4EFEA

Crystal structure of dna ligase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of DNA ligase
rcsb
molecule keywords DNA ligase
molecule tags Ligase/ligase inhibitor
total genus 103
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4efeA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4efeA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4efeA02
4X64B 4OX9B 2VQEB 2UUAB 1ZAUA 3KYHC 2ZM6B 1XDNA 3W1BA 4DUYB 4DV3B 2UXDB 1A0IA 5LMUB 3BA9A 2HVSA 3QWUA 4PZ6A 1XNQB 5D1OB 3TY8A 3W5OA 4DUZB 3BAAA 1TAEA 1CKNA 1P8LA 3PN1A 4B3SB 1N32B 1XNRB 3GJXB 4EFEA 4KHPB 4PZ7A 4EQ5A 2HIVA 5DISC 4JI7B 1B04A 1X9NA 2UXBB 4JI8B 1TA8A 4EFBA 4UCSA 3JSLA 4NXNB 1IBLB 1V9PA 3NBYB 4PZ8A 4UCTA 5FPOA 2UUCB 4K0KB 4DR6B 4YY3B 2OWOA 3NBZB 4DR3B 1XMQB 4LF5B 3TY5A 4UCUA 4X65B 1FJGB 1CKNB 1HR0B 1S68A 1IBMB 3JSNA 4JI6B 4GKJB 4DV2B 1HNZB 4AQYB 4DR5B 3T1HB 3BABA 1DGSA 4DR4B 2CFMA 1CKMA 4LFAB 2HVRA 4DV4B 4LF7B 4LH6A 3RR5A 4YHHB 4JI1B 4DV0B 4LFBB 4DV5B 4JI0B 4UCOA 1I94B 3VNNA 4UFZA 4GKKB 1XK5A 3UQ8A 4DR1B 4X66B 5IWAB 3RTXA 2VQFB 4B3MB 4LH7A 4NXMB 2UU9B 4B3RB 3OTOB 2E5LB 4LF4B 4LFCB 4CC6A 4TOIA 4LF8B 3GDEA 5FPRA 3S24A 1J5EB 1N33B 1FVIA 4DR7B 5LMNB 4DV7B 4DRFA 2F4VB 5BR8B 3BA8A 4E6NA 1N36B 4JYAB 4JI3B 1CKOA 1IBKB 1P16A 1N34B 4JI2B 4DV6B 2VUGA 4EEQA 4DV1B 3T1YB 3NC0B 3TY9A 4UCRA 4JV5B 4LF6B 2UUBB 2Q2UA 3SGIA 1XMOB 2Q2TA 5D1OA 1VS0A 4LF9B 5D1PA 3W1GA 4X62B 4B3TB 2HVQA 2UXCB 3L2PA 3GB8B 2HHHB 1HNWB 4UCVA 4JI5B 2HIXA 4DR2B 4GLXA 4JI4B 1HNXB 4CC5A
chains in the Genus database with same CATH superfamily
1VF6A 2PVPA 3M8AA 3K03A 4DR6O 2PI5A 2HJFC 3GWOA 1ZTEA 1IYEA 1DTOA 2QSAA 3RGZA 4P2ZA 3AEIA 1BHBA 4ICGA 3T9CA 4QWAA 3J80N 4XDJA 4JUZA 2HGWA 4F4LA 1NZ6A 2WSSG 3IFXA 4O3NA 1KT8A 2WLIA 4FGRA 4NTWA 4JPRA 4MVQA 4PDVA 1S3JA 3R23A 1K9MW 3SR2C 2HVKC 1IXMA 2FMAA 4B7EA 4ED8A 3L75H 4DV0O 3TW7A 3V6KA 4IZOA 3RBZA 2IJKA 5KMGB 4E4EA 4ABMA 2GBOA 1BHAA 4K0KH 4CE5A 2RNBA 5B1BB 1V9PA 5C44G 2CE4A 4B3MH 2P0AA 3P3PA 2IBKA 1EN5A 2M05A 2OWOA 1FYJA 2ZDQA 4X1YA 1N48A 2LQTA 3TETA 1HP8A 3N2KA 2R92A 