4EFBA

Crystal structure of dna ligase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of DNA ligase
rcsb
molecule keywords DNA ligase
molecule tags Ligase/ligase inhibitor
total genus 103
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4efbA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4efbA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4efbA02
4JI4B 5D1PA 4X65B 4K0KB 1N32B 3KYHC 4UCUA 2HIVA 3BA8A 1TA8A 1IBKB 1J5EB 1IBMB 2OWOA 4DV1B 1XMQB 1S68A 5D1OB 4DV7B 4OX9B 1N34B 2VUGA 1XNRB 5LMNB 4GKJB 4JI1B 3RTXA 5FPOA 1HNXB 4B3SB 4DV4B 3TY8A 1N33B 5FPRA 3QWUA 4JI0B 2CFMA 3BAAA 3T1HB 4NXNB 4EFEA 4DR5B 2UUCB 4JYAB 5IWAB 3PN1A 3GB8B 4E6NA 4GKKB 1I94B 1HR0B 2UXBB 1X9NA 4JI6B 4X64B 3TY9A 1CKNB 1ZAUA 2UUBB 4DV5B 1FVIA 3GJXB 4YY3B 4X66B 4X62B 4B3TB 4LF5B 4KHPB 3OTOB 4CC5A 4DV3B 4JI7B 3JSLA 4UCSA 1IBLB 3BA9A 1XDNA 3JSNA 4LFAB 2F4VB 3RR5A 4B3MB 4DR1B 5DISC 1TAEA 1A0IA 4LF4B 2E5LB 1XMOB 4DUYB 2UUAB 4LF8B 1VS0A 4LH6A 2Q2TA 4DR2B 1FJGB 2Q2UA 4AQYB 5LMUB 3L2PA 3BABA 4JI5B 4DRFA 4JI3B 4DR6B 3W5OA 1HNWB 4GLXA 4DV0B 2UXCB 4JI2B 4DUZB 1HNZB 4LH7A 4NXMB 4B3RB 4UCOA 4PZ6A 3S24A 4DR3B 4LFCB 5D1OA 3W1BA 3NBYB 1DGSA 1XK5A 4LF7B 4LF9B 4EEQA 1P8LA 4UCRA 3VNNA 3W1GA 3T1YB 2HHHB 4EQ5A 3SGIA 3UQ8A 4UCVA 4EFBA 4UCTA 3TY5A 1V9PA 2UXDB 4CC6A 4LF6B 2ZM6B 4YHHB 4PZ7A 2HVQA 1CKNA 1B04A 4DV2B 1N36B 4PZ8A 1XNQB 3NC0B 4DR7B 2UU9B 2HVRA 2HVSA 3NBZB 5BR8B 1CKOA 2VQEB 3GDEA 1CKMA 2HIXA 4JV5B 4JI8B 2VQFB 4LFBB 4DV6B 4TOIA 4DR4B 1P16A 4UFZA
chains in the Genus database with same CATH superfamily
1ENVA 3F8NA 3KYHC 4H44B 4J80A 3K04A 1IBMB 1VBHA 3BQ2A 1SQFA 1TUEB 3PR4A 1S97A 3T1YH 1AUXA 2ALZA 1PNLA 3RGBA 4K8ZA 4R8UA 3G67A 4RB1A 3EFFK 2CNVA 1W96A 1K3EA 3T1YO 4ED2A 5FNVB 3HKEB 2W9CA 1K1SA 2I80A 4G2KA 4DYLA 2UUCB 1E79G 3R9RA 3ZBHA 1VQMV 2XOKG 1BGWA 4J7ZA 1R3KC 3WG7C 2COGA 2VQEH 3FB5C 2GPSA 2R82A 2VQEO 4LNUA 1JX4A 1EM1A 1JDEA 5KAIZ 2XCPA 5DECA 2E74B 2ZINA 3H1KH 3SYQA 2XCAA 4ECSA 2WLKA 3QO7A 1AJPA 3V6KA 4CS3A 2FTKA 4ZOLA 5BMVB 1TWCA 3N43B 1PNKA 2VR1A 1WH2A 3MHHC 5LP6A 4IRDA 3CP1A 4E2LA 4DR1B 4JI0H 1BMFG 2H3OA 3K5NA 2V1DA 5IJ9A 1M6VA 1TWFA 5A2QN 4JI0O 3AYHB 4R8UB 4RNNA 1EN6A 1OCOB 4DR2B 1FJGB 1T36A 4QWCA 3BHPA 2QR4A 3DC6A 2W9CB 2LFSA 1S0MA 2P7TC 1S0NA 4QWAA 5JCOA 4DUZB 1OCCB 3BG5A 2Q9LA 3RGXA 1YXBA 4ZI7A 4FFBA 4ZHQA 4O7SA 4DR3H 2ILMA 1GK9A 3H3VH 3HO8A 1VF7A 3QQMA 4DR3O 1T5EA 2W8LA 2ZXWB 3RF2A 1MNGA 3T1YB 4FE2A 4O7TA 2B63A 4FLXA 4ZOLB 4Q8FA 1H2KA 2N05A 2LQTA 3IC7A 1VEWA 5LP6B 2DYSC 4RUCA 2PGGA 2XAJA 3SPCA 4MV3A 3TW6A 2UXCH 2VQEB 2Z02A 1Q90D 4OPAA 3OSNA 2UXCO 3WO1A 2R8GA 1URFA 3F7VC 3LSQA 2VQFH 1F7YA 2QKAA 2VQFO 1WPXA 2GTAA 2A0LA 5BPFA 3OHAA 4ZI7B 3FYIB 4G27B 4FFBB 4ZHQB 2RGVA 2P67A 1Q6IA 2LW7A 4DV1H 2LP7A 1KU9A 1XMQH 3FD9A 1UJWB 4EKWA 4QGPA 2PVPA 4JI0B 4DV1O 1XMQO 3T99A 1RM1C 2BE3A 4O4LF 1N33H 1AR5A 3QF7A 1ZX3A 2QKSA 4O3PA 1N33O 1SZXA 3OUFA 5BYBA 1QLEB 4O2AB 1FAFA 2OT5A 4YJ3F 3NGDA 4MA0A 4FGRA 1M4UA 4J9ZB 3EHBB 2HJFC 3MR6A 1OCZC 5DGAA 3W7TA 5KG1A 5KHIA 3M9NB 1XL4A 4O7RA 5B1AB 4I55F 4CKBA 5KFWA 4DV4H 3AG3C 3OE7G 4E4TA 3DAAA 3ZN0A 2GDSA 5IYCG 4DV4O 4QE7A 1V54C 1A9XA 5KFHA 2IA6A 4XZ3B 4U3JA 3BFRA 3C90A 4MTFA 2IM9A 3CRMA 2HEPA 3DTUB 2UXCB 3HKZE 1K4DC 3ZRWA 2HG5C 3UZBA 2JGDB 3RVYA 4QNHB 4BAYA 4U7OA 1NS1A 2JS3A 2PF4E 1Q86W 4MTOA 1VF6C 3CE2A 4C5BA 1QBZA 2EINB 1I7FA 1LNQA 3ZMSA 3N2GA 1TWAA 1K73W 1Q3EA 2Z3YA 3TQ1A 4UVAA 3HKDA 3UQ8A 3LUTB 4JPRA 2X5RA 4O84A 1CEZA 4J9YB 1RJPA 1LUWA 4F6RB 5LMUH 3OGIB 3CXCU 5LMUO 4K8XA 2HG8A 3NUAA 5BYAA 5I5VA 2IJIA 4UB6Z 3BQ0A 2DZDA 1XREA 2R7KA 2UXNA 5HNEA 3BJYA 3CC2V 5KFRA 4JI4B 4Q8EA 4CH4A 2HIVA 1MZBA 2BSKA 4LC1A 1WB7A 4J9SA 1F23A 3AG1B 3F5TA 3JD4A 1YTFB 3PW2A 2R7NA 3TXQA 2HHFA 2EX3A 1QLNA 3K08A 2ODMA 2W0FC 3SE7A 3RTXA 1Q6UA 4BW9A 4DV4B 5BWWA 2PBZA 2F66C 2EILC 3Q2OA 3RJ0A 2E2IA 3CCVV 3N2GB 3ABTA 2FKLA 1NI8A 3ABKC 4DQNA 3D36A 2IW5A 2KSDA 4I9QA 2XIGA 3Q8PB 2RDJA 4A93G 4EBDA 2FB9A 4DW0A 1HW7A 3ASNB 4FS1A 1TVKA 1RFYA 4QSHA 3ZX6A 3JRXA 4RNOA 5KG3A 4QPKA 4O4LA 4M0JA 2V59A 4B3TB 3VPCA 4RB3C 2G38A 5IYBG 3H01A 4FBUA 3JD2A 2FMLA 3CCLV 4QW8A 4O3QA 5LA6F 5L3DA 2JEJA 1TUBA 4YJ3A 2BSKB 5KFDA 1VQOV 1M56B 1TAEA 1E4GT 3X2QB 5KT2A 2N04A 3CRQA 2ADPA 4NXNH 1GM9A 4X8AA 4TQFA 2C00A 1H2GA 4NXNO 4PDRA 5LMUB 4FJCC 2X7RB 1PL4A 4GKKH 4XX0B 2ZJTA 3LDCA 2MK3A 1HNWB 4ZBMA 4I55A 4GKKO 4HBNA 3E22A 5B3SC 4F6EA 4JI3H 1YZBA 3GB7C 3JASB 4JI3O 4GX1A 3U55A 3PR5B 1AI7A 4JYCA 3K9SA 4EGQA 2AU0A 4O81A 2YEVA 3OAAG 2R6FA 3OMIB 3C3SA 1XK5A 4AHCA 4O4LB 4A3DG 1A0GA 5IDJA 4ED7A 3V4SA 1AI4A 2LJ2A 3KCYA 3E8BA 3V6HA 4TQRA 3SYAA 4YJ3B 2XUMA 2Y4UA 3O9OA 2PI5A 1N0NA 4OXSA 2UXDH 4DIMA 2BOCC 4CZZA 1ZHQA 3Q8QB 1RYSA 1Q6HA 2Y0SE 3ZHVA 2HVSA 3G6EV 3I4MG 2UXDO 1EKPA 5DQIA 1I2KA 3H1HH 5GONB 2YZNA 4J9RA 1HNZH 5E1AC 4I55B 2XHBA 1HNZO 3N6RA 1GLVA 4XYLB 1GO3E 3IGAC 1N32B 1GH6A 1TA8A 5IP7G 1S3JA 4LF9H 3ZHUA 1ROPA 5J2UB 5LHIA 4YAKB 2ZDHA 4LF9O 1JFFA 4D6TH 3MAQA 4RCNA 3GIIA 5FPOA 2HGXA 3M99B 3CJHA 2OTLV 1ZWIC 3E89A 3E86A 1W0KG 4WHXA 4NXNB 3T4ZA 3GTQA 2EIMC 3K5IA 1VBGA 3SPJA 2CZGA 1KUQA 3PN1A 2QTOA 4JTAB 3CQZA 3JD1A 5LBQA 4GKKB 1EUDB 4AYBE 2FB5A 3CHXA 2R7ZG 3L75H 3TXSA 3UCSC 1B3QA 3BCCH 3ZHRA 3GV8B 3CCQV 5CE8A 2OCCB 2EJ7A 4PA7A 1RP3B 3MHSC 1GTOA 2FLLA 1COWG 3EPGA 2W0XA 5KFPA 3B77A 3ETJA 1SQPH 5KHKA 1NVPD 5I5XA 2XC9A 4X1KA 4FK5C 5C8YF 4O3RA 4J9QA 4E4EA 4FM1A 4TV8F 1K92A 2NR5A 4H13B 1M90W 4YIPA 3KAKA 1HWYA 2DABA 3HT5A 2KG7A 1JKJB 4TV9B 1OCRC 4NZNA 2E5LH 3AG2B 3T5KA 2ABJA 2R8JA 2E5LO 4JI6H 1ZL8A 5LA6A 4X64H 1YDXA 5KHJA 3U11A 4JI6O 4X64O 1BQ0A 1HNZB 1BCCH 5LGNA 4L87A 1BQZA 2VS0A 4X62H 1VIBA 4U3FH 1S10A 3RV3A 3VPDA 1YVWA 1FXHA 4X62O 3JAWA 2V4QA 4JZGA 3W7UA 4I0XA 1ET0A 4A3MG 1G1XB 1QQCA 4WFFA 4LF9B 3WU2Z 5CB4F 2BCCH 4R7CA 4MVZA 1THZA 2NLJC 5DEDA 1E4FT 1S5LZ 2QTSA 3SJAC 2EBOA 4U6PA 5LHGA 1GYFA 3BY6A 2WWWA 4UCVA 3U0ZA 4X1KB 2HHHH 4X89A 1EYZA 2ZDIC 2HHHO 1JVMA 4DV2B 1Q5OA 4HYOA 1SQXH 4YHHH 4ECYA 3RT3C 1CKMA 3JATA 4C5AA 1D5AA 2Q5ZA 4X20B 4YHHO 2ODTX 1PNMA 1OCOC 5B5EZ 1PKXA 2AW9A 3JCZA 2DAAA 3U9TA 1ZL8B 5LA6B 1MZFA 4B08A 5IYCO 1P16A 3ZMZA 1FS0G 4J9LA 3R23A 1N0JA 3LDDA 1IOVA 4WFBV 2GTSA 3HB9A 2OWOA 3CMEV 5FD6A 5LYJF 1ZUQA 2K1EA 2QA4V 2VUGA 4DW1A 3CB2A 3SNOA 3JAWB 5FPRA 1F4MA 5KFNA 1K83A 4JI1H 3BAAA 1XHZA 3FMAA 2WAQA 2ZXWC 3E5NA 4JI1O 4O3SA 3T5HA 3ETGA 5EC2C 4O4IF 4JI6B 4QE9A 4X64B 5BY1A 4L8JA 3KHGA 3L71H 2X6AA 2PMZE 1K33A 2Q0AA 1KBLA 4NB5A 5KFBA 2O03A 1UNNC 5I5UA 3CXHF 5K2MA 4X65H 4K0KH 3JATB 2Z04A 3ASOC 4X62B 3RIZA 1VQ6V 5GTHZ 1SCUB 3I4NG 4X65O 4K0KO 3TIGA 3OD4A 3ZRVA 1DV2A 2ZGIA 5KT4A 3K0DA 4UCSA 3G4SV 3G6VA 1AUVA 1HDJA 1K1QA 5LGTA 1AP6A 4KXRA 2DOSA 1VQNV 2YU9A 4JAVA 1P4RA 4F4WA 1XEQA 3RBZA 3ZJZA 3M4IA 1KKCA 1JJ2U 1XQ8A 5FD5A 2V4DA 3HXLA 3E8FA 1RSOA 3AG7A 4CHIA 2AXTZ 3CRCA 1KC7A 2YSUB 3B8NA 5C8YA 3THOA 4RZRA 4J0MA 2B1GA 3VA7A 4TV8A 3APOA 4L1KA 2VQDA 5C5JA 2W6OA 1YHQV 2DJVA 4IYHA 3FDSA 2EJ3A 1ZHSA 4GYCB 5LL6b 1ULZA 3T1CA 3VQWA 1Z2PX 3G6YA 1SFOA 5DG7A 1QNMA 3HPLC 3EVKA 4ED6A 4IAJA 1K7DA 3OTFA 2RF4A 2WE6A 4YQWA 4MW3A 5CA3A 4LR3A 4JI5H 1CKNA 2Y4RA 4BXXG 4J9NA 2VOBA 4A3FG 4PZ8A 1I1KA 5IYBO 4JI5O 5EOYA 2HVRA 5CB4A 1W59A 3SI8A 4HNAA 2A79B 3UO2A 4KUMA 4AI8A 1RSOB 1FXKA 1YF2A 2KB1A 4CKCA 1YITV 2W7OA 1Y1WG 2JA6G 3IJ4A 1VQLV 3CEIA 1S77D 4ECRA 1OWTA 4X65B 4K0KB 4K35A 4XDKA 2HFEC 2DIKA 4YR0A 1NBMG 3LDEA 4EBCA 4PA3A 1SC5B 5KFQA 1N34B 1S5HC 2R9AA 3SYPA 2Q6AA 2NN4A 2WLLA 5CBGA 5LXTF 1PM9A 4FM2A 3WB1A 3DC5A 1WN7A 3ZMVA 3RB6A 4NTWA 3KKYA 3RYFA 5KG6A 1K8AW 4UV8A 4JYAB 1EKFA 2UU9H 5LYJA 4A2BA 3CRAA 4ABMA 5EIBC 2UU9O 3KZIZ 4PDBA 1CKNB 4JTCB 2SCUB 3KHRA 1L0NH 1I94H 3R66A 2BTQB 5TISZ 3RVZA 4K3AA 3GJXB 1I94O 1Q43A 4A3LG 3ZHTA 2QKCA 1OV9A 1FXKB 2O57A 5FLMG 4XDLA 2IMWP 2DLNA 4YJ2B 3G80A 4O4IA 1WP7A 1VMGA 4F4YA 1PK8A 1IXMA 1KECA 1RPRA 4B3MB 2FL4A 3BPZA 1I7LA 4RO2A 1CQJB 4PBCA 4DR5H 1NU1H 4MV1A 4I7ZB 3OHBA 5DQHA 