A;  2WVZ A;  4KX4 A;  4WET A;  5IOW A;  4BPY A;  1TP9 A;  3HMJ G;  1AC1 A;  3L9U A;  1YVL A;  5D9W A;  4HEA 2;  5EVO A;  3D0Z A;  3WT1 A;  2CX3 A;  2WW1 A;  3A2V A;  4BVX B;  2I3Y A;  2G2Q A;  2EFD A;  2JL4 A;  5J4V A;  1XPV A;  2YWI A;  2YAN A;  5H5R A;  3LJR A;  1Z6N A;  1B9Y C;  1JFU A;  1AW9 A;  5CO3 A;  2NVL A;  3TDG A;  1RW1 A;  4PUR A;  2B5Y A;  2LUS A;  4K1F A;  2VCQ A;  1B4P A;  3A3T A;  2OE0 A;  1TXX A;  4PQ1 A;  4HI7 A;  4W66 A;  5IMD A;  1BG5 A;  4PI2 C;  1OVN A;  4MA9 A;  5BMU B;  1JHB A;  2F8F A;  4EC0 A;  1TK8 B;  4V2N A;  3HCZ A;  4P3Y B;  5GSS A;  4FYB A;  3GFK A;  5F0G A;  3C7M A;  2O8V B;  5J9C A;  5HFG A;  2EIR A;  1QXH A;  4NPB A;  4WR4 A;  2DKI A;  2GZP A;  3PGT A;  4IJI A;  3HXS A;  4KF9 A;  2YP6 A;  3GIX A;  5JCG A;  4KUN A;  1GRX A;  4ZBD A;  2H0G A;  2GSR A;  2WW0 A;  4OO5 A;  2O36 A;  1EV4 A;  3TRP A;  3H4K A;  2H72 A;  2DIZ A;  2LRT A;  2PGT A;  4TXO A;  1GTB A;  2PVQ A;  4IP1 A;  1E6B A;  2TIR A;  2O85 A;  1I5G A;  5A1N A;  3CYN A;  1WIK A;  4MPF A;  5AIX A;  3DKS A;  4KCA A;  4KB3 A;  4F0B A;  3C1R A;  4DEJ A;  5ECO B;  5LNK e;  3FMW A;  3KP9 A;  1AAZ A;  2GLR A;  4GCI A;  2DKH A;  5CRG A;  3VWW A;  4G01 A;  4BVX A;  3AY8 A;  1EOH A;  2GSQ A;  4E8E A;  4HOJ A;  2H71 A;  4I97 A;  2OE1 A;  2YJ7 A;  4O92 A;  4D73 B;  3GKN A;  3ZIJ A;  5F06 A;  1M2A A;  4J2F A;  1QMV A;  5G5F A;  4N30 A;  1ERU A;  1JLW A;  1UC7 A;  2EFC A;  2R0G A;  3TCO A;  2WZS A;  3NIV A;  2HYX A;  3QMX A;  2JZS A;  4GQC A;  2ZNM A;  3FKF A;  4V1A g;  1K3L A;  5J3R A;  3HVN A;  4L5L A;  5HR2 A;  3IK9 A;  5J5N A;  5C00 A;  3O6T A;  4K7I A;  2K8V A;  5BMU A;  3A5I A;  2KOK A;  5G5E A;  2XPD A;  4K0N A;  2F9S A;  2DJJ A;  3LXZ A;  4LLR A;  3ZVJ A;  2XHF A;  2GSS A;  4TRX A;  3RDW A;  5DQY A;  2PMT A;  2H1A A;  3MNG A;  2L59 A;  3GL5 A;  2VL3 A;  1XWC A;  1VRS D;  2I4A A;  4JED A;  2MMZ A;  1TK5 B;  2VAF A;  5HQP A;  2OA7 A;  3GSS A;  5IO0 A;  4K2X A;  2LRN A;  5GAN D;  3QCP A;  4GDF A;  4EIP A;  5DDL A;  3F6D A;  2X64 A;  2YWN A;  4FYC A;  2WB9 A;  4ID0 A;  3UJ1 A;  3VI5 A;  5IIZ A;  1TOF A;  1W89 A;  3BOA A;  1KNG A;  4OFN A;  3CHX C;  5AN1 A;  2A4H A;  4XHM A;  5D9X A;  4CW9 A;  2H01 A;  1THX A;  1H4O A;  4MPG A;  1MDJ A;  4Z2U A;  1V98 A;  2MMN A;  4KH7 A;  2YZU A;  1GUM A;  4JR6 A;  5J47 A;  3LOR A;  2KP1 A;  3TKS E;  1F2E A;  5GZZ B;  2Z9S A;  2QKE A;  4ML6 A;  4D73 A;  5A4W A;  3FZ5 A;  3A2X A;  1TDI A;  4OFM A;  2B7K A;  2IIY A;  5CYY A;  3KZQ A;  3HJP A;  3H93 A;  1SKR B;  1OC9 B;  3F0I A;  2FA8 A;  3E9J B;  1Y25 A;  2YCD A;  3ZIV A;  5ECH B;  5KN0 A;  1XG8 A;  3GYK A;  4K9Z A;  4HU9 A;  2B1L A;  4G0L A;  4CY6 A;  2C0E A;  5B7C A;  1OAZ A;  2DJ1 A;  4MNN A;  2L4Q A;  19GS A;  4N10 A;  2VCZ A;  4XS6 A;  2R6K A;  3UEM A;  4FH8 A;  1O85 A;  1GL8 A;  5A4V A;  1PL1 A;  2M80 A;  1T3B A;  1WWJ A;  1N25 A;  3KXO A;  3UOM A;  4YQM A;  2V1M A;  4GST A;  2DML A;  2DC5 A;  4ECB A;  1S3R A;  4NHW A;  2HI7 A;  4ZIL A;  2IMF A;  3IR4 A;  3VUR A;  2PBJ A;  5INY A;  3BCI A;  2N5B A;  1WRY A;  1EGO A;  1X5D A;  4KW6 A;  3J7Y b;  2AYT A;  4AI6 A;  4N0V A;  4GF0 A;  3DXB A;  4WF4 A;  3DIE A;  1GUK A;  2MZC A;  2FUG 2;  5E59 A;  3VLN A;  18GS A;  1FVJ A;  3IBH A;  2KLX A;  1V57 A;  2FWH A;  2DJ3 A;  2VLT A;  3D4T A;  4ZBB A;  5A4U A;  5F07 A;  5B8B A;  3APO A;  3CWG A;  4A5P A;  1GTU A;  4K7N A;  4BVY B;  2QGV A;  2J23 A;  2C80 A;  1ON4 A;  3EC3 A;  2HZE