4IYHA 3SPGA 4I4TB 2XAQA 1CKNB 1OBDA 4PI2A 5DGAA 5LMNH 4Q8EA 1PV0A 3HKBA 2IJJA 4UB8Z 2PMZE 1R9TA 1KJQA 1AB3A 4O86A 1QLNA 4D6TH 2XAFA 4MSWC 1CKMA 4LFAB 1SZXA 1D5AA 5LP6A 4WF9V 2BTQB 5C8YB 5EYPB 1QVFU 1C30A 1Y14B 4YHHB 3HXLA 4JI1B 3B40A 1R3LC 3N2GB 3RBEA 3OHAA 4UFZA 5BY1A 3P30A 4GKKB 1V55C 1FFXA 2P22C 1Q8IA 1XBLA 2EJRA 3T1CA 4B3RH 5IWAB 1Y76A 2N04A 1BGWA 3BQ2A 1KJIA 4MW8A 1F4NA 3VQYA 1M0WA 3E5NA 4MV7A 1MZBA 1ULZA 2YDEA 4QJFA 2OLSA 4PDLA 1W2BU 4MV3A 2Y69C 2Y0PA 5BR8B 5CBGA 4NYKA 5BYBA 2UXDH 4K35A 4MVOA 5DGIA 1CKOA 3ASOC 3MHHC 2EZOA 2KG7B 4GC6A 3HB3B 4CS3A 3E35A 5KFMA 4BY1G 4UCRA 2WLMA 4J9LA 2UUBB 3S3WA 5JH7B 2R8HA 1N32O 2RF4A 3J80W 2ADPA 4CH6A 5BMVB 5KFPA 2X5RA 4C5CA 4CH4A 4FS1A 3WU2Z 3A0HZ 1HNXO 4X64O 3RYFA 1HNWB 4JI5B 3CCJV 3LNMB 2PZSA 5IYBO 3U10A 1AR1B 3TXSA 5IDJA 5JCOC 3O65A 5LMUH 4YJ3A 1JPXA 2EINB 3H9VA 3SPIA 3LQSA 3RN4A 3TINA 4DUYB 2J9GA 1I3QA 4AYBE 4ECWA 1R6NA 3HKDA 1KD1W 2W6IG 2W6JG 2EIJC 2AGOA 3EFFK 4XYMB 2QKSA 1JFFB 3JZIA 1DV2A 5EZYA 1KKCA 1VARA 4RUEA 3K57A 2EIYA 4KHPH 1EZJA 5D5PA 5CM0A 2GUZA 1SERA 3T99A 3GTQA 2NVYA 3K5LA 4TSFG 1PNKA 1JIHA 2D3OW 1I7NA 4RUCA 3AG3B 1TA8A 4WFFA 3H4DA 4K0KO 2BOCC 3U54A 1IBLB 4B3MO 2EJ0A 2FYUH 1EUCB 1BCCH 3JD1A 4J7JA 3ETQA 4W4LA 1WLEA 4A2AA 1XMQB 3NR7A 2WLIB 1S68A 5LMNO 5IE9A 2C35B 4OPHA 3OR6C 2ZE8A 4O3PA 1DGSA 1M0TA 3S3XA 1EYZA 5DAAA 3UZBA 3DXRA 1XEQA 3CSXA 1SYXB 5K1XA 3LDCA 3N40P 4DV5B 4EG0A 2Q5ZA 1VQ5V 1QR8A 1L0LH 2Y48A 4DR1B 2FLNA 2Q73A 4B3RO 1CP9A 3JD4A 1IOWA 1Y1VG 4X1YB 2AZ2A 3ZMTA 1K5SA 5DGHA 2YIDA 2RDIA 5B5EZ 2WLHA 4TOIA 1I2KA 4O4IA 4LWSA 3HKBB 5FPRA 2ZDIA 3JD0A 1J5EB 3SYPA 1CS0A 4IAJA 4DRFA 1IYDA 3ABKC 4TUYF 5JJNB 3EPGA 2AHZA 5LP6B 5B3SB 4N23A 2UXDO 2ARHA 3Q2OA 2DWDC 5KFAA 4DV1H 1V54B 1N34B 1RSOA 1QR9A 1W93A 1FFXB 4TM5A 4ZOLA 3GIQA 1Y76B 3M7MX 2R7LA 2YUAA 4L1KA 4I7HA 4C2MA 3MFIA 1KUTA 4DL7A 1TWHA 2ZXWC 3W1GA 3LNNA 2FK2A 3U55A 5KG0A 2JA6A 3VOUA 5EOYA 3ASNC 4QJFB 4GC7A 1IURA 3GVMA 4GLXA 3FKIA 2ZQMA 4U6PA 4RB1A 1QLEC 4M7EA 2YRXA 1MA1A 1WB8A 1AJPA 2VA2A 5LMUO 5KFSA 2LFRA 1S0NA 2X6AA 2HVSA 3ORQA 