2ZR2A 1EZ1A 4DR5O 1UPGA 4JI5B 2HVJC 3B09A 3QO5A 4X88A 3WB2A 2VPQA 5I47A 3GTOA 3N2KB 3ABMC 4ED1A 2Y48A 1GN6A 2ASLA 5LYJB 4CKEA 3H40A 4UCOA 4A3GG 4I4TF 5BWTA 5IYDG 2Y69B 3HBLA 3ASNC 4DL7A 5B1BC 4UB8Z 4GZRB 1N8RW 2Z0AA 3A2FA 3PW7A 5JH7F 2YIBD 3T9FA 5C93A 5EWFA 4YIOA 3DGEA 5KFXA 4WF9V 1U97A 4UCTA 4WFGA 2JIZG 4BW5A 1M1KW 1YCIA 4HYKA 3MDSA 2BQUA 4DR6H 2PI4A 1M56C 4LF6H 4IHJF 5HFLA 2UU9B 5EYPA 1IOWA 1P49A 4DR6O 3UZOA 3NBZB 4JI2H 4LF6O 4LNUB 1JA8A 3S3XA 4B3RH 4N21A 4JI2O 3H4BA 3BEHA 2HDKA 4TOIA 1NR7A 3AK3A 4UFZA 4B3RO 4IRCA 2CGOA 2X6BA 2NU8B 2W9BA 1JLLB 2CTQA 4ECWA 1SERA 2R7ZA 2XCLA 5CM0A 1QR9A 2QYZA 2NU7B 4FVMA 3H20A 3VMMA 4J7JA 4FFLA 3R65A 2ZD9A 5IJ9B 3NXSA 2QK4A 3FAVA 3F5WC 4MW8A 1JMKC 2GSMB 4DR5B 3FYEB 1I1LA 1XNQH 1M57B 5BR8H 1H2NA 3JAKA 5KT6A 1XNQO 3P3PA 5LXTA 2ZCEA 5BR8O 2BTOA 1KKDA 1CXZB 4FLUA 1WPBA 1GM8A 2M05A 1HR0H 3H1LH 4TUYF 1R3JC 3AK1A 5EYPB 2WLIA 1G2WA 2OTJV 5C3EG 3OGCC 1QVGU 4O86A 1HR0O 2X0LA 4QWBA 4R50A 4Q20A 2QWRB 2KKWA 3L4JA 3ORRA 4Y8VB 2R93G 3GILA 4X66H 5KFEA 1IYEA 2X0SA 2A7WA 4WCEV 4ED3A 3CX5F 2W9BB 3E8HA 4X66O 1HNXH 4UUGA 2PYLA 3LP8A 1K34A 4WFHA 1A0IA 1HNXO 2QWOB 3T9AA 3Q4HA 2UXXA 4GLWA 5AG2A 3CC7V 2ZNJA 4DR6B 1SZTA 4D7TA 2Q69A 1I5XA 1IVSA 3ZHQA 1X59A 3F7YC 3JYCA 4FLYA 4JI2B 5LL6Y 2R8IA 5L3GA 2ZQMA 4B3RB 3JAKB 4PZ6A 4YY3H 4JGSA 4EYIB 4DR3B 3W1BA 5LXTB 2JA5G 4BWSC 4A3IG 2DQ3A 4YY3O 2W70A 2GQRA 2YXLA 2YDEA 2WLIB 1M0TA 4RUAA 2JEXA 3N6XA 1R73A 5KG7A 1DIKA 3ABLB 1JR9A 4Z1VA 2F4VH 2ZDGA 2XASA 3SGIA 5L3FA 3RYHA 2F4VO 4FFRA 1V9PA 4I4TA 5L3CA 5IYZF 4CH5A 4AQYH 2HVQA 3PW5A 3ZMUA 2JEIA 3Q4HB 1KTAA 5JH7A 4AQYO 1XNQB 3I12A 4WFAV 2C22A 2VA2A 1VP7A 5BR8B 4DL6A 2P5OA 5D8DA 3T9EA 1V4YA 2E2HA 4UVBA 2VQFB 2EZPA 2JEGA 4A5UB 5JJJB 2R9IA 2IBKA 1BHAA 1O9HA 5L1LA 4CBCA 5A9GA 4DV6H 4P30A 2JS5A 2WLHA 3B8MA 3BVOA 4IHJA 1Y1VG 4DV6O 2EIJC 4DV1B 1XMQB 4LP8A 1NH2D 1GKFA 3SJQC 2DE0X 2LFRA 5CAEB 1HNXB 4PHZA 2A06H 1N33B 4G3IA 3N41B 2FPPB 4TSFG 4RB2C 1SQQH 4GCZA 2R85A 3QG5A 2CUGA 2CNUA 4U3JB 1XL6A 1V55B 4MV7A 3GWOA 4I4TB 3H0GG 2YUAA 2JGUA 2HLDG 1MA1A 4JV1A 4O7LA 3ZRWB 2WLNA 1DTOA 1EHIA 4MV6A 2IBZH 4DR4H 2X6CA 4DLKA 1S9FA 2IP4A 4YY3B 4DR4O 2WTFA 3WWJA 2RDIA 4CC5A 2Y0IA 2VUMG 1R6KA 3E83A 4YR3A 4OX9H 4P2ZA 3N40P 1M5IA 3T5LA 4MVUA 4Q4DA 3STLC 5ITZA 4JI7H 4OX9O 2AQ4A 1QU7A 3HKDB 3KG2A 2F4VB 4IHJB 1SS3A 4MVMA 4PA6A 4TUYA 3KCXA 4JI7O 4BR6A 2I87A 1KEEA 4J9KA 1Z5WA 3TK1A 5CR5A 3T1HH 4IR1A 1VQ9V 5J2TF 4MVQA 4BIUA 2FP4B 3DF7A 2WPDG 2WB1E 3T1HO 4AQYB 2MW2B 4BBRG 3OFNG 1A3GA 3WG7B 5EIBD 1KQSU 3RB0A 1VKZA 4ICGA 4QWDA 2GHYA 1WLEA 3HOWG 3LWBA 4X1IA 4PJ0Z 2YW2A 3FKIG 5KX5F 3BRCA 5HBRB 2DN9A 3SYCA 5KT7A 2H94A 5IY5C 2ZNIA 1SRYA 4ZIBA 2NUAB 3OUSA 5T14A 4G28B 4W4LA 4IR9A 2P6JA 1Y1WA 2YS7A 2ZIOA 2JA6A 5FR9A 3JCUZ 5KG0A 2HHFB 1J95A 2I8CA 2OH2A 3GTLA 4EQ5A 1YTFD 1W0JG 4ECTA 3C3TA 2ZT9B 2YWVA 4I7HA 5ITZB 5KMGA 4XYMB 4BBSG 2WLMA 4PZ7A 3KHLA 4ME6A 2W57A 1SQBH 4TUYB 3TCUA 3R5FA 4QIWF 3AW8A 1TVKB 4DR7H 3RN4A 5D5PA 4DR4B 4DR7O 5IYZA 4X1IB 4UCUA 2AGAA 3BA8A 1S68A 2CK3G 1BL8A 4OX9B 3ETQA 4PDMA 2YCHA 4ED0A 4A3CG 1TUBB 4QPJA 3K5OA 3D3IA 4FLTA 2DW4A 5LMNH 3MFIA 5I5WA 2DYSB 3QZ7A 3T1HB 1WP8A 1XILA 5LMNO 5IYDO 3GV5B 1EN4A 5FL7G 5KMGB 1GSHA 4IWYA 3V6JA 4LBEC 3P30A 2CTRA 3RYCA 3E22B 3E8GA 2XGPA 2ZE7A 2DWDC 1EBOA 1M9NA 3GTMA 4LF7H 4NLGA 4EYHB 1UFIA 4LF7O 2YEVB 2V58A 3JZFA 3DSQA 3H1IH 3N42B 4C2MA 4O7ZA 2QE7G 1WR2A 1H2LA 3JSLA 1NVPB 1MSDA 4XDJA 1XDNA 2HGWA 1F51A 3MWMA 4J7KA 2NNUA 1RM1B 1K97A 2A1HA 2Z5UA 1AI5A 3QVNA 1JQ0A 2CGNA 4PA9A 4PWQA 2MCTA 5KG4A 3PZPA 4JI3B 4FZ0A 5BZBA 5B1OA 1VF6A 1KJ9A 2UUBH 2AZ0A 1KJ8A 4MV4A 1I6UA 1SKVA 4RQFA 5H80A 2HP8A 4MSWC 2UUBO 2V5AA 3T9BA 1OHHG 5KFSA 5J2TA 4DL3A 3RYCB 1OCZB 4LF5H 1S03G 4CH6A 2R92G 3A0BZ 4LF5O 1Q82W 3OM3B 3CCRV 3HKCA 2PZSA 5KFUA 1GRJA 1WRVA 3L9DA 2IH3C 3AG3B 1JFFB 1JX9A 2Q67A 3VNNA 5KX5A 3QFFA 2C2EA 3CJHB 5BWXA 3CPWU 1JIHA 2UUAH 1QCEA 3S3WA 1V54B 2UXDB 2L35A 2UUAO 3L73H 2CDYA 3OEHG 1P7BA 1VQ4V 3L4KA 3G6XA 2ZR3A 1M0WA 2HIXA 3ICXA 3JZ6A 2LW1A 2W8KA 2P0AA 4LF7B 4JV5H 2W71A 4IRKA 2YL2A 1HP8A 1AVMA 3HKBA 4MVRA 5CA1F 2W9AA 3VQXA 4JTDB 4M9UA 2QJ1A 1K9MW 2FJZA 4QIWA 4DO2A 3JRWA 2IJKA 4U7NA 2P22C 2Y69C 4HNVA 5C44G 2W7PA 1FD9A 3HKCB 2R93A 3APQA 4GKJH 5KFAA 3P32A 2WA4A 5B66Z 3DTGA 2KG7B 1GGOA 4FFKA 4GKJO 4FFMA 4J11A 3MR5A 2R86A 5KAFZ 1N36H 4X9QA 1R6NA 4KL1A 4PA4A 1N36O 1Y67A 4Q43A 4QW9A 1DF4A 1GN3A 2NU9B 1Q8IA 3TY9A 1WB8A 4NTXA 4LFBH 2UUBB 3WO0A 5I5TA 1ZTEA 1OCCC 4LFBO 3GTPA 5FNVF 2GUZA 3RFCA 4LF5B 2ZE5A 3IAYA 3AK2A 2DPJA 2YZMA 1B06A 2RJZA 4I0XB 2WDTA 2DQ0A 5KFCA 3GVMA 3ZRSA 4BY7G 2ADQB 5JJEB 2JA5A 3HKBB 4B3SH 2EILB 2VPSA 4EG0A 2ARHA 5L1KA 2J6TA 4B3SO 4DK0A 2E5LB 2XT9A 2UUAB 4LFAH 1NQTA 3WB0A 5KHGA 1VS0A 2PYJA 4LFAO 5LP6C 4APMA 4OGQB 1I08A 3IG0A 5BMVF 1DV1A 1DLBA 4NVPA 4MV8A 1RYRA 3UO3A 2FLPA 4YP3A 4ASUG 1FFXA 3TQTA 2DWCA 2R84A 4WD3A 4CH3A 3CVZA 1IZ3A 4X1YA 3W7XA 1KMIZ 1VF5B 5JCOC 2EULA 2HR3A 2GUZB 1TWHA 5KFGA 3M9OB 1P8LA 3K59A 2ASDA 4UCRA 2HHHB 1P7GA 1XMOH 3BACA 4DUYH 1Y1VA 4TQDA 3DTFA 1WA8A 4O4HF 3WFVA 4IIJF 1XMOO 4DUYO 4YHHB 3MD0A 1ZLZA 1JOYA 1G4YB 3ZEDA 3TJTA 5BXZA 5EZYF 1N36B 4H33A 4RB0A 1MMMA 5F9LA 4A3EG 1KJIA 2QDOA 3GDEA 3VQYA 4FS2A 5KHHA 1FFTB 1QLEC 3LQSA 4LFBB 3GWKC 2W6MA 1NR1A 2VA3A 2R72A 4HZ3A 3RUPA 3H0GA 1DF5A 2OIEA 2DPIA 2LGQA 2HGSA 4UUJC 2ZKOA 5H5NA 3KREA 3RFRA 3UT5A 1CE8A 4RUFA 4X1YB 1FPOA 3JAMW 1Y66A 2EJRA 3OEEG 1KT8A 1IURA 2Q7DA 3UM7A 3J81W 1IBMH 5B1AC 2JJ1G 4JI1B 1SA0A 2BQ3A 4B3SB 2V9WA 3JARA 5D5QA 1IBMO 1S0VA 4RAIA 2VUMA 3FB7C 4IT5A 2F23A 2R70A 4CMDA 2P90A 1AR4A 1KP2A 3NR7A 4EFEA 3K57A 5CA1A 1N4CA 1KJJA 1WA8B 3GB8B 3FFQA 5C8YB 1Y76A 1AP5A 5IT9W 3P3NA 4TV8B 5DLGA 2YIAA 2VRZA 1V51A 1E1QG 2YIBA 4GC7A 3T54A 4FU0A 5EWEA 3FKIA 1L0LH 3I56V 5KLVH 2V7QG 2EINC 3J7AK 4LSAA 2WYOA 4K6NA 2AZ2A 4FLZA 3UT5B 1BZKA 1I5YA 2R7LA 4O2AF 1C3OA 4EEYA 4MAMA 3VQVA 1XMOB 4DUYB 5FNVA 4JF3A 2K9PA 3HKEA 2W6QA 5IP9G 1AI6A 1SA0B 2E76B 3JARB 5EBMC 2Q2UA 4FBTA 3BABA 4TVIA 4NZMA 4JZ2A 5KS8A 1MZEA 5CB4B 4DR2H 2FLNA 2XAHA 4HNAB 3RB4A 5KFFA 4IL6Z 5CA1B 4FFOA 4DV5H 4IZOA 4DR2O 4ED8A 2UVUA 3QZ8A 1NT2B 4LH7A 4J9OA 1GN2A 1SETA 4DV5O 1Y76B 4DUZH 3T7AA 4ECVA 4HAMA 2AGQA 1I1MA 2V4RA 1PPJH 4XBFA 2QB5A 4DUZO 5KFTA 3GIDA 5BMVA 2EJ0A 1KB9F 1E1RG 1EFRG 2PTMA 3AG1C 2ZDIA 1BNCA 1X4TA 1S72V 3ZMTA 3BQ1A 2WLLB 2QEXV 4LMYA 1JCHA 2GBOA 1KJQA 4W4KA 5C4XG 4EFBA 2ITDC 4JAUA 3I5DA 4O3OA 3K3WA 4DAAA 3SPGA 1OCRB 2WAQE 3RYFB 2Q7GA 2PUSA 2IJJA 2CW7A 3G71V 1RJQA 1Y74A 4UVCA 4RAYA 5KFJA 3LNMB 2ZE8A 4J9PA 4FFPA 3AEIA 4I5SA 3SDLA 4A3JG 4YR2A 2XGQA 3HKZA 5DGIA 4FZ1A 5IE9A 4O4HA 3AG4B 4IIJA 5C1PA 4BY1G 3GTGA 5BPHA 1Z2GA 1Q81W 5LGUA 5EZYA 5KUKA 1ORQC 5EWGA 4O4IB 5KFZA 1VQPV 4R6ZA 2ATKC 2JJ2G 1GAXA 2AGPA 1XUQA 5BWUA 3ETDA 1KC8W 3SR2C 1IXBA 3QTCA 1OJHA 4FMTA 3B40A 2W6PA 3X2QC 3JD3A 4JXUA 2EIKB 3QNEA 4JYBA 1GO3F 1YIJV 3ML0A 2PN1A 1I94B 2IU3A 4CE5A 3QO8A 3ZHSA 2UVVA 3CMAV 5C1OA 4GT1A 1K4CC 1Y74B 4MTXA 4DV5B 5BWVA 3D36C 2KQXA 3M8AA 4NTYA 2YI9A 1LUVA 4BWAA 3KHHA 1XBLA 3GTKA 1MSWD 4O4HB 5KT5A 4IIJB 5KFLA 3A8TA 5E79Z 2E75B 3M7MX 2YICA 5EZYB 2R92A 3RR5A 4O4JF 2COIA 4WBNF 2AGOA 3DXRA 1ZETA 4JV2A 3TEKA 4LCUC 5CN0A 4F4LA 5CBHA 1UC9A 4DRFA 3T9DA 3N8DA 1XI1A 4YAJB 1BXRA 2IJHA 1OZ0A 3GIQA 4O2AA 2FMAA 1SESA 3SYOA 1O9GA 2Q4PA 3E2EA 2WB1A 4LWSA 4MT8A 5GW7A 2YXYA 1L1FA 2RDCA 3ASOB 3K79A 2P06A 2C2RA 3ETEA 3CCUV 3JD0A 3OTOH 3B4SA 3ORQA 2RGRA 4GC6A 1FXVA 1B6QA 3OR6C 4QJFA 4A2AA 4J41A 3OTOO 5H2FZ 4FM0A 4O7YA 4BIOA 3I55V 3U9SA 1BE3H 3OMAB 5DM6V 1KYOF 1CPYA 3KTMA 4DL4A 4LF4H 1OBGA 1YSCA 2YZLA 1NTMH 3FAVB 4LF4O 1DK1A 4LF6B 5KFMA 2NVXA 4CS2A 5BWRA 5HV6A 2OCHA 3JAMN 1XHXA 3SJBC 3GIKA 3NC0B 3RW0A 3J81N 3HOZG 1Y6XA 4NYKA 3DXRB 1WCMG 2ETNA 4NXMH 2JGDA 5HFMA 2JVDA 1ZQ7A 4NXMO 3OUZA 2C2AA 2OCCC 2F95B 4LWSB 5L1JA 3C0FB 2M6YA 1JJOA 4FLWA 4BIZA 2JA8G 3GIPA 4JI4H 1NH2B 5K3WA 2C2DA 5IT9N 2E3CA 4JI4O 5GONF 3GIJA 