B;  4FO5 A;  1K0B A;  2JAD A;  1WP0 A;  3NOF A;  4MF6 A;  4EKZ A;  2H74 A;  1OC9 A;  4PHZ C;  2AAW A;  3IAM 2;  5EY6 A;  3M1G A;  5GAP D;  1K0D A;  3GUS A;  3WYW A;  1S3A A;  1SL0 B;  1BF5 A;  1XWB A;  3TKS C;  2IJY A;  3KTB A;  3HY2 A;  4XCS A;  1E2Y A;  1XZO A;  1QQ2 A;  3GHA A;  1M3I A;  5G31 A;  1SK2 A;  1VF4 A;  4ZB6 A;  1A2L A;  5CRD A;  4FQU A;  4YQU A;  5KN3 A;  3ERG A;  1O8X A;  3EE2 A;  3EMX A;  4IBP A;  3IC4 A;  2R2J A;  1PKW A;  2H0I A;  1YDK A;  1T00 A;  3CRT A;  1OE8 A;  2X8H A;  5FT3 A;  3I69 A;  2M72 A;  2C0F A;  3GUR A;  4XTS A;  1X9M B;  1CQH A;  3C8E A;  5IPG A;  3C71 A;  1EZK A;  2WZ9 A;  3VWV A;  3TU3 B;  3HJM A;  3MWH A;  5HR1 A;  1ZYN A;  1F37 A;  1J9B A;  3UBL A;  1U87 A;  2YPM A;  2E0Q A;  5EPF A;  2ON7 A;  3KGK A;  4YH2 A;  2QA1 A;  5ECN B;  1BX9 A;  2GQK A;  2CZ2 A;  4WKW A;  3IV4 A;  2MMA A;  2PVO C;  2GZZ A;  2A4V A;  4H86 A;  2FY6 A;  2WUL A;  3IDV A;  1FB0 A;  3CTF A;  1HQO A;  1X5C A;  4HSC X;  1M99 A;  3QFA C;  5AIS A;  2C1Y A;  1V2A A;  2HZE A;  2LQO A;  3QAG A;  3Q6O A;  2LNT A;  2RM5 A;  3WGE A;  3FZ9 A;  4FYU A;  2LJK A;  3ED3 A;  1QUW A;  1B4Q A;  3F4T A;  4O5R A;  4BIK A;  1TRU A;  5DAK B;  2WGR A;  5A34 B;  2AHE A;  1VF2 A;  3QD9 A;  3H79 A;  2EFE A;  1XW6 A;  1SEN A;  4MZB A;  3EUR A;  4DVC A;  2GTU A;  4L8E A;  1KTE A;  3HZ4 A;  3CSH A;  1DUG A;  4KA0 A;  2EIQ A;  2ES7 A;  2DJ0 A;  1OC8 A;  2JSZ A;  1PA3 A;  3PR8 A;  1QFN A;  1XFL A;  2UV8 G;  3IHG A;  3TB2 A;  2RM6 A;  2LQQ A;  4QL7 A;  2WFC A;  2HXK A;  4ECC A;  4ZL8 A;  2HNL A;  5IO2 A;  2P5R A;  2H19 A;  2HSN B;  4IEL A;  1TI1 A;  1PQN A;  3CSJ A;  4RI7 A;  3CSI A;  1AIU A;  2FWF A;  3Q19 A;  1ZZY A;  2L57 A;  4PQH A;  4OFT A;  3LYK A;  3P90 A;  3UAR A;  3IOS A;  1SU9 A;  3BJ5 A;  3I43 A;  3K8N A;  2CT6 A;  2ZUP A;  3KD0 A;  2CVB A;  5HR0 A;  2EFH A;  2LNS A;  5CRH A;  2KUC A;  2EIO A;  3A2W A;  4XS4 B;  2K8S A;  3EU4 A;  2HLS A;  3HZ8 A;  2B3S A;  4AKX B;  2VKZ G;  1MDK A;  2M46 A;  6GSX A;  1HYU A;  5L71 A;  1R5P A;  3W6G A;  4BL7 B;  17GS A;  4I2T A;  1V9W A;  2DIY A;  2WW2 A;  1Z7P A;  4ECI A;  1B48 A;  1XVW A;  1URM A;  1B9X C;  3ZVJ D;  4IS0 A;  1GSQ A;  5ECR B;  3D22 A;  1WE0 A;  2GT6 A;  1PN0 A;  2G0F A;  2I9H A;  5D9V A;  5COH A;  2IN3 A;  2AJQ B;  5DAK A;  4MMM A;  2H6X A;  5A34 A;  1YF0 A;  1G6Y A;  1K0M A;  3QAV A;  3HA9 A;  1SJ6 A;  1BAY A;  1SK0 A;  3RHB A;  3WGX A;  1RK4 A;  3ME7 A;  1FOH A;  1QK8 A;  2FNO A;  1MTC A;  3M0F A;  4JRR A;  2HRK B;  1ZYE A;  2BJX A;  5FHI A;  3L9S A;  2VLV A;  4OWY A;  3U6V A;  2HSN A;  4XRD A;  1M2D A;  1IYI A;  4F82 A;  4Z2R A;  3LYP A;  1U88 A;  2VIM A;  2X8G A;  5ECK B;  4LMV A;  2P5Q A;  1M2B A;  3TGZ A;  1T1V A;  3RGB C;  3L4N A;  1Y6E A;  4XS4 A;  3G7I A;  5H5Q A;  3TOT A;  2PUK C;  3CQF A;  2ALB A;  1JZD A;  1GTA A;  2V6K A;  6GSU A;  4EF0 A;  2H1D A;  5D73 A;  2BMX A;  3EWL A;  3LWA A;  4HJ2 A;  1NSW A;  5G1K A;  3P8W A;  4BL7 A;  2H1L A;  3TJJ A;  2PER A;  3HHV A;  4GRF A;  2H6Z A;  1M9A A;  4MJB A;  3APQ A;  2GT5 A;  4E8H A;  3DML A;  3QR6 A;  2XPE A;  3KMN A;  4N3Z A;  5HR3 A;  4K8M A;  1FG4 A;  4O7H A;  2JZT A;  12GS A;  3GKM A;  4PI0 C;  1SD8 A;  1A8L A;  2HRN A;  4X1U A;  5H5S A;  1NW2 A;  1K0O A;  4Q5R A;  2IMI A;  3BD2 A;  3GNJ A;  2HSH A;  1ERT A;  4MP4 A;  2H70 A;  1IYH A;  2AB6 A;  1BED A;  2MBT A;  5J4U A;  1FAA A;  4Z2T A;  4BWQ A;  2O7K A;  3S9F A;  1T4Z A;  1X5E A;  4WF5 A;  