1AN7A 3KCYA 5IYBG 3X2QC 4JZGA 4FLZA 1GM9A 4QGPA 4QIWE 1TAEA 4IRKA 4JF3A 4BIOA 4TT3G 4KHPO 4ME6A 5KG5A 1QU7A 4EFEA 4FFLA 5IY5B 4YHHH 4JI1H 3RYFB 4EQ5A 3CSWA 1RJRA 1X9NA 4GKKH 3QTCA 1AR5A 2X6BA 3HKZE 3ETHA 2V4DA 5IWAH 4YY3H 4G2KA 5L3GA 4MTFA 2XAHA 2ASLA 2QWPB 5FR9A 5L1KA 3HKDB 4WBNA 2XNDG 3CYOA 4APMA 5EZYB 3K59A 4JTAB 3JAKA 4UXNA 2SCUB 3PW4A 5F2VO 3B4SA 4YR0A 2GUZB 2BQRA 3BABA 4TV9F 3GQCA 3GTOA 5HFLA 1AR4A 4DV6O 1YJ9V 1TWAA 3N8DA 3SYCA 4O2AA 4GX0A 1WCMG 2UUBH 2EIMC 4WCEV 5IJ9A 3LDEA 4J11A 5BXZA 3OMIB 4QIWF 4O4JA 4D7SA 2YL2A 4LF8H 2E5LB 4LFCB 3EPIA 3HPLC 4U3JA 5J9PC 4P30A 2WYOA 3M9MB 1NU1H 1BZKA 2R8GA 3BQ0A 3HBLA 4MVRA 2C2AA 5KHKA 4LSAA 3DXRB 4E2LA 4DUYH 1Z5VA 5H6RA 4C7UA 4R7RA 3QVNA 3J81N 4MA0A 5LOVF 2LP7A 4FFPA 4DV1O 4FM1A 3H40A 2LJ2A 4A93G 1FKAH 4JV5B 1GYFA 1KBLA 4O2BF 2E76B 4LF9B 3WB2A 3JD2A 4FU0A 1RYRA 4O4IB 1M9NA 4LWSB 1M57B 2W8KA 2ZGIA 5LXTA 1E79G 5IYCO 2E74B 1IBLH 4OX9B 2VQEB 3CP1A 4HYOA 1WAZA 3OHBA 1ORQC 2ZNIA 5KG2A 5HV6A 2CGOA 1RSOB 3FB7C 3P32A 2HG5C 3N6RA 1DLBA 3L70H 4ZOLB 1RPOA 3IG0A 2Q7DA 1VQ6V 4CZZA 2QM8A 2WAMA 3R9RA 3AX6A 2VPQA 2UXNA 4YHHO 1ZQ7A 4JI1O 4DV5H 2WAQE 1J95A 1W0JG 3MJFA 4GKKO 3B77A 1FXVA 4JI8B 5IWAO 4YY3O 2VWKA 4LBEC 1CQJB 3MAQA 1VQ4V 1ZLZA 4FE2A 4RNOA 2X6CA 1BXRA 1MZFA 3ZHSA 1BQZA 1J5EH 2UVVA 3JCZA 4XDKA 4A3CG 4B7KA 3FMAA 4TV8A 4RQFA 4TQRA 3I12A 4QPJA 3JSNA 4JI6B 3T4ZA 1ROPA 1E4GT 5JH7F 2YIAA 1C3OA 2YCHA 1GGOA 3HOXG 2H8PC 5L1JA 4HNAA 2I80A 1VBHA 4LFBB 4JI0B 4ECTA 2B63G 5A9GA 3J81W 3PJSK 2UUBO 4A2BA 2JS5A 4WBNB 3HO8A 1NT2B 4LF8O 4EYIB 5EBLC 3OTOB 2P5OA 3GIMA 3STZC 3JAKB 3JZFA 3GIIA 3GDEA 4JI5O 4J9OA 3D3IA 2WA3A 2CH7A 1N33B 4QPKA 1NTMH 3BPZA 5B66Z 4C5BA 4MT8A 4DUYO 1U96A 1UC8A 4JYAB 4EGQA 2YEVA 3W7SA 4O2AB 1P49A 4JI2B 4FFOA 2IU0A 4HBNA 5IJ9B 1AILA 3T1YB 3CRRA 1FKAO 4LF6B 2VUMA 4U3JB 3AG4B 3JAWA 5IYDG 5C1OA 1AI7A 2UXCB 1RJPA 1P7BA 5LL6b 1Y66A 2EBOA 4RUAA 4RWUA 2HIXA 5AG2A 1NKDA 3KHLA 4GX5A 2CZGA 1IBLO 2HDKA 3ETJA 5KT3A 5KFIA 3QF7A 5JVLA 5LHHA 1XMQO 2NU6B 5L9XA 4QWBA 2R7ZG 4YAKB 3AW8A 2Z3YA 1TUEB 3OGCC 1JDEA 