2CTPA 4QJFB 1OBDA 1JDBB 3MR3A 5B1NA 1FYJA 4PI0A 2ITCC 4F6RA 1R1BA 3CCSV 4GUNA 2ZDQA 3KXYT 4FFNA 3V4ZA 5F2VO 2IU0A 3MWEA 5FJ8G 2FPGB 3AG2C 1YJNV 5JQWA 2WLJA 1HR0B 5J2UF 5JVLA 1WAZA 1X9NA 2Y0SA 2HJDA 3VOUA 3RYIA 3A0HZ 2J9GA 2W6JG 4RZQA 2YRWA 4EB6A 1E4EA 3H9VA 4DL5A 1FVIA 3RBDA 3G6BA 4MS2A 3OW2U 1H2MA 2DYRB 2F43G 5KA5A 5KFKA 1GMGA 1YJWV 4X66B 1PL0A 4TQSA 1IBKH 4YBZB 3OTOB 3HOYG 5F9NA 1H8HG 1RK6A 3K5HA 4FPPA 2ASJA 1IBKO 1GN4A 1F4NA 3BA9A 4B3TH 1XNRH 4GX5A 3FB8C 1RJRA 5LOVF 4IGGA 1N56A 4B3TO 1XNRO 1JPXA 1K5QA 3RYHB 4LF4B 2QGNA 3FX7A 2FYUH 4ECUA 4HNTA 3H1JH 2UVWA 3HOUG 4B7KA 3G8DA 2CQYA 4PV1B 5JH7B 5L3EA 4GLXA 4AYBA 2HVKC 1BJTA 2CE4A 4LSXA 1I0HA 1HNWH 4O4JA 1S76D 2RCVA 1WNSA 4UV9A 4NXMB 2KSWA 1PD3A 2QWQB 4WBNA 1HNWO 2NVYA 3GLKA 3RYIB 3D8CA 5DGHA 1NKDA 4D7SA 4PD4F 4EB6B 1E4EB 4TV9F 1AN7A 4DV3H 1DGSA 2A9HA 1IBLH 4DV3O 4TM5A 3TINA 5L3BA 1H38A 2QM7A 5KFOA 1IBLO 3B2EE 3SJCC 5I60A 4FM9A 1SQVH 3CYOA 4O7NA 4PI2A 4HR7A 2JDIG 2LGWA 2Q7HA 1B04A 3ZCCA 3MWDA 2HKOA 1QHTA 4TWKA 4DV0H 3ABMB 5E25A 1CKOA 4P9PA 4TT3G 3MJFA 1NTZH 4C7UA 4DV0O 2ZIMA 4DV6B 1I50A 1IYDA 3J80W 3JASA 3OUUA 2AHZA 2N74A 5DN6G 1B6RA 3D3QA 1CP9A 1R9TA 5B1BB 5D1PA 5KKNB 3HOVG 4O4JB 1MABG 3CWBH 4Q4CA 5H6RA 1IBKB 2QF7A 4FLVA 3RBEA 3LSSA 4WBNB 2JA7G 3IFXA 4I50F 3EYYA 1RK5A 3O65A 1N32H 3IN5A 3Q8SB 1XNRB 1S5JA 2NU6B 2R8HA 1N32O 5JQGF 4ECQA 1G8MA 3TY8A 3PVXA 3PJSK 3RWRD 1EZVH 2Y0PA 1TWGA 4ETSA 3R5XA 2GQSA 5FLXW 2QWNB 2XAQA 1M93A 2JRIA 2YS8A 4Q6GA 5H9CA 5LHHA 2OLSA 4MA5A 2D3OW 3W7SA 4ECXA 5EBLC 1DAAA 4E6NA 3T2MA 1L8DA 2M7WA 3HB3B 3OSPA 1W2BU 5GONA 4ECZA 3TW7A 4R7RA 2B9ZA 1EUCB 1Z2NX 3PW4A 5JUMA 2H8PC 4NZOA 2ZE6A 2R8KA 1MG1A 1K5SA 1AR1B 1XDCA 2P4KA 1A48A 3T4DA 3T9CA 2GPWA 1S0OA 2UVRA 3KALA 1R3IC 4DV3B 4JI7B 1Q7YW 1RPOA 4H37A 1IBLB 4DV7H 5EC1C 3ZIAG 5J2UA 4M7EA 1NZ6A 2J6SA 4A3BG 4DL2A 4PDVA 4DV7O 5KFYA 2JK5C 5JVDF 1M7JA 3L70H 4MTGA 3L74H 1EKVA 1VQ8V 2PY5A 4GX0A 2Y4TA 2YYAA 3TGUH 1JXLA 4DV0B 5LOVA 1W93A 4OPHA 5DQGA 2PMZA 5KA6A 5EBWC 2FK1A 4Z1MG 3CEBA 4AILC 5IYZB 5CMUA 4KHPH 1KP3A 1Z2OX 1AROP 1AILA 4U7CA 2BQRA 4O7VA 4DK1A 4KHPO 3CCJV 4UXNA 3IC9A 2JEUA 1ZSPA 3PW0A 1G6UA 5L9XA 4IYIA 4JASA 3N44B 4HQ6A 2A3QA 3Q1KA 4MV9A 2Q68A 3TY5A 2YI8A 2OYQA 1FKAH 4CC6A 3LMLA 1GSOA 2FK3A 4TV9A 1FKAO 3L72H 3U10A 5K1XA 2COJA 2YC0A 4DR7B 2F1MA 4DV2H 5H6QA 1VARA 3K06A 2QSAA 1C30A 3PFFA 4DV2O 1IX9A 1SF9A 1SQGA 1A32A 5LOVB 4CMFA 1WSCA 3HOXG 2JEFA 2B63G 1KD1W 1N48A 3GTJA 1KUTA 5CA0F 1FXKC 1I3QA 1BGYH 4N23A 3K9AA 1PV0A 5KG2A 4DV7B 2J6UA 5LMNB 1I7NA 2C35B 3G8CA 3PO3G 3QWUA 4R8CA 2EZOA 5DG8A 3MFHA 5GTIZ 2ZM6H 5I5SA 1KBHA 3UFXB 5L1IA 3K58A 2RQ6A 3CC4V 2ZM6O 3PO2G 4IWXA 4I50A 3A0RA 3JZIA 2XNDG 4NYEA 3H4DA 3ZS8C 2XD4A 1BS3A 1BT8A 4X20A 3T5JA 2Q73A 5JQGA 1XOUA 1ZAUA 4O2BF 4O7WA 1YJ9V 4RU9A 4JV5O 4KP4A 2FK2A 4EBEA 5J2TB 3RV4A 3UYYA 1J5EH 4KHPB 1NTKH 4PELA 2EIJB 2R87A 3FKSG 1J5EO 4O3NA 3AG4C 3K03A 1L2ZA 4F4XA 3EXAA 4EGJA 3JSNA 2F93B 1BHBA 3SPHA 5KX5B 3GV7B 5DAAA 1VQ7V 5DISC 2YS6A 1EN5A 4MVOA 2FKXA 2W6IG 2Q2TA 5IWAH 5DLFA 4F50A 2VWJA 3LULA 1Z5VA 2UXBH 5IWAO 3OT7A 4YJ2F 1SEIA 5KG5A 4QWEA 3U0GA 2EIKC 2UXBO 3GIMA 1NJIW 3UKMA 4I50B 5JVDA 2DMXA 1P84F 2QM4A 2Q8VA 3ABUA 5D1OA 5EDWA 4ZQIA 5JQGB 5A2QW 1R6TA 1WCMA 4RNMA 4DRXA 1PX2A 3OMNB 2Q7EA 1U96A 2D2CB 5K1PA 5DG9A 4MTEA 3ABKB 4GX2A 2IH1C 2WAMA 2XAFA 1US6A 3W7WA 3J80N 3CCMV 2EJ2A 4LF8H 4JV0A 2ZM6B 4LF8O 4YB8B 3ZRXA 2W6NA 1R3LC 3GQCA 5CBFA 2AHYA 2CKZB 1Y4MA 2GV9A 3VOTA 1PP9H 3OR7C 2QWPB 1M57C 1SYXB 2BOBC 2CNQA 3CCEV 4JV5B 2B1IA 2WA3A 3TIIA 1YEWA 4MTDA 2CH7A 3STZC 1VQ5V 3AX6A 4LFCH 2P4VA 2XTAA 5IY5B 3CSWA 5FLXN 4RQEA 4LFCO 4J9MA 3JALA 5JVDB 4JUZA 1J5EB 2RMKB 3RGZA 1GSAA 3RAXA 2CAZC 2C28A 5D1OB 1BSMA 4I9WA 4Q0YA 3K3VA 2Q0OC 1B6SA 2EIYA 1YI2V 4GKJB 1I2LA 4Q45A 1Y14B 2XAGA 4DRXB 1T94A 3ETHA 1N34H 2B5UA 1EZJA 3K0GA 3TETA 2CFMA 4A3KG 3ZN1A 2VWKA 2YXHA 1N34O 5B3SB 4FIPC 2W6ZA 5CA0A 1CS0A 5J9PC 5IWAB 3K5MA 2GLTA 1IDSA 4ZOLF 3Q8RB 2UXBB 3KAJA 3J7AU 1O75A 4JYAH 4MVSA 5KUMA 3CD6V 1FFXB 5I5YA 4JYYA 4JI8H 5LP6F 1TGOA 4C5CA 3E35A 5KFVA 1AJNA 4JYAO 2ATLA 3U54A 4JI8O 1QVFU 2RN9A 1AJQA 1WJZA 3K3PA 2L6LA 3WNZA 4NKGB 3LSUA 4NR1A 2CH7B 2FPIB 2BR0A 3CS5A 3SPIA 2YRXA 3JALB 4WFEA 4LFAB 2R9RB 5IJ0A 2YZGA 4O2BA 3ABLC 3EPIA 2QM8A 4KFMA 1VQKV 1VAJA 5KT3A 4LF8B 3CSXA 2FE3A 2UUCH 4LH6A 4B3MH 4ZKIA 3VBBA 2YIDA 5JJNB 4ZI7F 4ZHQF 3L2PA 3MR2A 2UUCO 4B3MO 1CQIB 3W5OA 1QR8A 3M9MB 2WSSG 4PDLA 5CA0B 3RB3A 2HJWA 4YXWG 2LO1A 3HR0A 2BTQA 1T3NA 3CRRA 4HNUA 3S24A 4HN2A 4LFCB 4RAZA 1D5NA 4O82A 3LNNA 3NBYB 2RNBA 4J10A 3K5LA 1H8EG 1LR1A 4H0LB 1D2DA 4YJ2A 2OIGA 4QIWE 2CTWA 4EEQA 2DYRC 2EIMB 4RUEA 3W1GA 4F4ZA 4B7EA 3N27A 1GM7A 5JWPA 2R7MA 4DR1H 2DWEC 5DMXA 2JA7A 3FB6C 4DR1O 3WWIA 3VPBA 5DGBA 5IJ0B 4Z2WA 1AB3A 4O2BB 1B33N 1FJGH 5EK0A 4P9OA 1MOFA 1FJGO 4Q44A 1V55C 3N2KA 3WWHA 1H2SB 3R5HA 4J42A 4DXWA 4JAAA 2CW8A 4RWUA 4CS4A 4JI8B 1UC8A 3RAQA 4O83A 5KFIA
chains in the Genus database with same CATH topology
4X1IB 3F8NA 3KYHC 4UCUA 2F95B 3BA8A 3C0FB 1IBMB 2OWOA 1JJOA 4FLWA 5FD6A 4JI4H 1S68A 1SQFA 4OX9B 3ETQA 2YCHA 2VUGA 2E3CA 3T1YH 3RGBA 4K8ZA 1TUBB 3CB2A 4RB1A 3JAWB 3K5OA 5FPRA 4FLTA 5LMNH 5FNVB 4PI0A 4JI1H 3HKEB 4F6RA 3KXYT 3BAAA 3T1HB 1XHZA 3FMAA 2UUCB 1BGWA 1HR0B 2VQEH 5KMGB 1X9NA 4JI6B 4X64B 3RYIA 3E22B 3RYCA 4L8JA 4RZQA 4LNUA 4EB6A 2Q0AA 1FVIA 2ZINA 4LF7H 2O03A 4X65H 4K0KH 3JATB 4X66B 4X62B 3RIZA 1IBKH 3DSQA 4CS3A 3OTOB 3N42B 4ZOLA 3JSLA 4UCSA 5BMVB 4B3TH 3BA9A 1XNRH 3N43B 1XDNA 1WH2A 5LP6A 3MWMA 4DR1B 3RYHB 4JI0H 4LF4B 3K5NA 5IJ9A 3M4IA 1XQ8A 5FD5A 2V4DA 4DR2B 1FJGB 3HXLA 2MCTA 3BHPA 1RSOA 4JI3B 5JH7B 4GLXA 5C8YA 3THOA 1BJTA 4J0MA 2UUBH 4LSXA 4TV8A 1HNWH 4O4JA 5JCOA 1SKVA 4DUZB 1I6UA 1WNSA 4NXMB 2KSWA 3RGXA 4WBNA 5J2TA 3RYIB 3RYCB 4LF5H 1S03G 4CH6A 4D7SA 4ZI7A 4FFBA 4EB6B 4ZHQA 1AN7A 4DV3H 1DGSA 1ZHSA 4DR3H 4GYCB 1IBLH 2PZSA 3HKCA 5LL6b 1VF7A 3VQWA 1Z2PX 1T5EA 3B2EE 3SJCC 1JFFB 3VNNA 3RF2A 3T1YB 5KX5A 4FM9A 4FLXA 4ZOLB 4PI2A 4IAJA 2UUAH 3OTFA 2WE6A 2UXDB 4LR3A 5LP6B 4JI5H 1CKNA 2Q7HA 1B04A 2VOBA 2PGGA 4PZ8A 3L4KA 1QHTA 5EOYA 4DV0H 2HVRA 5CB4A 2UXCH 4HNAA 1CKOA 2VQEB 1M0WA 2HIXA 2ZIMA 3ICXA 4DV6B 3J80W 3JASA 4LF7B 4JV5H 2VQFH 5D1PA 4X65B 4K0KB 4O4JB 3HKBA 1IBKB 4FLVA 4WBNB 3VQXA 3EYYA 1N32H 1N34B 2QJ1A 2R9AA 4ZI7B 1S5JA 1XNRB 4FFBB 2P22C 4ZHQB 2RGVA 4DV1H 1XMQH 1KU9A 4FM2A 3WB1A 3TY8A 3HKCB 1WN7A 3RWRD 4GKJH 4JI0B 4ETSA 5FLXW 3RYFA 4Q6GA 1M93A 1N33H 3QF7A 1N36H 4JYAB 2UU9H 5LYJA 4KL1A 4E6NA 4A2BA 1L8DA 5EIBC 5GONA 4O2AB 1Q8IA 3TY9A 1CKNB 4R7RA 4LFBH 4PDBA 1Z2NX 2UUBB 1I94H 2BTQB 3GJXB 1M4UA 1Q43A 4LF5B 3KALA 3IAYA 4DV3B 4JI7B 5KHIA 2RJZA 2WDTA 4YJ2B 1IBLB 4DV7H 5J2UA 4O4IA 4M7EA 5JJEB 3HKBB 4B3SH 4DV4H 2VPSA 4B3MB 4DK0A 2E5LB 3BPZA 2UUAB 4LFAH 3WB0A 4DR5H 5KHGA 1VS0A 2PYJA 5LP6C 4U3JA 2PY5A 4JI5B 4APMA 3WB2A 3IG0A 4NVPA 3N2KB 2IM9A 4DV0B 5LOVA 2HEPA 2UXCB 1FFXA 4CH3A 3CVZA 5LYJB 4X1YA 4UCOA 4AILC 5IYZB 4KHPH 1KMIZ 1Z2OX 5JCOC 4DK1A 3A2FA 1I7FA 2YIBD 3N2GA 1Q3EA 3K59A 1G6UA 1P8LA 4UCRA 3HKDA 2HHHB 3N44B 3UQ8A 1XMOH 4DUYH 4MV9A 4TQDA 4UCTA 3TY5A 2YI8A 2OYQA 1FKAH 4CC6A 4F6RB 3LMLA 4YHHB 4TV9A 5LMUH 3U10A 4DR6H 3ZEDA 5K1XA 1N36B 4LF6H 4K8XA 4DR7B 2UU9B 5EYPA 1P49A 4RB0A 3NBZB 4JI2H 3GDEA 3VQYA 2F1MA 4DV2H 5KHHA 4LNUB 4LFBB 4B3RH 2R72A 4TOIA 4UFZA 1SQGA 5LOVB 2HGSA 4JI4B 3RFRA 4CH4A 3UT5A 2HIVA 1MZBA 4X1YB 3JAMW 4DV7B 4FVMA 3J81W 3H20A 2EX3A 1IBMH 5LMNB 4JI1B 3RTXA 1SA0A 4B3SB 4BW9A 4DV4B 3JARA 5D5QA 2F66C 3QWUA 3RJ0A 3N2GB 5IJ9B 2ZM6H 2R70A 3K58A 2RQ6A 4EFEA 1JMKC 4DR5B 3K57A 5CA1A 1XNQH 4I9QA 2XIGA 4I50A 3GB8B 5BR8H 3JAKA 3ZS8C 1HW7A 3FFQA 5C8YB 5IT9W 5LXTA 4X20A 1TVKA 2ZCEA 5JQGA 2BTOA 1ZAUA 4TV8B 4FLUA 1WPBA 1HR0H 2YIAA 5EYPB 2YIBA 4O4LA 5J2TB 4B3TB 1J5EH 4KHPB 4RB3C 2KKWA 3L4JA 3J7AK 4LSAA 4X66H 2WYOA 1L2ZA 4FLZA 3UT5B 3JSNA 1TUBA 2F93B 1HNXH 4YJ3A 2PYLA 5KX5B 5DISC 1TAEA 3VQVA 1A0IA 1E4GT 1XMOB 