2X8C A;  2X4A A;  1F3B A;  1K0A A;  3L78 A;  1G6W A;  5KOX A;  3RAZ A;  3D6I A;  1GTI A;  2E2G A;  1J0F A;  2O5V A;  1EEJ A;  2HRK A;  3H1N A;  1GSS A;  1GP1 A;  3UVT A;  2LKU A;  1PGT A;  1ZYQ B;  2VO4 A;  3E3E A;  5JCU A;  1X9W B;  1GUH A;  1XW9 A;  1SYR A;  2X99 A;  4WR5 A;  1TU7 A;  6GSY A;  1JZO A;  2NDO A;  1OKD A;  4NWY A;  3F6F A;  5IM9 A;  1Q4J A;  1A2M A;  4ACS A;  4N11 A;  2HSM B;  4O5Q A;  1Z5Y E;  4I6X A;  2GQM A;  2B6M A;  2OAD A;  2A2S A;  3PH9 A;  4IW9 A;  4EIQ A;  4KDU A;  3SWL A;  3VFI A;  1PX7 A;  1GH2 A;  2FLS A;  4K5R A;  2VOC A;  1M9B A;  1N2A A;  2HRA A;  2DMM A;  2DSA A;  1BJX A;  1TRW A;  2CZ3 A;  4BWS A;  1Z3E A;  1J08 A;  1WOU A;  4EVM A;  4PX1 A;  4MJC A;  1G7O A;  1EOG A;  4YKG A;  2B5E A;  4IJ3 A;  1YY7 A;  1TK0 B;  1K3O A;  4QMK A;  2LV3 A;  4O32 A;  2MMO A;  4FXY P;  3F63 A;  4AKI A;  4POK A;  4GQF A;  4GSN A;  5J41 A;  1YKA A;  1X0R A;  1F3A A;  1I1I P;  3GA4 A;  3APS A;  1MD3 A;  2R0C A;  4MCU A;  3KMO A;  3GN3 A;  1I9D A;  1ERW A;  4JZQ A;  3IE3 A;  1PFO A;  1Z7R A;  4EL1 A;  4IQA A;  1F6M C;  4F0C A;  2IME A;  4AGS A;  3N9J A;  1GSF A;  4X43 A;  2DLX A;  2VM1 A;  5DCH A;  4GWR A;  3FR6 A;  4F03 A;  3GX8 A;  1MD4 A;  2C0G A;  2FA4 A;  2GZY A;  1DSB A;  1S3C A;  2K9F A;  4KSM A;  1W4V A;  3IA1 A;  2VCW A;  1U3A A;  4NXI A;  2HSM A;  5ECQ B;  5E4W A;  5B8A A;  3F4R A;  5ELG A;  3MYD A;  4IGJ A;  4K7O A;  5GST A;  1T7P B;  1DBY A;  1GLQ A;  2IMD A;  2LJR A;  3QPM A;  2AUV A;  3IPZ A;  3M3M A;  2H6Y A;  4RQX A;  5EL8 A;  4EDY A;  5D93 A;  2FGX A;  1FVK A;  4HU7 A;  1BYE A;  4AKH A;  4IHU A;  2VCV A;  3LQ7 A;  4TKY A;  3UMA A;  3TJG A;  4LL1 B;  2A2R A;  3KH9 A;  3P2A A;  3ZL5 A;  4TR0 A;  5CP1 A;  1YEW C;  2B1K A;  4YQV A;  1K3Y A;  3TOU A;  2OBI A;  3WT2 A;  4EXJ A;  1UA5 A;  3R2Q A;  4RUV A;  1EP7 A;  3EIN A;  3G9B A;  1NM3 A;  4WBR D;  3ZIT A;  5BRT A;  2GGT A;  4IVF A;  1TXU A;  3KJY A;  4LL4 B;  5DAL B;  1SJI A;  4TR3 A;  2WRT A;  2QC7 A;  2YV7 A;  1YEX A;  4HQZ A;  1ABA A;  1OYJ A;  1SVL A;  4L5O A;  4QQ7 A;  4MLY A;  4MAB A;  5D9T A;  4MH2 A;  5ID2 B;  2DJK A;  8GSS A;  4V2L A;  3EYT A;  3DEX A;  4XS1 A;  1FO5 A;  3W8S A;  1GSE A;  1VF3 A;  3GMF A;  3NZN A;  3LSZ A;  1K0N A;  2B7J A;  1EGR A;  3ZRE A;  3RPN A;  1OE7 A;  4AKG A;  3WGD A;  3FZ4 A;  4AJ7 A;  2QSI A;  10GS A;  1A0F A;  1YJ6 A;  3ME8 A;  1NHO A;  6GSW A;  4YAP A;  3M9J A;  3F4S A;  2IPA A;  1WPI A;  4HZ2 A;  2PWJ A;  4TOP A;  1ML6 A;  2YV9 A;  4JBB A;  3ERW A;  4BVY A;  2IL3 A;  1DE1 A;  4J56 E;  4ZB8 A;  3DRN A;  1EP8 A;  2YWM A;  1XWA A;  1XBS A;  1T4Y A;  1XVQ A;  4AJ8 A;  4AJ6 A;  1HD2 A;  2A2P A;  1F9M A;  4GTU A;  5A5K A;  4KSO A;  2YWO A;  4PUF C;  2HFD A;  4KAE A;  1O8W A;  4QL9 A;  2P31 A;  2FWE A;  1GUL A;  2PPT A;  3LGC A;  2FCH A;  2V32 A;  2P0G A;  1FW1 A;  2O3E A;  2E7P A;  2R37 A;  4MK3 A;  4X4J A;  4NHZ A;  4KGI A;  4KDX A;  1S3D A;  4V2M A;  5ID2 A;  3ZZX A;  3LG6 A;  1Z6M A;  3WD6 A;  2R5G A;  3EMP A;  3QDN A;  2C3Q A;  5ECP B;  1MDI A;  4G2E A;  3FZA A;  5JCW A;  3VWU A;  5C04 A;  3ZML A;  6GSS A;  2LRC A;  2V6O A;  4G9H A;  2YZH A;  2GST A;  3ZTL A;  2OKA A;  3M9K A;  3GX0 A;  4N0Z A;  2WCI A;  1YF1 A;  2O89 A;  1FHE A;  13GS A;  3VK9 A;  1G0T A;  3HVX A;  9GSS A;  3A5W A;  3IXR A;  3ZRD A;  2MBS A;  3GTU B;  2OE3 A;  2C3N A;  3PIN A;  2H75 A;  4ZB9 A;  2NTO A;  1BQ7 A;  2XBI A;  4ZB7 A;  4X0X A;  2VD0 A;  1ZOF A;  4ICY A;  4USS A;  1OKT A;  2F3M A;  1V58 A;  4PUA A;  3SBC A;  4AF2 A;  3FRC A;  4F9Z A;  2HE3 A;  3HDC A;  3DD3 A;  2DJ2 A;  2KP2 A;  4KDY A;  1LBK A;  4ML1 A;  1K0C A;  4OCE A;  2WW3 A;  3QOU A;  3Q18 A;  3GV1 A;  1A24 A;  5JWQ B;  4NV5 A;  1ST9 A;  3ZYW A;  1SVO A;  3ZLP A;  4E68 A;  2L6C A;  3KTL A;  3LFL A;  2L6D A;  2AV4 A;  4WBJ A;  1YZX A;  4ECJ A;  3LEF A;  3HKR A;  3GH9 A;  5F05 A;  5IMV A;  1R7H A;  2RUE A;  1H75 A;  3LW9 A;  3FK8 A;  1BG1 A;  1AXD A;  4G19 A;  1A2J A;  2IMK A;  1PSQ A;  4IP6 A;  2GDR A;  3H8Q A;  2F51 A;  1GSD A;  2HSY A;  1FOV A;  2VLU A;  3GKK A;  4MF5 A;  4IN0 A;  4PXO A;  1XWK A;  1TRS A;  1ZMA A;  4L0U A;  3UBK A;  1GNE A;  3GH6 A;  2H1G A;  3F9U A;  4GLT A;  5DVB A;  1PMT A;  1GNW A;  3IK7 A;  2JAC A;  5DJL A;  1YKC A;  1TTZ A;  3UVH A;  5G1L A;  2H8L A;  3IC8 A;  5JWR B;  1ACV A;  3GTU A;  3F8U A;  3MIX A;  3TKR A;  1GLP A;  3D5J A;  2HQT A;  1Y1U A;  1EWX A;  3KCM A;  3KP8 A;  4KE3 A;  4WEY A;  4K0G A;  2DBC A;  4MH3 A;  4LA1 A;  4Q5N A;  1A0R P;  20GS A;  1UN2 A;  1JZW A;  4EO3 A;  1UVZ A;  5DCG A;  6GST A;  1KBN A;  4TR4 A;  3FW2 A;  3DVW A;  3ISO A;  1Q98 A;  2L5O A;  5IMF A;  4PQI A;  4CDO A;  2JSY A;  1ZCP A;  3KH7 A;  4ZXG A;  1XCC A;  5IPH A;  4PNF A;  4XRA A;  3TJK A;  5ECM B;  3FR9 A;  2C8U A;  1T8E B;  3TJF A;  5ELA A;  2L4C A;  2R4V A;  2XC2 A;  1O7U A;  2TRX A;  3RBT A;  3F3R A;  4HUA A;  5CRW A;  4V1A p;  2YOI A;  3VI7 A;  3V1W A;  2REM A;  1SKS B;  1PD2 1;  2R0P A;  3I6A A;  2V2G A;  1XWG A;  2LEG A;  3BBY A;  4HS1 A;  5J4Y A;  5HFK A;  2WVX B;  7GSS A;  1ZYP A;  3HYP A;  3IRA A;  1V40 A;  3ZMK A;  3EPT A;  3KEB A;  4YKF A;  22GS A;  3CXG A;  2N5F A;  3MDK A;  2VL2 C;  1C72 A;  3LXT A;  5CAX A;  4EDZ A;  2L5L A;  1O6J A;  3TRQ A;  1B8X A;  4DSS B;  4NMU A;  2VM2 A;  5D96 A;  5LD0 A;  4ILF A;  6GSV A;  1TJD A;  4WXT A;  3TJB A; 
#chains in the Genus database with same CATH homology
 1ZGN A;  4TR1 B;  3QFB C;  4HJM A;  3Q74 A;  3US3 A;  5DJM A;  4XIH A;  1AQV A;  1JZR A;  1FB6 A;  1THO A;  3J7Y k;  3L0H A;  3I9V 2;  2EC4 A;  4OCF A;  3E0U A;  1N8J A;  3U5R E;  4MJE A;  3FR3 A;  2ON5 A;  2RII A;  1XW5 A;  2PU9 C;  1O73 A;  2VCX A;  3MAK A;  2UZ8 A;  3VWX A;  2F8A A;  5IQY A;  4CHS A;  2N5A A;  1YQ1 A;  4TN8 A;  4ZL7 A;  1ILO A;  3HJO A;  4L0W A;  1SD9 A;  3CBU A;  2CVD A;  1KEB A;  2CAQ A;  4TVE A;  4BA7 A;  5B6N A;  1XXU A;  2KHP A;  1PX6 A;  1WMJ A;  1GSY A;  1G7E A;  2VL9 A;  5CRE A;  1R5A A;  4I2U A;  2VL2 A;  3CRU A;  3G7Y A;  5D8I A;  3TUE A;  4HDE A;  1TKD B;  1SK1 A;  4MF7 A;  1A23 A;  3MSZ A;  1RQM A;  4MJA A;  1PRX A;  5G30 A;  3UIW A;  2R3X A;  2HZF A;  2RLI A;  4G10 A;  11GS A;  1M0U A;  5IMA A;  2C0D A;  4POB A;  2H66 A;  1EV9 A;  4ZBA A;  2JZR A;  4OO4 A;  3QAW A;  5KN2 A;  4TXV A;  2OAC A;  3TKP A;  1ERV A;  4NAX A;  1TW9 A;  3TKQ A;  2CQ9 A;  3KM6 A;  5AGY A;  1VF1 A;  5DQS A;  2JU5 A;  2MYG A;  1SVM A;  2YNX A;  4K6X A;  4DSS A;  3CTG A;  3GL3 A;  1AQX A;  1VGL A;  1EEM A;  1ZL9 A;  2CAI A;  4TR1 A;  2GQL A;  4I8B A;  3ERF A;  2GVP A;  3G7J A;  2FD3 A;  1AUC A;  5A5H B;  2VUP A;  4POL A;  1GSU A;  1HNA A;  3C1S A;  1R4W A;  1O81 A;  3M8N A;  2H0H A;  5AIV A;  2IFQ B;  1SKW B;  3HVV A;  4HQS A;  2NPB A;  2I81 A;  2E2M A;  1JLV A;  3FEU A;  4ZL9 A;  4ULX A;  5KEJ A;  4MDC A;  4KND A;  3DWV A;  3TRX A;  1PN9 A;  2HT9 A;  2B5X A;  4Q5F A;  4OD7 A;  2CV4 A;  3D4M A;  2HRF A;  