4DUYB 5FNVA 4NXNH 3HKEA 4TQFA 1SA0B 2Q2TA 5IWAH 3JARB 2Q2UA 5LMUB 2VWJA 3BABA 2ZNJA 1Z5VA 4GKKH 2ZJTA 4DR6B 1HNWB 4D7TA 2UXBH 5CB4B 4I55A 4DR2H 1SEIA 4HBNA 4HNAB 3E22A 5CA1B 4FLYA 4JI2B 4JI3H 4DV5H 4I50B 5JVDA 1NT2B 4LH7A 3JASB 4B3RB 2QM4A 3JAKB 4PZ6A 4YY3H 4DR3B 5D1OA 3W1BA 5LXTB 4DUZH 4BWSC 5JQGB 5A2QW 2YXLA 4DRXA 2Q7EA 1XK5A 5BMVA 1M0TA 4AHCA 3N6XA 5K1PA 2PTMA 4O4LB 4MTEA 1X4TA 2F4VH 4LMYA 3SGIA 3RYHA 4EFBA 4LF8H 1V9PA 4I4TA 4CH5A 2ZM6B 4YJ3B 2Q7GA 2PUSA 3RYFB 4AQYH 2CW7A 2HVQA 2UXDH 4RAYA 5JH7A 1XNQB 1ZHQA 2GV9A 2HVSA 5BR8B 1SYXB 2P5OA 5GONB 4JV5B 1HNZH 2VQFB 1YEWA 4MTDA 4O4HA 5JJJB 4LFCH 4I55B 4IIJA 2XHBA 1O9HA 1N32B 4DV6H 3JALA 5JVDB 1TA8A 2JS5A 5EZYA 1J5EB 3RGZA 4IHJA 2CAZC 4LF9H 4DV1B 1XMQB 5D1OB 5J2UB 4Q0YA 4O4IB 3K3VA 4GKJB 1JFFA 3MAQA 5FPOA 4DRXB 1HNXB 4PHZA 3SR2C 3QTCA 1N33B 1N34H 2CFMA 3N41B 2VWKA 4RB2C 4NXNB 3QG5A 5CA0A 4U3JB 5IWAB 3PN1A 3K5MA 4GKKB 4MV7A 4I4TB 1I94B 2JGUA 2UXBB 3KAJA 1O75A 4JYAH 3CHXA 1FFXB 4JI8H 1TGOA 4DV5B 4DR4H 2YI9A 4BWAA 4YY3B 4CC5A 4O4HB 5KHKA 4IIJB 4OX9H 3N40P 4X1KA 1M5IA 3M7MX 3JALB 5ITZA 4LFAB 4JI7H 5IJ0A 3HKDB 4O2BA 5EZYB 4FM1A 2F4VB 4IHJB 3RR5A 4TUYA 3KAKA 4LF8B 1Z5WA 3T1HH 3CSXA 2FE3A 2UUCH 4LH6A 4B3MH 5JJNB 4TV9B 3DF7A 2E5LH 4AQYB 3L2PA 4DRFA 5EIBD 3W5OA 1XI1A 4JI6H 5LA6A 4X64H 4O2AA 4X1IA 5CA0B 5KHJA 3U11A 1O9GA 3BRCA 1HNZB 2BTQA 3S24A 4LFCB 4DR4B 4RAZA 4X62H 2ZNIA 4ZIBA 3OTOH 2RGRA 3LNNA 3NBYB 3K5LA 4A2AA 3JAWA 4FM0A 4YJ2A 2ZIOA 1QQCA 4LF9B 4EEQA 3W1GA 1E4FT 4DR1H 4EQ5A 3SJAC 4LF4H 1GYFA 4UCVA 3U0ZA 4I7HA 4X1KB 2HHHH 4LF6B 5ITZB 5KMGA 4PZ7A 5IJ0B 1FJGH 4O2BB 4CS2A 2W57A 4TUYB 1XHXA 3SJBC 4DV2B 1Q5OA 3NC0B 4YHHH 3N2KA 1H2SB 1CKMA 3JATA 1D5AA 4X20B 2CW8A 1TVKB 4CS4A 4DR7H 4NXMH 4JI8B 2JVDA 5D5PA 5LA6B 4B08A 1P16A 5IYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI4 B;  5D1P A;  4X65 B;  4K0K B;  1N32 B;  3KYH C;  4UCU A;  2HIV A;  3BA8 A;  1TA8 A;  1IBK B;  1J5E B;  1IBM B;  2OWO A;  4DV1 B;  1XMQ B;  1S68 A;  5D1O B;  4DV7 B;  4OX9 B;  1N34 B;  2VUG A;  1XNR B;  5LMN B;  4GKJ B;  4JI1 B;  3RTX A;  5FPO A;  1HNX B;  4B3S B;  4DV4 B;  3TY8 A;  1N33 B;  5FPR A;  3QWU A;  4JI0 B;  2CFM A;  3BAA A;  3T1H B;  4NXN B;  4EFE A;  4DR5 B;  2UUC B;  4JYA B;  5IWA B;  3PN1 A;  3GB8 B;  4E6N A;  4GKK B;  1I94 B;  1HR0 B;  2UXB B;  1X9N A;  4JI6 B;  4X64 B;  3TY9 A;  1CKN B;  1ZAU A;  2UUB B;  4DV5 B;  1FVI A;  3GJX B;  4YY3 B;  4X66 B;  4X62 B;  4B3T B;  4LF5 B;  4KHP B;  3OTO B;  4CC5 A;  4DV3 B;  4JI7 B;  3JSL A;  4UCS A;  1IBL B;  3BA9 A;  1XDN A;  3JSN A;  4LFA B;  2F4V B;  3RR5 A;  4B3M B;  4DR1 B;  5DIS C;  1TAE A;  1A0I A;  4LF4 B;  2E5L B;  1XMO B;  4DUY B;  2UUA B;  4LF8 B;  1VS0 A;  4LH6 A;  2Q2T A;  4DR2 B;  1FJG B;  2Q2U A;  4AQY B;  5LMU B;  3L2P A;  3BAB A;  4JI5 B;  4DRF A;  4JI3 B;  4DR6 B;  3W5O A;  1HNW B;  4GLX A;  4DV0 B;  2UXC B;  4JI2 B;  4DUZ B;  1HNZ B;  4LH7 A;  4NXM B;  4B3R B;  4UCO A;  4PZ6 A;  3S24 A;  4DR3 B;  4LFC B;  5D1O A;  3W1B A;  3NBY B;  1DGS A;  1XK5 A;  4LF7 B;  4LF9 B;  4EEQ A;  1P8L A;  4UCR A;  3VNN A;  3W1G A;  3T1Y B;  2HHH B;  4EQ5 A;  3SGI A;  3UQ8 A;  4UCV A;  4EFB A;  4UCT A;  3TY5 A;  1V9P A;  2UXD B;  4CC6 A;  4LF6 B;  2ZM6 B;  4YHH B;  4PZ7 A;  2HVQ A;  1CKN A;  1B04 A;  4DV2 B;  1N36 B;  4PZ8 A;  1XNQ B;  3NC0 B;  4DR7 B;  2UU9 B;  2HVR A;  2HVS A;  3NBZ B;  5BR8 B;  1CKO A;  2VQE B;  3GDE A;  1CKM A;  2HIX A;  4JV5 B;  4JI8 B;  2VQF B;  4LFB B;  4DV6 B;  4TOI A;  4DR4 B;  1P16 A;  4UFZ A; 
#chains in the Genus database with same CATH topology
 1ENV A;  3F8N A;  3KYH C;  4H44 B;  4J80 A;  3K04 A;  1IBM B;  1VBH A;  3BQ2 A;  1SQF A;  1TUE B;  3PR4 A;  1S97 A;  3T1Y H;  1AUX A;  2ALZ A;  1PNL A;  3RGB A;  4K8Z A;  4R8U A;  3G67 A;  4RB1 A;  3EFF K;  2CNV A;  1W96 A;  1K3E A;  3T1Y O;  4ED2 A;  5FNV B;  3HKE B;  2W9C A;  1K1S A;  2I80 A;  4G2K A;  4DYL A;  2UUC B;  1E79 G;  3R9R A;  3ZBH A;  1VQM V;  2XOK G;  1BGW A;  4J7Z A;  1R3K C;  3WG7 C;  2COG A;  2VQE H;  3FB5 C;  2GPS A;  2R82 A;  2VQE O;  4LNU A;  1JX4 A;  1EM1 A;  1JDE A;  5KAI Z;  2XCP A;  5DEC A;  2E74 B;  2ZIN A;  3H1K H;  3SYQ A;  2XCA A;  4ECS A;  2WLK A;  3QO7 A;  1AJP A;  3V6K A;  4CS3 A;  2FTK A;  4ZOL A;  5BMV B;  1TWC A;  3N43 B;  1PNK A;  2VR1 A;  1WH2 A;  3MHH C;  5LP6 A;  4IRD A;  3CP1 A;  4E2L A;  4DR1 B;  4JI0 H;  1BMF G;  2H3O A;  3K5N A;  2V1D A;  5IJ9 A;  1M6V A;  1TWF A;  5A2Q N;  4JI0 O;  3AYH B;  4R8U B;  4RNN A;  1EN6 A;  1OCO B;  4DR2 B;  1FJG B;  1T36 A;  4QWC A;  3BHP A;  2QR4 A;  3DC6 A;  2W9C B;  2LFS A;  1S0M A;  2P7T C;  1S0N A;  4QWA A;  5JCO A;  4DUZ B;  1OCC B;  3BG5 A;  2Q9L A;  3RGX A;  1YXB A;  4ZI7 A;  4FFB A;  4ZHQ A;  4O7S A;  4DR3 H;  2ILM A;  1GK9 A;  3H3V H;  3HO8 A;  1VF7 A;  3QQM A;  4DR3 O;  1T5E A;  2W8L A;  2ZXW B;  3RF2 A;  1MNG A;  3T1Y B;  4FE2 A;  4O7T A;  2B63 A;  4FLX A;  4ZOL B;  4Q8F A;  1H2K A;  2N05 A;  2LQT A;  3IC7 A;  1VEW A;  5LP6 B;  2DYS C;  4RUC A;  2PGG A;  2XAJ A;  3SPC A;  4MV3 A;  3TW6 A;  2UXC H;  2VQE B;  2Z02 A;  1Q90 D;  4OPA A;  3OSN A;  2UXC O;  3WO1 A;  2R8G A;  1URF A;  3F7V C;  3LSQ A;  2VQF H;  1F7Y A;  2QKA A;  2VQF O;  1WPX A;  2GTA A;  2A0L A;  5BPF A;  3OHA A;  4ZI7 B;  3FYI B;  4G27 B;  4FFB B;  4ZHQ B;  2RGV A;  2P67 A;  1Q6I A;  2LW7 A;  4DV1 H;  2LP7 A;  1KU9 A;  1XMQ H;  3FD9 A;  1UJW B;  4EKW A;  4QGP A;  2PVP A;  4JI0 B;  4DV1 O;  1XMQ O;  3T99 A;  1RM1 C;  2BE3 A;  4O4L F;  1N33 H;  1AR5 A;  3QF7 A;  1ZX3 A;  2QKS A;  4O3P A;  1N33 O;  1SZX A;  3OUF A;  5BYB A;  1QLE B;  4O2A B;  1FAF A;  2OT5 A;  4YJ3 F;  3NGD A;  4MA0 A;  4FGR A;  1M4U A;  4J9Z B;  3EHB B;  2HJF C;  3MR6 A;  1OCZ C;  5DGA A;  3W7T A;  5KG1 A;  5KHI A;  3M9N B;  1XL4 A;  4O7R A;  5B1A B;  4I55 F;  4CKB A;  5KFW A;  4DV4 H;  3AG3 C;  3OE7 G;  4E4T A;  3DAA A;  3ZN0 A;  2GDS A;  5IYC G;  4DV4 O;  4QE7 A;  1V54 C;  1A9X A;  5KFH A;  2IA6 A;  4XZ3 B;  4U3J A;  3BFR A;  3C90 A;  4MTF A;  2IM9 A;  3CRM A;  2HEP A;  3DTU B;  2UXC B;  3HKZ E;  1K4D C;  3ZRW A;  2HG5 C;  3UZB A;  2JGD B;  3RVY A;  4QNH B;  4BAY A;  4U7O A;  1NS1 A;  2JS3 A;  2PF4 E;  1Q86 W;  4MTO A;  1VF6 C;  3CE2 A;  4C5B A;  1QBZ A;  2EIN B;  1I7F A;  1LNQ A;  3ZMS A;  3N2G A;  1TWA A;  1K73 W;  1Q3E A;  2Z3Y A;  3TQ1 A;  4UVA A;  3HKD A;  3UQ8 A;  3LUT B;  4JPR A;  2X5R A;  4O84 A;  1CEZ A;  4J9Y B;  1RJP A;  1LUW A;  4F6R B;  5LMU H;  3OGI B;  3CXC U;  5LMU O;  4K8X A;  2HG8 A;  3NUA A;  5BYA A;  5I5V A;  2IJI A;  4UB6 Z;  3BQ0 A;  2DZD A;  1XRE A;  2R7K A;  2UXN A;  5HNE A;  3BJY A;  3CC2 V;  5KFR A;  4JI4 B;  4Q8E A;  4CH4 A;  2HIV A;  1MZB A;  2BSK A;  4LC1 A;  1WB7 A;  4J9S A;  1F23 A;  3AG1 B;  3F5T A;  3JD4 A;  1YTF B;  3PW2 A;  2R7N A;  3TXQ A;  2HHF A;  2EX3 A;  1QLN A;  3K08 A;  2ODM A;  2W0F C;  3SE7 A;  3RTX A;  1Q6U A;  4BW9 A;  4DV4 B;  5BWW A;  2PBZ A;  2F66 C;  2EIL C;  3Q2O A;  3RJ0 A;  2E2I A;  3CCV V;  3N2G B;  3ABT A;  2FKL A;  1NI8 A;  3ABK C;  4DQN A;  3D36 A;  2IW5 A;  2KSD A;  4I9Q A;  2XIG A;  3Q8P B;  2RDJ A;  4A93 G;  4EBD A;  2FB9 A;  4DW0 A;  1HW7 A;  3ASN B;  4FS1 A;  1TVK A;  1RFY A;  4QSH A;  3ZX6 A;  3JRX A;  4RNO A;  5KG3 A;  4QPK A;  4O4L A;  4M0J A;  2V59 A;  4B3T B;  3VPC A;  4RB3 C;  2G38 A;  5IYB G;  3H01 A;  4FBU A;  3JD2 A;  2FML A;  3CCL V;  4QW8 A;  4O3Q A;  5LA6 F;  5L3D A;  2JEJ A;  1TUB A;  4YJ3 A;  2BSK B;  5KFD A;  1VQO V;  1M56 B;  1TAE A;  1E4G T;  3X2Q B;  5KT2 A;  2N04 A;  3CRQ A;  2ADP A;  4NXN H;  1GM9 A;  4X8A A;  4TQF A;  2C00 A;  1H2G A;  4NXN O;  4PDR A;  5LMU B;  4FJC C;  2X7R B;  1PL4 A;  4GKK H;  4XX0 B;  2ZJT A;  3LDC A;  2MK3 A;  1HNW B;  4ZBM A;  4I55 A;  4GKK O;  4HBN A;  3E22 A;  5B3S C;  4F6E A;  4JI3 H;  1YZB A;  3GB7 C;  3JAS B;  4JI3 O;  4GX1 A;  3U55 A;  3PR5 