4Q5Q A;  3L9V A;  3FYG A;  3UAP A;  2C4J A;  4IKH A;  2CX4 A;  2CVK A;  2OBK A;  4PGT A;  2LTK A;  2LS5 A;  2VCT A;  2J9H A;  3DYR A;  1OC3 A;  2YJH A;  5KOW A;  4Z7X A;  1X9S B;  1A8Y A;  4EUY A;  5G2Z A;  2D2Z A;  3JCM L;  2FWG A;  4FIW A;  3RPP A;  1WJK A;  3GRX A;  5F8B A;  5ECS A;  14GS A;  1GWC A;  3FHK A;  1PKZ A;  2ZCT A;  2WS2 A;  3ZFB A;  4KCE A;  4RI6 A;  4GSS A;  4ISD A;  4F2I A;  4MZC A;  5B6M A;  3IAS 2;  4G0I A;  3HD5 A;  3UL3 A;  3GST A;  2WJU A;  2GS3 A;  5ABR A;  1NHY A;  3ZFL A;  2H1B A;  2K6V A;  1XOB A;  2IWT A;  1SL2 B;  5FWG A;  4JU5 A;  3CMI A;  3P7X A;  1TU8 A;  4NV2 A;  5LCZ A;  5J40 A;  2V41 A;  2PN8 A;  5A5H A;  5CNW A;  4RQR A;  3O76 A;  1M7T A;  5KN1 A;  1U3I A;  1QGV A;  1TRV A;  3DVX A;  2WDU A;  1LU4 A;  1SYX A;  1TI3 A;  1XIY A;  2TRC P;  2IFQ A;  5DBQ A;  2I1U A;  4JR4 A;  2CA8 A;  1DE2 A;  4TW5 A;  3EU3 A;  3TKS A;  4HZ4 A;  3GKX A;  2C3T A;  1PL2 A;  3R3E A;  2H73 A;  4PNG A;  3BCK A;  1YEP A;  3VPQ A;  3FY7 A;  4I5Q A;  3F3Q A;  5ENU A;  5DAL A;  5ECL B;  2NBS A;  4K5S A;  4ZIJ A;  1HNC A;  1MEK A;  4J57 E;  4K2D A;  4DSR A;  3N5O A;  2RUF A;  2XBQ A;  3VPT A;  1R26 A;  1AQW A;  4GXZ A;  3W8J A;  4G0K A;  1USB A;  5IMZ A;  16GS A;  3C73 A;  4EE0 A;  2QA2 A;  2H76 A;  1LJR A;  2OJL A;  2BTO T;  5IMC A;  1Z9H A;  4JE1 A;  3DGQ A;  1XOA A;  3RHC A;  2O87 A;  3HVS A;  3IHQ A;  4DSQ A;  2VD1 A;  1SL1 B;  3D21 A;  4IQ1 A;  2X49 A;  3OR5 A;  2LST A;  2OT3 A;  1U6T A;  5ECI B;  2YN1 A;  4MZW A;  4O5U A;  4LMW A;  2H30 A;  4PTS A;  1HNB A;  4YAV A;  5HFI A;  4CY8 A;  5J9B A;  4POM A;  4TXO B;  5JWO B;  4OMV A;  3PPU A;  3KIJ A;  1CQG A;  2FHE A;  3O3T A;  1SJZ A;  2LJA A;  2K18 A;  5IOX A;  5A1N B;  3EVI A;  4KX4 A;  4WET A;  5IOW A;  4BPY A;  1TP9 A;  3HMJ G;  1AC1 A;  3L9U A;  1YVL A;  5D9W A;  4HEA 2;  5EVO A;  3D0Z A;  3WT1 A;  2CX3 A;  3A2V A;  4BVX B;  2I3Y A;  2G2Q A;  2EFD A;  2JL4 A;  5J4V A;  1XPV A;  2YWI A;  2YAN A;  5H5R A;  3LJR A;  1Z6N A;  1B9Y C;  1JFU A;  1AW9 A;  5CO3 A;  2NVL A;  3TDG A;  1RW1 A;  4PUR A;  2B5Y A;  2LUS A;  4K1F A;  2VCQ A;  1B4P A;  3A3T A;  2OE0 A;  1TXX A;  4PQ1 A;  4HI7 A;  4W66 A;  5IMD A;  1BG5 A;  1OVN A;  4MA9 A;  5BMU B;  1JHB A;  2F8F A;  4EC0 A;  1TK8 B;  4V2N A;  3HCZ A;  4P3Y B;  5GSS A;  4FYB A;  3GFK A;  5F0G A;  3C7M A;  2O8V B;  5J9C A;  5HFG A;  2EIR A;  1QXH A;  4NPB A;  4WR4 A;  2DKI A;  2GZP A;  3PGT A;  4IJI A;  3HXS A;  4KF9 A;  2YP6 A;  3GIX A;  5JCG A;  4KUN A;  1GRX A;  4ZBD A;  2H0G A;  2GSR A;  4OO5 A;  1EV4 A;  3TRP A;  3H4K A;  2H72 A;  2DIZ A;  2LRT A;  2PGT A;  4TXO A;  1GTB A;  2PVQ A;  4IP1 A;  1E6B A;  2TIR A;  2O85 A;  1I5G A;  5A1N A;  3CYN A;  1WIK A;  4MPF A;  5AIX A;  3DKS A;  4KCA A;  4KB3 A;  4F0B A;  3C1R A;  4DEJ A;  5ECO B;  5LNK e;  3FMW A;  3KP9 A;  1AAZ A;  2GLR A;  4GCI A;  2DKH A;  5CRG A;  3VWW A;  4G01 A;  4BVX A;  3AY8 A;  1EOH A;  2GSQ A;  4E8E A;  4HOJ A;  2H71 A;  4I97 A;  2OE1 A;  2YJ7 A;  4O92 A;  4D73 B;  3GKN A;  3ZIJ A;  5F06 A;  1M2A A;  4J2F A;  1QMV A;  5G5F A;  4N30 A;  1ERU A;  1JLW A;  1UC7 A;  2EFC A;  2R0G A;  3TCO A;  3NIV A;  2HYX A;  3QMX A;  2JZS A;  4GQC A;  2ZNM A;  3FKF A;  4V1A g;  1K3L A;  5J3R A;  4L5L A;  5HR2 A;  3IK9 A;  5J5N A;  5C00 A;  3O6T A;  4K7I A;  2K8V A;  5BMU A;  3A5I A;  2KOK A;  5G5E A;  2XPD A;  4K0N A;  2F9S A;  2DJJ A;  3LXZ A;  4LLR A;  3ZVJ A;  2XHF A;  2GSS A;  4TRX A;  3RDW A;  5DQY A;  2PMT A;  2H1A A;  3MNG A;  2L59 A;  3GL5 A;  2VL3 A;  1XWC A;  1VRS D;  2I4A A;  4JED A;  2MMZ A;  1TK5 B;  2VAF A;  5HQP A;  2OA7 A;  3GSS A;  5IO0 A;  4K2X A;  2LRN A;  5GAN D;  3QCP A;  4GDF A;  4EIP A;  5DDL A;  3F6D A;  2X64 A;  2YWN A;  4FYC A;  2WB9 A;  4ID0 A;  3UJ1 A;  3VI5 A;  5IIZ A;  1TOF A;  1W89 A;  3BOA A;  1KNG A;  4OFN A;  5AN1 A;  2A4H A;  4XHM A;  5D9X A;  4CW9 A;  2H01 A;  1THX A;  1H4O A;  4MPG A;  1MDJ A;  4Z2U A;  1V98 A;  2MMN A;  4KH7 A;  2YZU A;  1GUM A;  4JR6 A;  5J47 A;  3LOR A;  2KP1 A;  3TKS E;  1F2E A;  5GZZ B;  2Z9S A;  2QKE A;  4ML6 A;  4D73 A;  5A4W A;  3FZ5 A;  3A2X A;  1TDI A;  4OFM A;  2B7K A;  2IIY A;  5CYY A;  3KZQ A;  3H93 A;  3HJP A;  1SKR B;  1OC9 B;  3F0I A;  2FA8 A;  3E9J B;  1Y25 A;  2YCD A;  3ZIV A;  5ECH B;  5KN0 A;  3GYK A;  4K9Z A;  4HU9 A;  2B1L A;  4G0L A;  4CY6 A;  2C0E A;  5B7C A;  1OAZ A;  2DJ1 A;  4MNN A;  2L4Q A;  19GS A;  4N10 A;  2VCZ A;  4XS6 A;  2R6K A;  3UEM A;  4FH8 A;  1O85 A;  1GL8 A;  5A4V A;  1PL1 A;  2M80 A;  1T3B A;  1WWJ A;  1N25 A;  3KXO A;  3UOM A;  4YQM A;  2V1M A;  4GST A;  2DML A;  2DC5 A;  4ECB A;  4NHW A;  2HI7 A;  4ZIL A;  2IMF A;  3IR4 A;  3VUR A;  2PBJ A;  5INY A;  3BCI A;  2N5B A;  1WRY A;  1EGO A;  1X5D A;  4KW6 A;  3J7Y b;  2AYT A;  4AI6 A;  4N0V A;  4GF0 A;  3DXB A;  4WF4 A;  3DIE A;  1GUK A;  2MZC A;  2FUG 2;  5E59 A;  3VLN A;  18GS A;  1FVJ A;  3IBH A;  2KLX A;  1V57 A;  2FWH A;  2DJ3 A;  2VLT A;  3D4T A;  4ZBB A;  5A4U A;  5F07 A;  5B8B A;  3APO A;  3CWG A;  4A5P A;  1GTU A;  4K7N A;  4BVY B;  2QGV A;  2J23 A;  2C80 A;  1ON4 A;  3EC3 A;  2HZE B;  4FO5 A;  1K0B A;  2JAD A;  1WP0 A;  3NOF A;  4MF6 A;  4EKZ A;  2H74 A;  1OC9 A;  2AAW A;  3IAM 2;  5EY6 A;  3M1G A;  5GAP D;  1K0D A;  3GUS A;  3WYW A;  1S3A A;  1SL0 B;  1BF5 A;  1XWB A;  3TKS C;  2IJY A;  3KTB A;  3HY2 A;  4XCS A;  1E2Y A;  1XZO A;  1QQ2 A;  3GHA A;  5G31 A;  1SK2 A;  1VF4 A;  4ZB6 A;  1A2L A;  5CRD A;  4FQU A;  4YQU A;  5KN3 A;  3ERG A;  1O8X A;  3EE2 A;  3EMX A;  4IBP A;  3IC4 A;  2R2J A;  1PKW A;  2H0I A;  1YDK A;  1T00 A;  3CRT A;  1OE8 A;  2X8H A;  5FT3 A;  3I69 A;  2M72 A;  2C0F A;  3GUR A;  4XTS A;  1X9M B;  1CQH A;  3C8E A;  5IPG A;  3C71 A;  1EZK A;  2WZ9 A;  3VWV A;  3TU3 B;  3HJM A;  3MWH A;  5HR1 A;  1ZYN A;  1F37 A;  1J9B A;  3UBL A;  1U87 A;  2YPM A;  2E0Q A;  5EPF A;  2ON7 A;  3KGK A;  4YH2 A;  2QA1 A;  5ECN B;  1BX9 A;  2GQK A;  2CZ2 A;  4WKW A;  3IV4 A;  2MMA A;  2PVO C;  2GZZ A;  2A4V A;  4H86 A;  2FY6 A;  2WUL A;  3IDV A;  1FB0 A;  3CTF A;  1HQO A;  1X5C A;  1M99 A;  3QFA C;  5AIS A;  2C1Y A;  1V2A A;  2HZE A;  2LQO A;  3QAG A;  3Q6O A;  2LNT A;  2RM5 A;  3WGE A;  3FZ9 A;  4FYU A;  2LJK A;  3ED3 A;  1QUW A;  1B4Q A;  3F4T A;  4O5R A;  1TRU A;  5DAK B;  2WGR A;  5A34 B;  2AHE A;  1VF2 A;  3QD9 A;  3H79 A;  2EFE A;  1XW6 A;  1SEN A;  4MZB A;  3EUR A;  4DVC A;  2GTU A;  4L8E A;  1KTE A;  3HZ4 A;  3CSH A;  1DUG A;  4KA0 A;  2EIQ A;  2ES7 A;  2DJ0 A;  1OC8 A;  2JSZ A;  1PA3 A;  3PR8 A;  1QFN A;  1XFL A;  2UV8 G;  3IHG A;  3TB2 A;  2RM6 A;  2LQQ A;  4QL7 A;  2WFC A;  2HXK A;  4ECC A;  4ZL8 A;  2HNL A;  5IO2 A;  2P5R A;  2H19 A;  2HSN B;  4IEL A;  1TI1 A;  1PQN A;  3CSJ A;  4RI7 A;  3CSI A;  1AIU A;  2FWF A;  3Q19 A;  1ZZY A;  2L57 A;  4PQH A;  4OFT A;  3LYK A;  3P90 A;  3UAR A;  3IOS A;  1SU9 A;  3BJ5 A;  3I43 A;  3K8N A;  2CT6 A;  2ZUP A;  3KD0 A;  2CVB A;  