B;  1AI7 A;  4JYC A;  3K9S A;  4EGQ A;  2AU0 A;  4O81 A;  2YEV A;  3OAA G;  2R6F A;  3OMI B;  3C3S A;  1XK5 A;  4AHC A;  4O4L B;  4A3D G;  1A0G A;  5IDJ A;  4ED7 A;  3V4S A;  1AI4 A;  2LJ2 A;  3KCY A;  3E8B A;  3V6H A;  4TQR A;  3SYA A;  4YJ3 B;  2XUM A;  2Y4U A;  3O9O A;  2PI5 A;  1N0N A;  4OXS A;  2UXD H;  4DIM A;  2BOC C;  4CZZ A;  1ZHQ A;  3Q8Q B;  1RYS A;  1Q6H A;  2Y0S E;  3ZHV A;  2HVS A;  3G6E V;  3I4M G;  2UXD O;  1EKP A;  5DQI A;  1I2K A;  3H1H H;  5GON B;  2YZN A;  4J9R A;  1HNZ H;  5E1A C;  4I55 B;  2XHB A;  1HNZ O;  3N6R A;  1GLV A;  4XYL B;  1GO3 E;  3IGA C;  1N32 B;  1GH6 A;  1TA8 A;  5IP7 G;  1S3J A;  4LF9 H;  3ZHU A;  1ROP A;  5J2U B;  5LHI A;  4YAK B;  2ZDH A;  4LF9 O;  1JFF A;  4D6T H;  3MAQ A;  4RCN A;  3GII A;  5FPO A;  2HGX A;  3M99 B;  3CJH A;  2OTL V;  1ZWI C;  3E89 A;  3E86 A;  1W0K G;  4WHX A;  4NXN B;  3T4Z A;  3GTQ A;  2EIM C;  3K5I A;  1VBG A;  3SPJ A;  2CZG A;  1KUQ A;  3PN1 A;  2QTO A;  4JTA B;  3CQZ A;  3JD1 A;  5LBQ A;  4GKK B;  1EUD B;  4AYB E;  2FB5 A;  3CHX A;  2R7Z G;  3L75 H;  3TXS A;  3UCS C;  1B3Q A;  3BCC H;  3ZHR A;  3GV8 B;  3CCQ V;  5CE8 A;  2OCC B;  2EJ7 A;  4PA7 A;  1RP3 B;  3MHS C;  1GTO A;  2FLL A;  1COW G;  3EPG A;  2W0X A;  5KFP A;  3B77 A;  3ETJ A;  1SQP H;  5KHK A;  1NVP D;  5I5X A;  2XC9 A;  4X1K A;  4FK5 C;  5C8Y F;  4O3R A;  4J9Q A;  4E4E A;  4FM1 A;  4TV8 F;  1K92 A;  2NR5 A;  4H13 B;  1M90 W;  4YIP A;  3KAK A;  1HWY A;  2DAB A;  3HT5 A;  2KG7 A;  1JKJ B;  4TV9 B;  1OCR C;  4NZN A;  2E5L H;  3AG2 B;  3T5K A;  2ABJ A;  2R8J A;  2E5L O;  4JI6 H;  1ZL8 A;  5LA6 A;  4X64 H;  1YDX A;  5KHJ A;  3U11 A;  4JI6 O;  4X64 O;  1BQ0 A;  1HNZ B;  1BCC H;  5LGN A;  4L87 A;  1BQZ A;  2VS0 A;  4X62 H;  1VIB A;  4U3F H;  1S10 A;  3RV3 A;  3VPD A;  1YVW A;  1FXH A;  4X62 O;  3JAW A;  2V4Q A;  4JZG A;  3W7U A;  4I0X A;  1ET0 A;  4A3M G;  1G1X B;  1QQC A;  4WFF A;  4LF9 B;  3WU2 Z;  5CB4 F;  2BCC H;  4R7C A;  4MVZ A;  1THZ A;  2NLJ C;  5DED A;  1E4F T;  1S5L Z;  2QTS A;  3SJA C;  2EBO A;  4U6P A;  5LHG A;  1GYF A;  3BY6 A;  2WWW A;  4UCV A;  3U0Z A;  4X1K B;  2HHH H;  4X89 A;  1EYZ A;  2ZDI C;  2HHH O;  1JVM A;  4DV2 B;  1Q5O A;  4HYO A;  1SQX H;  4YHH H;  4ECY A;  3RT3 C;  1CKM A;  3JAT A;  4C5A A;  1D5A A;  2Q5Z A;  4X20 B;  4YHH O;  2ODT X;  1PNM A;  1OCO C;  5B5E Z;  1PKX A;  2AW9 A;  3JCZ A;  2DAA A;  3U9T A;  1ZL8 B;  5LA6 B;  1MZF A;  4B08 A;  5IYC O;  1P16 A;  3ZMZ A;  1FS0 G;  4J9L A;  3R23 A;  1N0J A;  3LDD A;  1IOV A;  4WFB V;  2GTS A;  3HB9 A;  2OWO A;  3CME V;  5FD6 A;  5LYJ F;  1ZUQ A;  2K1E A;  2QA4 V;  2VUG A;  4DW1 A;  3CB2 A;  3SNO A;  3JAW B;  5FPR A;  1F4M A;  5KFN A;  1K83 A;  4JI1 H;  3BAA A;  1XHZ A;  3FMA A;  2WAQ A;  2ZXW C;  3E5N A;  4JI1 O;  4O3S A;  3T5H A;  3ETG A;  5EC2 C;  4O4I F;  4JI6 B;  4QE9 A;  4X64 B;  5BY1 A;  4L8J A;  3KHG A;  3L71 H;  2X6A A;  2PMZ E;  1K33 A;  2Q0A A;  1KBL A;  4NB5 A;  5KFB A;  2O03 A;  1UNN C;  5I5U A;  3CXH F;  5K2M A;  4X65 H;  4K0K H;  3JAT B;  2Z04 A;  3ASO C;  4X62 B;  3RIZ A;  1VQ6 V;  5GTH Z;  1SCU B;  3I4N G;  4X65 O;  4K0K O;  3TIG A;  3OD4 A;  3ZRV A;  1DV2 A;  2ZGI A;  5KT4 A;  3K0D A;  4UCS A;  3G4S V;  3G6V A;  1AUV A;  1HDJ A;  1K1Q A;  5LGT A;  1AP6 A;  4KXR A;  2DOS A;  1VQN V;  2YU9 A;  4JAV A;  1P4R A;  4F4W A;  1XEQ A;  3RBZ A;  3ZJZ A;  3M4I A;  1KKC A;  1JJ2 U;  1XQ8 A;  5FD5 A;  2V4D A;  3HXL A;  3E8F A;  1RSO A;  3AG7 A;  4CHI A;  2AXT Z;  3CRC A;  1KC7 A;  2YSU B;  3B8N A;  5C8Y A;  3THO A;  4RZR A;  4J0M A;  2B1G A;  3VA7 A;  4TV8 A;  3APO A;  4L1K A;  2VQD A;  5C5J A;  2W6O A;  1YHQ V;  2DJV A;  4IYH A;  3FDS A;  2EJ3 A;  1ZHS A;  4GYC B;  5LL6 b;  1ULZ A;  3T1C A;  3VQW A;  1Z2P X;  3G6Y A;  1SFO A;  5DG7 A;  1QNM A;  3HPL C;  3EVK A;  4ED6 A;  4IAJ A;  1K7D A;  3OTF A;  2RF4 A;  2WE6 A;  4YQW A;  4MW3 A;  5CA3 A;  4LR3 A;  4JI5 H;  1CKN A;  2Y4R A;  4BXX G;  4J9N A;  2VOB A;  4A3F G;  4PZ8 A;  1I1K A;  5IYB O;  4JI5 O;  5EOY A;  2HVR A;  5CB4 A;  1W59 A;  3SI8 A;  4HNA A;  2A79 B;  3UO2 A;  4KUM A;  4AI8 A;  1RSO B;  1FXK A;  1YF2 A;  2KB1 A;  4CKC A;  1YIT V;  2W7O A;  1Y1W G;  2JA6 G;  3IJ4 A;  1VQL V;  3CEI A;  1S77 D;  4ECR A;  1OWT A;  4X65 B;  4K0K B;  4K35 A;  4XDK A;  2HFE C;  2DIK A;  4YR0 A;  1NBM G;  3LDE A;  4EBC A;  4PA3 A;  1SC5 B;  5KFQ A;  1N34 B;  1S5H C;  2R9A A;  3SYP A;  2Q6A A;  2NN4 A;  2WLL A;  5CBG A;  5LXT F;  1PM9 A;  4FM2 A;  3WB1 A;  3DC5 A;  1WN7 A;  3ZMV A;  3RB6 A;  4NTW A;  3KKY A;  3RYF A;  5KG6 A;  1K8A W;  4UV8 A;  4JYA B;  1EKF A;  2UU9 H;  5LYJ A;  4A2B A;  3CRA A;  4ABM A;  5EIB C;  2UU9 O;  3KZI Z;  4PDB A;  1CKN B;  4JTC B;  2SCU B;  3KHR A;  1L0N H;  1I94 H;  3R66 A;  2BTQ B;  5TIS Z;  3RVZ A;  4K3A A;  3GJX B;  1I94 O;  1Q43 A;  4A3L G;  3ZHT A;  2QKC A;  1OV9 A;  1FXK B;  2O57 A;  5FLM G;  4XDL A;  2IMW P;  2DLN A;  4YJ2 B;  3G80 A;  4O4I A;  1WP7 A;  1VMG A;  4F4Y A;  1PK8 A;  1IXM A;  1KEC A;  1RPR A;  4B3M B;  2FL4 A;  3BPZ A;  1I7L A;  4RO2 A;  1CQJ B;  4PBC A;  4DR5 H;  1NU1 H;  4MV1 A;  4I7Z B;  3OHB A;  5DQH A;  2ZR2 A;  1EZ1 A;  4DR5 O;  1UPG A;  4JI5 B;  2HVJ C;  3B09 A;  3QO5 A;  4X88 A;  3WB2 A;  2VPQ A;  5I47 A;  3GTO A;  3N2K B;  3ABM C;  4ED1 A;  2Y48 A;  1GN6 A;  2ASL A;  5LYJ B;  4CKE A;  3H40 A;  4UCO A;  4A3G G;  4I4T F;  5BWT A;  5IYD G;  2Y69 B;  3HBL A;  3ASN C;  4DL7 A;  5B1B C;  4UB8 Z;  4GZR B;  1N8R W;  2Z0A A;  3A2F A;  3PW7 A;  5JH7 F;  2YIB D;  3T9F A;  5C93 A;  5EWF A;  4YIO A;  3DGE A;  5KFX A;  4WF9 V;  1U97 A;  4UCT A;  4WFG A;  2JIZ G;  4BW5 A;  1M1K W;  1YCI A;  4HYK A;  3MDS A;  2BQU A;  4DR6 H;  2PI4 A;  1M56 C;  4LF6 H;  4IHJ F;  5HFL A;  2UU9 B;  5EYP A;  1IOW A;  1P49 A;  4DR6 O;  3UZO A;  3NBZ B;  4JI2 H;  4LF6 O;  4LNU B;  1JA8 A;  3S3X A;  4B3R H;  4N21 A;  4JI2 O;  3H4B A;  3BEH A;  2HDK A;  4TOI A;  1NR7 A;  3AK3 A;  4UFZ A;  4B3R O;  4IRC A;  2CGO A;  2X6B A;  2NU8 B;  2W9B A;  1JLL B;  2CTQ A;  4ECW A;  1SER A;  2R7Z A;  2XCL A;  5CM0 A;  1QR9 A;  2QYZ A;  2NU7 B;  4FVM A;  3H20 A;  3VMM A;  4J7J A;  4FFL A;  3R65 A;  2ZD9 A;  5IJ9 B;  3NXS A;  2QK4 A;  3FAV A;  3F5W C;  4MW8 A;  1JMK C;  2GSM B;  4DR5 B;  3FYE B;  1I1L A;  1XNQ H;  1M57 B;  5BR8 H;  1H2N A;  3JAK A;  5KT6 A;  1XNQ O;  3P3P A;  5LXT A;  2ZCE A;  5BR8 O;  2BTO A;  1KKD A;  1CXZ B;  4FLU A;  1WPB A;  1GM8 A;  2M05 A;  1HR0 H;  3H1L H;  4TUY F;  1R3J C;  3AK1 A;  5EYP B;  2WLI A;  1G2W A;  2OTJ V;  5C3E G;  3OGC C;  1QVG U;  4O86 A;  1HR0 O;  2X0L A;  4QWB A;  4R50 A;  4Q20 A;  2QWR B;  2KKW A;  3L4J A;  3ORR A;  4Y8V B;  2R93 G;  3GIL A;  4X66 H;  5KFE A;  1IYE A;  2X0S A;  2A7W A;  4WCE V;  4ED3 A;  3CX5 F;  2W9B B;  3E8H A;  4X66 O;  1HNX H;  4UUG A;  2PYL A;  3LP8 A;  1K34 A;  4WFH A;  1A0I A;  1HNX O;  2QWO B;  3T9A A;  3Q4H A;  2UXX A;  4GLW A;  5AG2 A;  3CC7 V;  2ZNJ A;  4DR6 B;  1SZT A;  4D7T A;  2Q69 A;  1I5X A;  1IVS A;  3ZHQ A;  1X59 A;  3F7Y C;  3JYC A;  4FLY A;  4JI2 B;  5LL6 Y;  2R8I A;  5L3G A;  2ZQM A;  4B3R B;  3JAK B;  4PZ6 A;  4YY3 H;  4JGS A;  4EYI B;  4DR3 B;  3W1B A;  5LXT B;  2JA5 G;  4BWS C;  4A3I G;  2DQ3 A;  4YY3 O;  2W70 A;  2GQR A;  2YXL A;  2YDE A;  2WLI B;  1M0T A;  4RUA A;  2JEX A;  3N6X A;  1R73 A;  5KG7 A;  1DIK A;  3ABL B;  1JR9 A;  4Z1V A;  2F4V H;  2ZDG A;  2XAS A;  3SGI A;  5L3F A;  3RYH A;  2F4V O;  4FFR A;  1V9P A;  4I4T A;  5L3C A;  5IYZ F;  4CH5 A;  4AQY H;  2HVQ A;  3PW5 A;  3ZMU A;  2JEI A;  3Q4H B;  1KTA A;  5JH7 A;  4AQY O;  1XNQ B;  3I12 A;  4WFA V;  2C22 A;  2VA2 A;  1VP7 A;  5BR8 B;  4DL6 A;  2P5O A;  5D8D A;  3T9E A;  1V4Y A;  2E2H A;  4UVB A;  2VQF B;  2EZP A;  2JEG A;  4A5U B;  5JJJ B;  2R9I A;  2IBK A;  1BHA A;  1O9H A;  5L1L A;  4CBC A;  5A9G A;  4DV6 H;  4P30 A;  2JS5 