5HR0 A;  2EFH A;  2LNS A;  5CRH A;  2KUC A;  2EIO A;  3A2W A;  4XS4 B;  2K8S A;  3EU4 A;  2HLS A;  3HZ8 A;  2B3S A;  4AKX B;  2VKZ G;  1MDK A;  2M46 A;  6GSX A;  1HYU A;  5L71 A;  1R5P A;  3W6G A;  4BL7 B;  17GS A;  4I2T A;  1V9W A;  2DIY A;  1Z7P A;  4ECI A;  1B48 A;  1XVW A;  1URM A;  1B9X C;  3ZVJ D;  4IS0 A;  1GSQ A;  5ECR B;  3D22 A;  1WE0 A;  2GT6 A;  1PN0 A;  2G0F A;  2I9H A;  5D9V A;  5COH A;  2IN3 A;  2AJQ B;  5DAK A;  4MMM A;  2H6X A;  5A34 A;  1YF0 A;  1G6Y A;  1K0M A;  3QAV A;  3HA9 A;  1SJ6 A;  1BAY A;  1SK0 A;  3RHB A;  3WGX A;  1RK4 A;  3ME7 A;  1FOH A;  1QK8 A;  2FNO A;  1MTC A;  3M0F A;  4JRR A;  2HRK B;  1ZYE A;  2BJX A;  5FHI A;  3L9S A;  2VLV A;  4OWY A;  3U6V A;  2HSN A;  4XRD A;  1M2D A;  1IYI A;  4F82 A;  4Z2R A;  3LYP A;  1U88 A;  2VIM A;  2X8G A;  5ECK B;  4LMV A;  2P5Q A;  1M2B A;  3TGZ A;  1T1V A;  3L4N A;  1Y6E A;  4XS4 A;  3G7I A;  5H5Q A;  3TOT A;  2PUK C;  2ALB A;  1JZD A;  1GTA A;  2V6K A;  6GSU A;  4EF0 A;  2H1D A;  5D73 A;  2BMX A;  3EWL A;  3LWA A;  4HJ2 A;  1NSW A;  5G1K A;  3P8W A;  4BL7 A;  2H1L A;  3TJJ A;  2PER A;  3HHV A;  4GRF A;  2H6Z A;  1M9A A;  4MJB A;  3APQ A;  2GT5 A;  4E8H A;  3DML A;  3QR6 A;  2XPE A;  3KMN A;  4N3Z A;  5HR3 A;  4K8M A;  1FG4 A;  4O7H A;  2JZT A;  12GS A;  3GKM A;  1SD8 A;  1A8L A;  2HRN A;  4X1U A;  5H5S A;  1NW2 A;  1K0O A;  4Q5R A;  2IMI A;  3BD2 A;  3GNJ A;  2HSH A;  1ERT A;  4MP4 A;  2H70 A;  1IYH A;  2AB6 A;  1BED A;  2MBT A;  5J4U A;  1FAA A;  4Z2T A;  4BWQ A;  2O7K A;  3S9F A;  1T4Z A;  1X5E A;  4WF5 A;  2X8C A;  2X4A A;  1F3B A;  1K0A A;  3L78 A;  1G6W A;  5KOX A;  3RAZ A;  3D6I A;  1GTI A;  2E2G A;  1J0F A;  2O5V A;  1EEJ A;  2HRK A;  3H1N A;  1GSS A;  1GP1 A;  3UVT A;  2LKU A;  1PGT A;  1ZYQ B;  2VO4 A;  3E3E A;  5JCU A;  1X9W B;  1GUH A;  1XW9 A;  1SYR A;  2X99 A;  4WR5 A;  1TU7 A;  6GSY A;  1JZO A;  2NDO A;  1OKD A;  4NWY A;  3F6F A;  5IM9 A;  1Q4J A;  1A2M A;  4ACS A;  4N11 A;  2HSM B;  4O5Q A;  1Z5Y E;  4I6X A;  2GQM A;  2B6M A;  2OAD A;  2A2S A;  3PH9 A;  4IW9 A;  4EIQ A;  4KDU A;  3SWL A;  3VFI A;  1PX7 A;  1GH2 A;  2FLS A;  4K5R A;  2VOC A;  1M9B A;  1N2A A;  2HRA A;  2DMM A;  2DSA A;  1BJX A;  1TRW A;  2CZ3 A;  4BWS A;  1Z3E A;  1J08 A;  1WOU A;  4EVM A;  4PX1 A;  4MJC A;  1G7O A;  1EOG A;  4YKG A;  2B5E A;  4IJ3 A;  1YY7 A;  1TK0 B;  1K3O A;  4QMK A;  2LV3 A;  4O32 A;  2MMO A;  3F63 A;  4AKI A;  4POK A;  4GQF A;  4GSN A;  5J41 A;  1YKA A;  1X0R A;  1F3A A;  3GA4 A;  3APS A;  1MD3 A;  2R0C A;  4MCU A;  3KMO A;  3GN3 A;  1I9D A;  1ERW A;  4JZQ A;  3IE3 A;  1Z7R A;  4EL1 A;  4IQA A;  1F6M C;  4F0C A;  2IME A;  4AGS A;  3N9J A;  1GSF A;  4X43 A;  2DLX A;  2VM1 A;  5DCH A;  4GWR A;  3FR6 A;  4F03 A;  3GX8 A;  1MD4 A;  2C0G A;  2FA4 A;  2GZY A;  1DSB A;  1S3C A;  2K9F A;  4KSM A;  1W4V A;  3IA1 A;  2VCW A;  1U3A A;  4NXI A;  2HSM A;  5ECQ B;  5E4W A;  5B8A A;  3F4R A;  5ELG A;  3MYD A;  4IGJ A;  4K7O A;  5GST A;  1T7P B;  1DBY A;  1GLQ A;  2IMD A;  2LJR A;  3QPM A;  2AUV A;  3IPZ A;  3M3M A;  2H6Y A;  4RQX A;  5EL8 A;  4EDY A;  5D93 A;  2FGX A;  1FVK A;  4HU7 A;  1BYE A;  4AKH A;  4IHU A;  2VCV A;  3LQ7 A;  4TKY A;  3UMA A;  3TJG A;  4LL1 B;  2A2R A;  3KH9 A;  3P2A A;  3ZL5 A;  4TR0 A;  5CP1 A;  2B1K A;  4YQV A;  1K3Y A;  3TOU A;  2OBI A;  3WT2 A;  4EXJ A;  1UA5 A;  3R2Q A;  4RUV A;  1EP7 A;  3EIN A;  3G9B A;  1NM3 A;  4WBR D;  3ZIT A;  5BRT A;  2GGT A;  4IVF