A;  2WLH A;  3B8M A;  3BVO A;  4IHJ A;  1Y1V G;  4DV6 O;  2EIJ C;  4DV1 B;  1XMQ B;  4LP8 A;  1NH2 D;  1GKF A;  3SJQ C;  2DE0 X;  2LFR A;  5CAE B;  1HNX B;  4PHZ A;  2A06 H;  1N33 B;  4G3I A;  3N41 B;  2FPP B;  4TSF G;  4RB2 C;  1SQQ H;  4GCZ A;  2R85 A;  3QG5 A;  2CUG A;  2CNU A;  4U3J B;  1XL6 A;  1V55 B;  4MV7 A;  3GWO A;  4I4T B;  3H0G G;  2YUA A;  2JGU A;  2HLD G;  1MA1 A;  4JV1 A;  4O7L A;  3ZRW B;  2WLN A;  1DTO A;  1EHI A;  4MV6 A;  2IBZ H;  4DR4 H;  2X6C A;  4DLK A;  1S9F A;  2IP4 A;  4YY3 B;  4DR4 O;  2WTF A;  3WWJ A;  2RDI A;  4CC5 A;  2Y0I A;  2VUM G;  1R6K A;  3E83 A;  4YR3 A;  4OX9 H;  4P2Z A;  3N40 P;  1M5I A;  3T5L A;  4MVU A;  4Q4D A;  3STL C;  5ITZ A;  4JI7 H;  4OX9 O;  2AQ4 A;  1QU7 A;  3HKD B;  3KG2 A;  2F4V B;  4IHJ B;  1SS3 A;  4MVM A;  4PA6 A;  4TUY A;  3KCX A;  4JI7 O;  4BR6 A;  2I87 A;  1KEE A;  4J9K A;  1Z5W A;  3TK1 A;  5CR5 A;  3T1H H;  4IR1 A;  1VQ9 V;  5J2T F;  4MVQ A;  4BIU A;  2FP4 B;  3DF7 A;  2WPD G;  2WB1 E;  3T1H O;  4AQY B;  2MW2 B;  4BBR G;  3OFN G;  1A3G A;  3WG7 B;  5EIB D;  1KQS U;  3RB0 A;  1VKZ A;  4ICG A;  4QWD A;  2GHY A;  1WLE A;  3HOW G;  3LWB A;  4X1I A;  4PJ0 Z;  2YW2 A;  3FKI G;  5KX5 F;  3BRC A;  5HBR B;  2DN9 A;  3SYC A;  5KT7 A;  2H94 A;  5IY5 C;  2ZNI A;  1SRY A;  4ZIB A;  2NUA B;  3OUS A;  5T14 A;  4G28 B;  4W4L A;  4IR9 A;  2P6J A;  1Y1W A;  2YS7 A;  2ZIO A;  2JA6 A;  5FR9 A;  3JCU Z;  5KG0 A;  2HHF B;  1J95 A;  2I8C A;  2OH2 A;  3GTL A;  4EQ5 A;  1YTF D;  1W0J G;  4ECT A;  3C3T A;  2ZT9 B;  2YWV A;  4I7H A;  5ITZ B;  5KMG A;  4XYM B;  4BBS G;  2WLM A;  4PZ7 A;  3KHL A;  4ME6 A;  2W57 A;  1SQB H;  4TUY B;  3TCU A;  3R5F A;  4QIW F;  3AW8 A;  1TVK B;  4DR7 H;  3RN4 A;  5D5P A;  4DR4 B;  4DR7 O;  5IYZ A;  4X1I B;  4UCU A;  2AGA A;  3BA8 A;  1S68 A;  2CK3 G;  1BL8 A;  4OX9 B;  3ETQ A;  4PDM A;  2YCH A;  4ED0 A;  4A3C G;  1TUB B;  4QPJ A;  3K5O A;  3D3I A;  4FLT A;  2DW4 A;  5LMN H;  3MFI A;  5I5W A;  2DYS B;  3QZ7 A;  3T1H B;  1WP8 A;  1XIL A;  5LMN O;  5IYD O;  3GV5 B;  1EN4 A;  5FL7 G;  5KMG B;  1GSH A;  4IWY A;  3V6J A;  4LBE C;  3P30 A;  2CTR A;  3RYC A;  3E22 B;  3E8G A;  2XGP A;  2ZE7 A;  2DWD C;  1EBO A;  1M9N A;  3GTM A;  4LF7 H;  4NLG A;  4EYH B;  1UFI A;  4LF7 O;  2YEV B;  2V58 A;  3JZF A;  3DSQ A;  3H1I H;  3N42 B;  4C2M A;  4O7Z A;  2QE7 G;  1WR2 A;  1H2L A;  3JSL A;  1NVP B;  1MSD A;  4XDJ A;  1XDN A;  2HGW A;  1F51 A;  3MWM A;  4J7K A;  2NNU A;  1RM1 B;  1K97 A;  2A1H A;  2Z5U A;  1AI5 A;  3QVN A;  1JQ0 A;  2CGN A;  4PA9 A;  4PWQ A;  2MCT A;  5KG4 A;  3PZP A;  4JI3 B;  4FZ0 A;  5BZB A;  5B1O A;  1VF6 A;  1KJ9 A;  2UUB H;  2AZ0 A;  1KJ8 A;  4MV4 A;  1I6U A;  1SKV A;  4RQF A;  5H80 A;  2HP8 A;  4MSW C;  2UUB O;  2V5A A;  3T9B A;  1OHH G;  5KFS A;  5J2T A;  4DL3 A;  3RYC B;  1OCZ B;  4LF5 H;  1S03 G;  4CH6 A;  2R92 G;  3A0B Z;  4LF5 O;  1Q82 W;  3OM3 B;  3CCR V;  3HKC A;  2PZS A;  5KFU A;  1GRJ A;  1WRV A;  3L9D A;  2IH3 C;  3AG3 B;  1JFF B;  1JX9 A;  2Q67 A;  3VNN A;  5KX5 A;  3QFF A;  2C2E A;  3CJH B;  5BWX A;  3CPW U;  1JIH A;  2UUA H;  1QCE A;  3S3W A;  1V54 B;  2UXD B;  2L35 A;  2UUA O;  3L73 H;  2CDY A;  3OEH G;  1P7B A;  1VQ4 V;  3L4K A;  3G6X A;  2ZR3 A;  1M0W A;  2HIX A;  3ICX A;  3JZ6 A;  2LW1 A;  2W8K A;  2P0A A;  4LF7 B;  4JV5 H;  2W71 A;  4IRK A;  2YL2 A;  1HP8 A;  1AVM A;  3HKB A;  4MVR A;  5CA1 F;  2W9A A;  3VQX A;  4JTD B;  4M9U A;  2QJ1 A;  1K9M W;  2FJZ A;  4QIW A;  4DO2 A;  3JRW A;  2IJK A;  4U7N A;  2P22 C;  2Y69 C;  4HNV A;  5C44 G;  2W7P A;  1FD9 A;  3HKC B;  2R93 A;  3APQ A;  4GKJ H;  5KFA A;  3P32 A;  2WA4 A;  5B66 Z;  3DTG A;  2KG7 B;  1GGO A;  4FFK A;  4GKJ O;  4FFM A;  4J11 A;  3MR5 A;  2R86 A;  5KAF Z;  1N36 H;  4X9Q A;  1R6N A;  4KL1 A;  4PA4 A;  1N36 O;  1Y67 A;  4Q43 A;  4QW9 A;  1DF4 A;  1GN3 A;  2NU9 B;  1Q8I A;  3TY9 A;  1WB8 A;  4NTX A;  4LFB H;  2UUB B;  3WO0 A;  5I5T A;  1ZTE A;  1OCC C;  4LFB O;  3GTP A;  5FNV F;  2GUZ A;  3RFC A;  4LF5 B;  2ZE5 A;  3IAY A;  3AK2 A;  2DPJ A;  2YZM A;  1B06 A;  2RJZ A;  4I0X B;  2WDT A;  2DQ0 A;  5KFC A;  3GVM A;  3ZRS A;  4BY7 G;  2ADQ B;  5JJE B;  2JA5 A;  3HKB B;  4B3S H;  2EIL B;  2VPS A;  4EG0 A;  2ARH A;  5L1K A;  2J6T A;  4B3S O;  4DK0 A;  2E5L B;  2XT9 A;  2UUA B;  4LFA H;  1NQT A;  3WB0 A;  5KHG A;  1VS0 A;  2PYJ A;  4LFA O;  5LP6 C;  4APM A;  4OGQ B;  1I08 A;  3IG0 A;  5BMV F;  1DV1 A;  1DLB A;  4NVP A;  4MV8 A;  1RYR A;  3UO3 A;  2FLP A;  4YP3 A;  4ASU G;  1FFX A;  3TQT A;  2DWC A;  2R84 A;  4WD3 A;  4CH3 A;  3CVZ A;  1IZ3 A;  4X1Y A;  3W7X A;  1KMI Z;  1VF5 B;  5JCO C;  2EUL A;  2HR3 A;  2GUZ B;  1TWH A;  5KFG A;  3M9O B;  1P8L A;  3K59 A;  2ASD A;  4UCR A;  2HHH B;  1P7G A;  1XMO H;  3BAC A;  4DUY H;  1Y1V A;  4TQD A;  3DTF A;  1WA8 A;  4O4H F;  3WFV A;  4IIJ F;  1XMO O;  4DUY O;  4YHH B;  3MD0 A;  1ZLZ A;  1JOY A;  1G4Y B;  3ZED A;  3TJT A;  5BXZ A;  5EZY F;  1N36 B;  4H33 A;  4RB0 A;  1MMM A;  5F9L A;  4A3E G;  1KJI A;  2QDO A;  3GDE A;  3VQY A;  4FS2 A;  5KHH A;  1FFT B;  1QLE C;  3LQS A;  4LFB B;  3GWK C;  2W6M A;  1NR1 A;  2VA3 A;  2R72 A;  4HZ3 A;  3RUP A;  3H0G A;  1DF5 A;  2OIE A;  2DPI A;  2LGQ A;  2HGS A;  4UUJ C;  2ZKO A;  5H5N A;  3KRE A;  3RFR A;  3UT5 A;  1CE8 A;  4RUF A;  4X1Y B;  1FPO A;  3JAM W;  1Y66 A;  2EJR A;  3OEE G;  1KT8 A;  1IUR A;  2Q7D A;  3UM7 A;  3J81 W;  1IBM H;  5B1A C;  2JJ1 G;  4JI1 B;  1SA0 A;  2BQ3 A;  4B3S B;  2V9W A;  3JAR A;  5D5Q A;  1IBM O;  1S0V A;  4RAI A;  2VUM A;  3FB7 C;  4IT5 A;  2F23 A;  2R70 A;  4CMD A;  2P90 A;  1AR4 A;  1KP2 A;  3NR7 A;  4EFE A;  3K57 A;  5CA1 A;  1N4C A;  1KJJ A;  1WA8 B;  3GB8 B;  3FFQ A;  5C8Y B;  1Y76 A;  1AP5 A;  5IT9 W;  3P3N A;  4TV8 B;  5DLG A;  2YIA A;  2VRZ A;  1V51 A;  1E1Q G;  2YIB A;  4GC7 A;  3T54 A;  4FU0 A;  5EWE A;  3FKI A;  1L0L H;  3I56 V;  5KLV H;  2V7Q G;  2EIN C;  3J7A K;  4LSA A;  2WYO A;  4K6N A;  2AZ2 A;  4FLZ A;  3UT5 B;  1BZK A;  1I5Y A;  2R7L A;  4O2A F;  1C3O A;  4EEY A;  4MAM A;  3VQV A;  1XMO B;  4DUY B;  5FNV A;  4JF3 A;  2K9P A;  3HKE A;  2W6Q A;  5IP9 G;  1AI6 A;  1SA0 B;  2E76 B;  3JAR B;  5EBM C;  2Q2U A;  4FBT A;  3BAB A;  4TVI A;  4NZM A;  4JZ2 A;  5KS8 A;  1MZE A;  5CB4 B;  4DR2 H;  2FLN A;  2XAH A;  4HNA B;  3RB4 A;  5KFF A;  4IL6 Z;  5CA1 B;  4FFO A;  4DV5 H;  4IZO A;  4DR2 O;  4ED8 A;  2UVU A;  3QZ8 A;  1NT2 B;  4LH7 A;  4J9O A;  1GN2 A;  1SET A;  4DV5 O;  1Y76 B;  4DUZ H;  3T7A A;  4ECV A;  4HAM A;  2AGQ A;  1I1M A;  2V4R A;  1PPJ H;  4XBF A;  2QB5 A;  4DUZ O;  5KFT A;  3GID A;  5BMV A;  2EJ0 A;  1KB9 F;  1E1R G;  1EFR G;  2PTM A;  3AG1 C;  2ZDI A;  1BNC A;  1X4T A;  1S72 V;  3ZMT A;  3BQ1 A;  2WLL B;  2QEX V;  4LMY A;  1JCH A;  2GBO A;  1KJQ A;  4W4K A;  5C4X G;  4EFB A;  2ITD C;  4JAU A;  3I5D A;  4O3O A;  3K3W A;  4DAA A;  3SPG A;  1OCR B;  2WAQ E;  3RYF B;  2Q7G A;  2PUS A;  2IJJ A;  2CW7 A;  3G71 V;  1RJQ A;  1Y74 A;  4UVC A;  4RAY A;  5KFJ A;  3LNM B;  2ZE8 A;  4J9P A;  4FFP A;  3AEI A;  4I5S A;  3SDL A;  4A3J G;  4YR2 A;  2XGQ A;  3HKZ A;  5DGI A;  4FZ1 A;  5IE9 A;  4O4H A;  3AG4 B;  4IIJ A;  5C1P A;  4BY1 G;  3GTG A;  5BPH A;  1Z2G A;  1Q81 W;  5LGU A;  5EZY A;  5KUK A;  1ORQ C;  5EWG A;  4O4I B;  5KFZ A;  1VQP V;  4R6Z A;  2ATK C;  2JJ2 G;  1GAX A;  2AGP A;  1XUQ A;  5BWU A;  3ETD A;  1KC8 W;  3SR2 C;  1IXB A;  3QTC A;  1OJH A;  4FMT A;  3B40 A;  2W6P A;  3X2Q C;  3JD3 A;  4JXU A;  2EIK B;  3QNE A;  4JYB A;  1GO3 F;  1YIJ V;  3ML0 A;  2PN1 A;  1I94 B;  2IU3 A;  4CE5 A;  3QO8 A;  3ZHS A;  2UVV A;  3CMA V;  5C1O A;  4GT1 A;  1K4C C;  1Y74 B;  4MTX A;  4DV5 B;  5BWV A;  3D36 C;  2KQX A;  3M8A A;  4NTY A;  2YI9 A;  1LUV A;  4BWA A;  3KHH A;  1XBL A;  3GTK A;  1MSW D;  4O4H B;  5KT5 A;  4IIJ B;  5KFL A;  3A8T A;  5E79 Z;  2E75 B;  3M7M X;  2YIC A;  5EZY B;  2R92 A;  3RR5 A;  4O4J F;  2COI A;  4WBN F;  2AGO A;  3DXR A;  1ZET A;  4JV2 A;  3TEK A;  4LCU C;  5CN0 A;  4F4L A;  5CBH A;  1UC9 A;  4DRF A;  3T9D A;  3N8D A;  1XI1 A;  4YAJ B;  1BXR A;  2IJH A;  1OZ0 A;  3GIQ A;  4O2A A;  2FMA A;  1SES A;  3SYO A;  1O9G A;  2Q4P A;  3E2E A;  2WB1 A;  4LWS A;  4MT8 A;  5GW7 A;  2YXY A;  1L1F A;  2RDC A;  3ASO B;  3K79 A;  2P06 A;  2C2R A;  3ETE A;  3CCU V;  3JD0 A;  3OTO H;  3B4S A;  3ORQ A;  2RGR A;  4GC6 A;  1FXV A;  1B6Q A;  3OR6 C;  4QJF A;  4A2A A;  4J41 A;  3OTO O;  5H2F Z;  4FM0 A;  4O7Y A;  4BIO A;  3I55 V;  3U9S A;  1BE3 H;  3OMA B;  5DM6 V;  1KYO F;  1CPY A;  3KTM A;  4DL4 A;  4LF4 H;  1OBG A;  1YSC A;  2YZL A;  1NTM H;  3FAV B;  4LF4 O;  1DK1 A;  4LF6 B;  5KFM A;  2NVX A;  4CS2 A;  5BWR A;  5HV6 A;  2OCH A;  3JAM N;  1XHX A;  3SJB C;  3GIK A;  3NC0 B;  3RW0 A;  3J81 N;  3HOZ G;  1Y6X A;  4NYK A;  3DXR B;  1WCM G;  2ETN A;  4NXM H;  2JGD A;  5HFM A;  2JVD A;  1ZQ7 A;  4NXM O;  3OUZ A;  2C2A A;  2OCC C;  2F95 B;  4LWS B;  5L1J A;  3C0F B;  2M6Y A;  1JJO A;  4FLW A;  4BIZ A;  2JA8 G;  3GIP A;  4JI4 H;  1NH2 B;  5K3W A;  2C2D A;  5IT9 N;  2E3C A;  4JI4 O;  5GON F;  3GIJ A;  2CTP A;  4QJF B;  1OBD A;  1JDB B;  3MR3 A;  5B1N A;  1FYJ A;  4PI0 A;  2ITC C;  4F6R A;  1R1B A;  3CCS V;  4GUN A;  2ZDQ A;  3KXY T;  4FFN A;  3V4Z A;  5F2V O;  2IU0 A;  3MWE A;  5FJ8 G;  2FPG B;  3AG2 C;  1YJN V;  5JQW A;  2WLJ A;  1HR0 B;  5J2U F;  5JVL A;  1WAZ A;  1X9N A;  2Y0S A;  2HJD A;  3VOU A;  3RYI A;  3A0H Z;  2J9G A;  2W6J G;  4RZQ A;  2YRW A;  4EB6 A;  1E4E A;  3H9V A;  4DL5 A;  1FVI A;  3RBD A;  3G6B A;  4MS2 A;  3OW2 U;  1H2M A;  2DYR B;  2F43 G;  5KA5 A;  5KFK A;  1GMG A;  1YJW V;  4X66 B;  1PL0 A;  4TQS A;  1IBK H;  4YBZ B;  3OTO B;  3HOY G;  5F9N A;  1H8H G;  1RK6 A;  3K5H A;  4FPP A;  2ASJ A;  1IBK O;  1GN4 A;  1F4N A;  3BA9 A;  4B3T H;  1XNR H;  4GX5 A;  3FB8 C;  1RJR A;  5LOV F;  4IGG A;  1N56 A;  4B3T O;  1XNR O;  1JPX A;  1K5Q A;  3RYH B;  4LF4 B;  2QGN A;  3FX7 A;  2FYU H;  4ECU A;  4HNT A;  3H1J H;  2UVW A;  3HOU G;  4B7K A;  3G8D A;  2CQY A;  4PV1 B;  5JH7 B;  5L3E A;  4GLX A;  4AYB A;  2HVK C;  1BJT A;  2CE4 A;  4LSX A;  1I0H A;  1HNW H;  4O4J A;  1S76 D;  2RCV A;  1WNS A;  4UV9 A;  4NXM B;  2KSW A;  1PD3 A;  2QWQ B;  4WBN A;  1HNW O;  2NVY A;  3GLK A;  3RYI B;  3D8C A;  5DGH A;  1NKD A;  4D7S A;  4PD4 F;  4EB6 B;  1E4E B;  4TV9 F;  1AN7 A;  4DV3 H;  1DGS A;  2A9H A;  1IBL H;  4DV3 O;  4TM5 A;  3TIN A;  5L3B A;  1H38 A;  2QM7 A;  5KFO A;  1IBL O;  3B2E E;  3SJC C;  5I60 A;  4FM9 A;  1SQV H;  3CYO A;  4O7N A;  4PI2 A;  4HR7 A;  2JDI G;  2LGW A;  2Q7H A;  1B04 A;  3ZCC A;  3MWD A;  2HKO A;  1QHT A;  4TWK A;  4DV0 H;  3ABM B;  5E25 A;  1CKO A;  4P9P A;  4TT3 G;  3MJF A;  1NTZ H;  4C7U A;  4DV0 O;  2ZIM A;  4DV6 B;  1I50 A;  1IYD A;  3J80 W;  3JAS A;  3OUU A;  2AHZ A;  2N74 A;  5DN6 G;  1B6R A;  3D3Q A;  1CP9 A;  1R9T A;  5B1B B;  5D1P A;  5KKN B;  3HOV G;  4O4J B;  1MAB G;  3CWB H;  4Q4C A;  5H6R A;  1IBK B;  2QF7 A;  4FLV A;  3RBE A;  3LSS A;  4WBN B;  2JA7 G;  3IFX A;  4I50 F;  3EYY A;  1RK5 A;  3O65 A;  1N32 H;  3IN5 A;  3Q8S B;  1XNR B;  1S5J A;  2NU6 B;  2R8H A;  1N32 O;  5JQG F;  4ECQ A;  1G8M A;  3TY8 A;  3PVX A;  3PJS K;  3RWR D;  1EZV H;  2Y0P A;  1TWG A;  4ETS A;  3R5X A;  2GQS A;  5FLX W;  2QWN B;  2XAQ A;  1M93 A;  2JRI A;  2YS8 A;  4Q6G A;  5H9C A;  5LHH A;  2OLS A;  4MA5 A;  2D3O W;  3W7S A;  4ECX A;  5EBL C;  1DAA A;  4E6N A;  3T2M A;  1L8D A;  2M7W A;  3HB3 B;  3OSP A;  1W2B U;  5GON A;  4ECZ A;  3TW7 A;  4R7R A;  2B9Z A;  1EUC B;  1Z2N X;  3PW4 A;  5JUM A;  2H8P C;  4NZO A;  2ZE6 A;  2R8K A;  1MG1 A;  1K5S A;  1AR1 B;  1XDC A;  2P4K A;  1A48 A;  3T4D A;  3T9C A;  2GPW A;  1S0O A;  2UVR A;  3KAL A;  1R3I C;  4DV3 B;  4JI7 B;  1Q7Y W;  1RPO A;  4H37 A;  1IBL B;  4DV7 H;  5EC1 C;  3ZIA G;  5J2U A;  4M7E A;  1NZ6 A;  2J6S A;  4A3B G;  4DL2 A;  4PDV A;  4DV7 O;  5KFY A;  2JK5 C;  5JVD F;  1M7J A;  3L70 H;  4MTG A;  3L74 H;  1EKV A;  1VQ8 V;  2PY5 A;  4GX0 A;  2Y4T A;  2YYA A;  3TGU H;  1JXL A;  4DV0 B;  5LOV A;  1W93 A;  4OPH A;  5DQG A;  2PMZ A;  5KA6 A;  5EBW C;  2FK1 A;  4Z1M G;  3CEB A;  4AIL C;  5IYZ B;  5CMU A;  4KHP H;  1KP3 A;  1Z2O X;  1ARO P;  1AIL A;  4U7C A;  2BQR A;  4O7V A;  4DK1 A;  4KHP O;  3CCJ V;  4UXN A;  3IC9 A;  2JEU A;  1ZSP A;  3PW0 A;  1G6U A;  5L9X A;  4IYI A;  4JAS A;  3N44 B;  4HQ6 A;  2A3Q A;  3Q1K A;  4MV9 A;  2Q68 A;  3TY5 A;  2YI8 A;  2OYQ A;  1FKA H;  4CC6 A;  3LML A;  1GSO A;  2FK3 A;  4TV9 A;  1FKA O;  3L72 H;  3U10 A;  5K1X A;  2COJ A;  2YC0 A;  4DR7 B;  2F1M A;  4DV2 H;  5H6Q A;  1VAR A;  3K06 A;  2QSA A;  1C30 A;  3PFF A;  4DV2 O;  1IX9 A;  1SF9 A;  1SQG A;  1A32 A;  5LOV B;  4CMF A;  1WSC A;  3HOX G;  2JEF A;  2B63 G;  1KD1 W;  1N48 A;  3GTJ A;  1KUT A;  5CA0 F;  1FXK C;  1I3Q A;  1BGY H;  4N23 A;  3K9A A;  1PV0 A;  5KG2 A;  4DV7 B;  2J6U A;  5LMN B;  1I7N A;  2C35 B;  3G8C A;  3PO3 G;  3QWU A;  4R8C A;  2EZO A;  5DG8 A;  3MFH A;  5GTI Z;  2ZM6 H;  5I5S A;  1KBH A;  3UFX B;  5L1I A;  3K58 A;  2RQ6 A;  3CC4 V;  2ZM6 O;  3PO2 G;  4IWX A;  4I50 A;  3A0R A;  3JZI A;  2XND G;  4NYE A;  3H4D A;  3ZS8 C;  2XD4 A;  1BS3 A;  1BT8 A;  4X20 A;  3T5J A;  2Q73 A;  5JQG A;  1XOU A;  1ZAU A;  4O2B F;  4O7W A;  1YJ9 V;  4RU9 A;  4JV5 O;  4KP4 A;  2FK2 A;  4EBE A;  5J2T B;  3RV4 A;  3UYY A;  1J5E H;  4KHP B;  1NTK H;  4PEL A;  2EIJ B;  2R87 A;  3FKS G;  1J5E O;  4O3N A;  3AG4 C;  3K03 A;  1L2Z A;  4F4X A;  3EXA A;  4EGJ A;  3JSN A;  2F93 B;  1BHB A;  3SPH A;  5KX5 B;  3GV7 B;  5DAA A;  1VQ7 V;  5DIS C;  2YS6 A;  1EN5 A;  4MVO A;  2FKX A;  2W6I G;  2Q2T A;  5IWA H;  5DLF A;  4F50 A;  2VWJ A;  3LUL A;  1Z5V A;  2UXB H;  5IWA O;  3OT7 A;  4YJ2 F;  1SEI A;  5KG5 A;  4QWE A;  3U0G A;  2EIK C;  2UXB O;  3GIM A;  1NJI W;  3UKM A;  4I50 B;  5JVD A;  2DMX A;  1P84 F;  2QM4 A;  2Q8V A;  3ABU A;  5D1O A;  5EDW A;  4ZQI A;  5JQG B;  5A2Q W;  1R6T A;  1WCM A;  4RNM A;  4DRX A;  1PX2 A;  3OMN B;  2Q7E A;  1U96 A;  2D2C B;  5K1P A;  5DG9 A;  4MTE A;  3ABK B;  4GX2 A;  2IH1 C;  2WAM A;  2XAF A;  1US6 A;  3W7W A;  3J80 N;  3CCM V;  2EJ2 A;  4LF8 H;  4JV0 A;  2ZM6 B;  4LF8 O;  4YB8 B;  3ZRX A;  2W6N A;  1R3L C;  3GQC A;  5CBF A;  2AHY A;  2CKZ B;  1Y4M A;  2GV9 A;  3VOT A;  1PP9 H;  3OR7 C;  2QWP B;  1M57 C;  1SYX B;  2BOB C;  2CNQ A;  3CCE V;  4JV5 B;  2B1I A;  2WA3 A;  3TII A;  1YEW A;  4MTD A;  2CH7 A;  3STZ C;  1VQ5 V;  3AX6 A;  4LFC H;  2P4V A;  2XTA A;  5IY5 B;  3CSW A;  5FLX N;  4RQE A;  4LFC O;  4J9M A;  3JAL A;  5JVD B;  4JUZ A;  1J5E B;  2RMK B;  3RGZ A;  1GSA A;  3RAX A;  2CAZ C;  2C28 A;  5D1O B;  1BSM A;  4I9W A;  4Q0Y A;  3K3V A;  2Q0O C;  1B6S A;  2EIY A;  1YI2 V;  4GKJ B;  1I2L A;  4Q45 A;  1Y14 B;  2XAG A;  4DRX B;  1T94 A;  3ETH A;  1N34 H;  2B5U A;  1EZJ A;  3K0G A;  3TET A;  2CFM A;  4A3K G;  3ZN1 A;  2VWK A;  2YXH A;  1N34 O;  5B3S B;  4FIP C;  2W6Z A;  5CA0 A;  1CS0 A;  5J9P C;  5IWA B;  3K5M A;  2GLT A;  1IDS A;  4ZOL F;  3Q8R B;  2UXB B;  3KAJ A;  3J7A U;  1O75 A;  4JYA H;  4MVS A;  5KUM A;  3CD6 V;  1FFX B;  5I5Y A;  4JYY A;  4JI8 H;  5LP6 F;  1TGO A;  4C5C A;  3E35 A;  5KFV A;  1AJN A;  4JYA O;  2ATL A;  3U54 A;  4JI8 O;  1QVF U;  2RN9 A;  1AJQ A;  1WJZ A;  3K3P A;  2L6L A;  3WNZ A;  4NKG B;  3LSU A;  4NR1 A;  2CH7 B;  2FPI B;  2BR0 A;  3CS5 A;  3SPI A;  2YRX A;  3JAL B;  4WFE A;  4LFA B;  2R9R B;  5IJ0 A;  2YZG A;  4O2B A;  3ABL C;  3EPI A;  2QM8 A;  4KFM A;  1VQK V;  1VAJ A;  5KT3 A;  4LF8 B;  3CSX A;  2FE3 A;  2UUC H;  4LH6 A;  4B3M H;  4ZKI A;  3VBB A;  2YID A;  5JJN B;  4ZI7 F;  4ZHQ F;  3L2P A;  3MR2 A;  2UUC O;  4B3M O;  1CQI B;  3W5O A;  1QR8 A;  3M9M B;  2WSS G;  4PDL A;  5CA0 B;  3RB3 A;  2HJW A;  4YXW G;  2LO1 A;  3HR0 A;  2BTQ A;  1T3N A;  3CRR A;  4HNU A;  3S24 A;  4HN2 A;  4LFC B;  4RAZ A;  1D5N A;  4O82 A;  3LNN A;  3NBY B;  2RNB A;  4J10 A;  3K5L A;  1H8E G;  1LR1 A;  4H0L B;  1D2D A;  4YJ2 A;  2OIG A;  4QIW E;  2CTW A;  4EEQ A;  2DYR C;  2EIM B;  4RUE A;  3W1G A;  4F4Z A;  4B7E A;  3N27 A;  1GM7 A;  5JWP A;  2R7M A;  4DR1 H;  2DWE C;  5DMX A;  2JA7 A;  3FB6 C;  4DR1 O;  3WWI A;  3VPB A;  5DGB A;  5IJ0 B;  4Z2W A;  1AB3 A;  4O2B B;  1B33 N;  1FJG H;  5EK0 A;  4P9O A;  1MOF A;  1FJG O;  4Q44 A;  1V55 C;  3N2K A;  3WWH A;  1H2S B;  3R5H A;  4J42 A;  4DXW A;  4JAA A;  2CW8 A;  4RWU A;  4CS4 A;  4JI8 B;  1UC8 A;  3RAQ A;  4O83 A;  5KFI A; 