A;  1TXU A;  3KJY A;  4LL4 B;  5DAL B;  1SJI A;  4TR3 A;  2WRT A;  2QC7 A;  2YV7 A;  1YEX A;  4HQZ A;  1ABA A;  1OYJ A;  1SVL A;  4L5O A;  4QQ7 A;  4MLY A;  4MAB A;  5D9T A;  4MH2 A;  5ID2 B;  2DJK A;  8GSS A;  4V2L A;  3EYT A;  3DEX A;  4XS1 A;  1FO5 A;  3W8S A;  1GSE A;  1VF3 A;  3GMF A;  3NZN A;  3LSZ A;  1K0N A;  2B7J A;  1EGR A;  3ZRE A;  3RPN A;  1OE7 A;  4AKG A;  3WGD A;  3FZ4 A;  4AJ7 A;  2QSI A;  10GS A;  1A0F A;  1YJ6 A;  3ME8 A;  1NHO A;  6GSW A;  4YAP A;  3M9J A;  3F4S A;  2IPA A;  1WPI A;  4HZ2 A;  2PWJ A;  4TOP A;  1ML6 A;  2YV9 A;  4JBB A;  3ERW A;  4BVY A;  2IL3 A;  1DE1 A;  4J56 E;  4ZB8 A;  3DRN A;  1EP8 A;  2YWM A;  1XWA A;  1XBS A;  1T4Y A;  1XVQ A;  4AJ8 A;  4AJ6 A;  1HD2 A;  2A2P A;  1F9M A;  4GTU A;  5A5K A;  4KSO A;  2YWO A;  4PUF C;  2HFD A;  4KAE A;  1O8W A;  4QL9 A;  2P31 A;  2FWE A;  1GUL A;  2PPT A;  3LGC A;  2FCH A;  2V32 A;  2P0G A;  1FW1 A;  2E7P A;  2R37 A;  4MK3 A;  4X4J A;  4NHZ A;  4KGI A;  4KDX A;  1S3D A;  4V2M A;  5ID2 A;  3ZZX A;  3LG6 A;  1Z6M A;  3WD6 A;  2R5G A;  3EMP A;  3QDN A;  2C3Q A;  5ECP B;  1MDI A;  4G2E A;  3FZA A;  5JCW A;  3VWU A;  5C04 A;  3ZML A;  6GSS A;  2LRC A;  2V6O A;  4G9H A;  2YZH A;  2GST A;  3ZTL A;  2OKA A;  3M9K A;  3GX0 A;  4N0Z A;  2WCI A;  1YF1 A;  2O89 A;  1FHE A;  13GS A;  3VK9 A;  1G0T A;  3HVX A;  9GSS A;  3A5W A;  3IXR A;  3ZRD A;  2MBS A;  3GTU B;  2OE3 A;  2C3N A;  3PIN A;  2H75 A;  4ZB9 A;  2NTO A;  1BQ7 A;  2XBI A;  4ZB7 A;  4X0X A;  2VD0 A;  1ZOF A;  4ICY A;  4USS A;  1OKT A;  2F3M A;  1V58 A;  4PUA A;  3SBC A;  4AF2 A;  3FRC A;  4F9Z A;  2HE3 A;  3HDC A;  3DD3 A;  2DJ2 A;  2KP2 A;  4KDY A;  1LBK A;  4ML1 A;  1K0C A;  4OCE A;  3QOU A;  3Q18 A;  3GV1 A;  1A24 A;  5JWQ B;  4NV5 A;  1ST9 A;  3ZYW A;  1SVO A;  3ZLP A;  4E68 A;  2L6C A;  3KTL A;  3LFL A;  2L6D A;  2AV4 A;  4WBJ A;  1YZX A;  4ECJ A;  3LEF A;  3HKR A;  3GH9 A;  5F05 A;  5IMV A;  1R7H A;  2RUE A;  1H75 A;  3LW9 A;  3FK8 A;  1BG1 A;  1AXD A;  4G19 A;  1A2J A;  2IMK A;  1PSQ A;  4IP6 A;  2GDR A;  3H8Q A;  2F51 A;  1GSD A;  2HSY A;  1FOV A;  2VLU A;  3GKK A;  4MF5 A;  4IN0 A;  4PXO A;  1XWK A;  1TRS A;  1ZMA A;  4L0U A;  3UBK A;  1GNE A;  3GH6 A;  2H1G A;  3F9U A;  4GLT A;  5DVB A;  1PMT A;  1GNW A;  3IK7 A;  2JAC A;  5DJL A;  1YKC A;  1TTZ A;  3UVH A;  5G1L A;  2H8L A;  3IC8 A;  5JWR B;  1ACV A;  3GTU A;  3F8U A;  3MIX A;  3TKR A;  1GLP A;  3D5J A;  2HQT A;  1Y1U A;  1EWX A;  3KCM A;  3KP8 A;  4KE3 A;  4WEY A;  4K0G A;  2DBC A;  4MH3 A;  4LA1 A;  4Q5N A;  1A0R P;  20GS A;  1UN2 A;  1JZW A;  4EO3 A;  1UVZ A;  5DCG A;  6GST A;  1KBN A;  4TR4 A;  3FW2 A;  3DVW A;  3ISO A;  1Q98 A;  2L5O A;  5IMF A;  4PQI A;  4CDO A;  2JSY A;  1ZCP A;  3KH7 A;  4ZXG A;  1XCC A;  5IPH A;  4PNF A;  4XRA A;  3TJK A;  5ECM B;  3FR9 A;  2C8U A;  1T8E B;  3TJF A;  5ELA A;  2L4C A;  2R4V A;  2XC2 A;  1O7U A;  2TRX A;  3RBT A;  3F3R A;  4HUA A;  5CRW A;  4V1A p;  2YOI A;  3VI7 A;  3V1W A;  2REM A;  1SKS B;  1PD2 1;  2R0P A;  3I6A A;  2V2G A;  1XWG A;  2LEG A;  3BBY A;  4HS1 A;  5J4Y A;  5HFK A;  7GSS A;  1ZYP A;  3HYP A;  3IRA A;  1V40 A;  3ZMK A;  3EPT A;  3KEB A;  4YKF A;  22GS A;  3CXG A;  2N5F A;  3MDK A;  2VL2 C;  1C72 A;  3LXT A;  5CAX A;  4EDZ A;  2L5L A;  1O6J A;  3TRQ A;  1B8X A;  4DSS B;  4NMU A;  2VM2 A;  5D96 A;  5LD0 A;  4ILF A;  6GSV A;  1TJD A;  4WXT A;  3TJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...