#chains in the Genus database with same CATH homology
 4X1I B;  3F8N A;  3KYH C;  4UCU A;  2F95 B;  3BA8 A;  3C0F B;  1IBM B;  2OWO A;  1JJO A;  4FLW A;  5FD6 A;  4JI4 H;  1S68 A;  1SQF A;  4OX9 B;  3ETQ A;  2YCH A;  2VUG A;  2E3C A;  3T1Y H;  3RGB A;  4K8Z A;  1TUB B;  3CB2 A;  4RB1 A;  3JAW B;  3K5O A;  5FPR A;  4FLT A;  5LMN H;  5FNV B;  4PI0 A;  4JI1 H;  3HKE B;  4F6R A;  3KXY T;  3BAA A;  3T1H B;  1XHZ A;  3FMA A;  2UUC B;  1BGW A;  1HR0 B;  2VQE H;  5KMG B;  1X9N A;  4JI6 B;  4X64 B;  3RYI A;  3E22 B;  3RYC A;  4L8J A;  4RZQ A;  4LNU A;  4EB6 A;  2Q0A A;  1FVI A;  2ZIN A;  4LF7 H;  2O03 A;  4X65 H;  4K0K H;  3JAT B;  4X66 B;  4X62 B;  3RIZ A;  1IBK H;  3DSQ A;  4CS3 A;  3OTO B;  3N42 B;  4ZOL A;  3JSL A;  4UCS A;  5BMV B;  4B3T H;  3BA9 A;  1XNR H;  3N43 B;  1XDN A;  1WH2 A;  5LP6 A;  3MWM A;  4DR1 B;  3RYH B;  4JI0 H;  4LF4 B;  3K5N A;  5IJ9 A;  3M4I A;  1XQ8 A;  5FD5 A;  2V4D A;  4DR2 B;  1FJG B;  3HXL A;  2MCT A;  3BHP A;  1RSO A;  4JI3 B;  5JH7 B;  4GLX A;  5C8Y A;  3THO A;  1BJT A;  4J0M A;  2UUB H;  4LSX A;  4TV8 A;  1HNW H;  4O4J A;  5JCO A;  1SKV A;  4DUZ B;  1I6U A;  1WNS A;  4NXM B;  2KSW A;  3RGX A;  4WBN A;  5J2T A;  3RYI B;  3RYC B;  4LF5 H;  1S03 G;  4CH6 A;  4D7S A;  4ZI7 A;  4FFB A;  4EB6 B;  4ZHQ A;  1AN7 A;  4DV3 H;  1DGS A;  1ZHS A;  4DR3 H;  4GYC B;  1IBL H;  2PZS A;  3HKC A;  5LL6 b;  1VF7 A;  3VQW A;  1Z2P X;  1T5E A;  3B2E E;  3SJC C;  1JFF B;  3VNN A;  3RF2 A;  3T1Y B;  5KX5 A;  4FM9 A;  4FLX A;  4ZOL B;  4PI2 A;  4IAJ A;  2UUA H;  3OTF A;  2WE6 A;  2UXD B;  4LR3 A;  5LP6 B;  4JI5 H;  1CKN A;  2Q7H A;  1B04 A;  2VOB A;  2PGG A;  4PZ8 A;  3L4K A;  1QHT A;  5EOY A;  4DV0 H;  2HVR A;  5CB4 A;  2UXC H;  4HNA A;  1CKO A;  2VQE B;  1M0W A;  2HIX A;  2ZIM A;  3ICX A;  4DV6 B;  3J80 W;  3JAS A;  4LF7 B;  4JV5 H;  2VQF H;  5D1P A;  4X65 B;  4K0K B;  4O4J B;  3HKB A;  1IBK B;  4FLV A;  4WBN B;  3VQX A;  3EYY A;  1N32 H;  1N34 B;  2QJ1 A;  2R9A A;  4ZI7 B;  1S5J A;  1XNR B;  4FFB B;  2P22 C;  4ZHQ B;  2RGV A;  4DV1 H;  1XMQ H;  1KU9 A;  4FM2 A;  3WB1 A;  3TY8 A;  3HKC B;  1WN7 A;  3RWR D;  4GKJ H;  4JI0 B;  4ETS A;  5FLX W;  3RYF A;  4Q6G A;  1M93 A;  1N33 H;  3QF7 A;  1N36 H;  4JYA B;  2UU9 H;  5LYJ A;  4KL1 A;  4E6N A;  4A2B A;  1L8D A;  5EIB C;  5GON A;  4O2A B;  1Q8I A;  3TY9 A;  1CKN B;  4R7R A;  4LFB H;  4PDB A;  1Z2N X;  2UUB B;  1I94 H;  2BTQ B;  3GJX B;  1M4U A;  1Q43 A;  4LF5 B;  3KAL A;  3IAY A;  4DV3 B;  4JI7 B;  5KHI A;  2RJZ A;  2WDT A;  4YJ2 B;  1IBL B;  4DV7 H;  5J2U A;  4O4I A;  4M7E A;  5JJE B;  3HKB B;  4B3S H;  4DV4 H;  2VPS A;  4B3M B;  4DK0 A;  2E5L B;  3BPZ A;  2UUA B;  4LFA H;  3WB0 A;  4DR5 H;  5KHG A;  1VS0 A;  2PYJ A;  5LP6 C;  4U3J A;  2PY5 A;  4JI5 B;  4APM A;  3WB2 A;  3IG0 A;  4NVP A;  3N2K B;  2IM9 A;  4DV0 B;  5LOV A;  2HEP A;  2UXC B;  1FFX A;  4CH3 A;  3CVZ A;  5LYJ B;  4X1Y A;  4UCO A;  4AIL C;  5IYZ B;  4KHP H;  1KMI Z;  1Z2O X;  5JCO C;  4DK1 A;  3A2F A;  1I7F A;  2YIB D;  3N2G A;  1Q3E A;  3K59 A;  1G6U A;  1P8L A;  4UCR A;  3HKD A;  2HHH B;  3N44 B;  3UQ8 A;  1XMO H;  4DUY H;  4MV9 A;  4TQD A;  4UCT A;  3TY5 A;  2YI8 A;  2OYQ A;  1FKA H;  4CC6 A;  4F6R B;  3LML A;  4YHH B;  4TV9 A;  5LMU H;  3U10 A;  4DR6 H;  3ZED A;  5K1X A;  1N36 B;  4LF6 H;  4K8X A;  4DR7 B;  2UU9 B;  5EYP A;  1P49 A;  4RB0 A;  3NBZ B;  4JI2 H;  3GDE A;  3VQY A;  2F1M A;  4DV2 H;  5KHH A;  4LNU B;  4LFB B;  4B3R H;  2R72 A;  4TOI A;  4UFZ A;  1SQG A;  5LOV B;  2HGS A;  4JI4 B;  3RFR A;  4CH4 A;  3UT5 A;  2HIV A;  1MZB A;  4X1Y B;  3JAM W;  4DV7 B;  4FVM A;  3J81 W;  3H20 A;  2EX3 A;  1IBM H;  5LMN B;  4JI1 B;  3RTX A;  1SA0 A;  4B3S B;  4BW9 A;  4DV4 B;  3JAR A;  5D5Q A;  2F66 C;  3QWU A;  3RJ0 A;  3N2G B;  5IJ9 B;  2ZM6 H;  2R70 A;  3K58 A;  2RQ6 A;  4EFE A;  1JMK C;  4DR5 B;  3K57 A;  5CA1 A;  1XNQ H;  4I9Q A;  2XIG A;  4I50 A;  3GB8 B;  5BR8 H;  3JAK A;  3ZS8 C;  1HW7 A;  3FFQ A;  5C8Y B;  5IT9 W;  5LXT A;  4X20 A;  1TVK A;  2ZCE A;  5JQG A;  2BTO A;  1ZAU A;  4TV8 B;  4FLU A;  1WPB A;  1HR0 H;  2YIA A;  5EYP B;  2YIB A;  4O4L A;  5J2T B;  4B3T B;  1J5E H;  4KHP B;  4RB3 C;  2KKW A;  3L4J A;  3J7A K;  4LSA A;  4X66 H;  2WYO A;  1L2Z A;  4FLZ A;  3UT5 B;  3JSN A;  1TUB A;  2F93 B;  1HNX H;  4YJ3 A;  2PYL A;  5KX5 B;  5DIS C;  1TAE A;  3VQV A;  1A0I A;  1E4G T;  1XMO B;  4DUY B;  5FNV A;  4NXN H;  3HKE A;  4TQF A;  1SA0 B;  2Q2T A;  5IWA H;  3JAR B;  2Q2U A;  5LMU B;  2VWJ A;  3BAB A;  2ZNJ A;  1Z5V A;  4GKK H;  2ZJT A;  4DR6 B;  1HNW B;  4D7T A;  2UXB H;  5CB4 B;  4I55 A;  4DR2 H;  1SEI A;  4HBN A;  4HNA B;  3E22 A;  5CA1 B;  4FLY A;  4JI2 B;  4JI3 H;  4DV5 H;  4I50 B;  5JVD A;  1NT2 B;  4LH7 A;  3JAS B;  4B3R B;  2QM4 A;  3JAK B;  4PZ6 A;  4YY3 H;  4DR3 B;  5D1O A;  3W1B A;  5LXT B;  4DUZ H;  4BWS C;  5JQG B;  5A2Q W;  2YXL A;  4DRX A;  2Q7E A;  1XK5 A;  5BMV A;  1M0T A;  4AHC A;  3N6X A;  5K1P A;  2PTM A;  4O4L B;  4MTE A;  1X4T A;  2F4V H;  4LMY A;  3SGI A;  3RYH A;  4EFB A;  4LF8 H;  1V9P A;  4I4T A;  4CH5 A;  2ZM6 B;  4YJ3 B;  2Q7G A;  2PUS A;  3RYF B;  4AQY H;  2CW7 A;  2HVQ A;  2UXD H;  4RAY A;  5JH7 A;  1XNQ B;  1ZHQ A;  2GV9 A;  2HVS A;  5BR8 B;  1SYX B;  2P5O A;  5GON B;  4JV5 B;  1HNZ H;  2VQF B;  1YEW A;  4MTD A;  4O4H A;  5JJJ B;  4LFC H;  4I55 B;  4IIJ A;  2XHB A;  1O9H A;  1N32 B;  4DV6 H;  3JAL A;  5JVD B;  1TA8 A;  2JS5 A;  5EZY A;  1J5E B;  3RGZ A;  4IHJ A;  2CAZ C;  4LF9 H;  4DV1 B;  1XMQ B;  5D1O B;  5J2U B;  4Q0Y A;  4O4I B;  3K3V A;  4GKJ B;  1JFF A;  3MAQ A;  5FPO A;  4DRX B;  1HNX B;  4PHZ A;  3SR2 C;  3QTC A;  1N33 B;  1N34 H;  2CFM A;  3N41 B;  2VWK A;  4RB2 C;  4NXN B;  3QG5 A;  5CA0 A;  4U3J B;  5IWA B;  3PN1 A;  3K5M A;  4GKK B;  4MV7 A;  4I4T B;  1I94 B;  2JGU A;  2UXB B;  3KAJ A;  1O75 A;  4JYA H;  3CHX A;  1FFX B;  4JI8 H;  1TGO A;  4DV5 B;  4DR4 H;  2YI9 A;  4BWA A;  4YY3 B;  4CC5 A;  4O4H B;  5KHK A;  4IIJ B;  4OX9 H;  3N40 P;  4X1K A;  1M5I A;  3M7M X;  3JAL B;  5ITZ A;  4LFA B;  4JI7 H;  5IJ0 A;  3HKD B;  4O2B A;  5EZY B;  4FM1 A;  2F4V B;  4IHJ B;  3RR5 A;  4TUY A;  3KAK A;  4LF8 B;  1Z5W A;  3T1H H;  3CSX A;  2FE3 A;  2UUC H;  4LH6 A;  4B3M H;  5JJN B;  4TV9 B;  3DF7 A;  2E5L H;  4AQY B;  3L2P A;  4DRF A;  5EIB D;  3W5O A;  1XI1 A;  4JI6 H;  5LA6 A;  4X64 H;  4O2A A;  4X1I A;  5CA0 B;  5KHJ A;  3U11 A;  1O9G A;  3BRC A;  1HNZ B;  2BTQ A;  3S24 A;  4LFC B;  4DR4 B;  4RAZ A;  4X62 H;  2ZNI A;  4ZIB A;  3OTO H;  2RGR A;  3LNN A;  3NBY B;  3K5L A;  4A2A A;  3JAW A;  4FM0 A;  4YJ2 A;  2ZIO A;  1QQC A;  4LF9 B;  4EEQ A;  3W1G A;  1E4F T;  4DR1 H;  4EQ5 A;  3SJA C;  4LF4 H;  1GYF A;  4UCV A;  3U0Z A;  4I7H A;  4X1K B;  2HHH H;  4LF6 B;  5ITZ B;  5KMG A;  4PZ7 A;  5IJ0 B;  1FJG H;  4O2B B;  4CS2 A;  2W57 A;  4TUY B;  1XHX A;  3SJB C;  4DV2 B;  1Q5O A;  3NC0 B;  4YHH H;  3N2K A;  1H2S B;  1CKM A;  3JAT A;  1D5A A;  4X20 B;  2CW8 A;  1TVK B;  4CS4 A;  4DR7 H;  4NXM H;  4JI8 B;  2JVD A;  5D5P A;  5LA6 B;  4B08 A;  1P16 A;  5IYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...