1L2ZA 4IGGA 3CE2A 5IYCG 4NLGA 2A79B 3ZIAG 4M0JA 4OXSA 1IDSA 3K9AA 4C5AA 3H0GA 4EB6A 2ZE6A 4O7YA 2COIA 4J9ZB 3K3VA 3CC7V 4FMTA 1WSCA 1SQQH 3QFFA 2IH3C 3B8MA 5KFJA 4DV5O 4R50A 2HJWA 4MVZA 5LXTB 3ML0A 1XL6A 1YSCA 2WB1A 3FYEB 2F93B 2CNUA 4W4KA 2GQRA 1QVGU 4O4HA 1JVMA 1VQMV 3BY6A 4YQWA 2UUCB 4ECUA 5KX5A 3PW2A 5LP6F 2E5LH 4RQEA 1WNSA 4YP3A 1H2LA 1FJGH 2ATKC 5CA1F 5KT2A 1J5EO 2KSWA 1I1MA 3SYOA 5L3FA 5CA3A 3T9EA 3MD0A 1YDXA 4K8XA 1DIKA 4DV4H 1R3KC 3VOTA 3K0GA 1T5EA 2Q7EA 2HVRA 4X89A 3JRWA 2UVRA 1G4YB 3RJ0A 1GN6A 1N34O 1KJ8A 5CA0A 4BR6A 3SDLA 4AHCA 3E8GA 2ZCEA 4LSXA 2WWWA 4NTXA 5LGTA 2IP4A 4MVSA 4XDLA 4EEYA 3ABMB 2CTPA 3MDSA 3AK1A 4WFAV 1DF5A 4P9OA 2HGXA 3T7AA 4LF9H 3RTXA 5KFKA 4I55A 3VPCA 5LBQA 5KHHA 1YTFB 1H2KA 2GTSA 3TGUH 3RAQA 1RM1B 3MWDA 1QCEA 4TV8B 5KFOA 4DR7H 2JK5C 4I50A 2VQEH 2OTJV 3ZHRA 1FXHA 1HW7A 2F4VB 5EWEA 1Z2NX 3CEIA 4F4YA 1YIJV 2NU9B 3K5IA 4RB3C 3G8DA 2HJDA 2EILC 1IBKB 3AG7A 3D36A 3RGXA 3PVXA 1JQ0A 4EEQA 2AQ4A 1XMOH 1UFIA 2Q8VA 3L71H 1XL4A 3Q1KA 4O3SA 2FL4A 3KREA 3BJYA 4YJ3F 5FJ8G 1SQPH 2GPWA 4CMFA 4QE7A 5BMVA 4X62B 2W6PA 3C3TA 2CH7B 4Q8FA 4YJ2A 5LGNA 5LA6A 2A7WA 4O81A 5LL6Y 2G38A 3Q4HA 2X7RB 4YIPA 1FXKA 4TWKA 4DV3H 2BOBC 1RK5A 3L74H 2GTAA 2YEVB 2OCCC 1FAFA 1OWTA 5KA6A 2YIBA 4I9QA 3MR6A 2Z04A 4Y8VB 2O03A 1XOUA 1S0OA 2KSDA 3ZS8C 4JI6H 1R3JC 2HP8A 1JFFA 3W5OA 2HHFA 3BAAA 2FJZA 4IWXA 1JCHA 1M5IA 3IC9A 3JAWB 2WLJA 3E89A 3H1HH 4LNUA 1O75A 4H44B 2JGDA 2R7MA 1JXLA 2GPSA 4PZ7A 4YB8B 3H4BA 1H2SB 4Z1VA 1Q82W 4FFNA 2FB9A 2Y4TA 4TQFA 4HNTA 4NXNB 5IYZA 2EJ2A 4DR3H 4ECRA 2W0XA 3CMAV 2ZKOA 2E5LO 5F9NA 3H1JH 1Y74A 2ZR3A 4DL5A 4X65H 1FJGO 2W9AA 4WFHA 1NVPD 2V58A 4PJ0Z 1IVSA 1YVWA 2DOSA 4EB6B 4QSHA 2COGA 1IBMB 3CRCA 5BZBA 4IR1A 1HNZB 1VMGA 2VA3A 4DV4O 5KLVH 2ODMA 2DAAA 2W6OA 4J42A 4LH6A 4R7CA 4F6EA 4F6RA 1IOVA 4O4IF 4JI2H 4O4HB 1Y6XA 5KUKA 1XK5A 3BRCA 3ABLC 1VQ8V 2EIKB 5DQGA 2F66C 3HR0A 5KX5B 4MV6A 4Q6GA 4LF9O 5IP9G 2V5AA 1Y1WA 4RB2C 1NTZH 1Q81W 4LF4B 1CEZA 5H2FZ 4DR7O 4EBDA 1KP3A 4ZOLF 2Z0AA 4WD3A 2PF4E 3Q8PB 1K3EA 1I7LA 3S24A 4QW8A 1FPOA 1RK6A 1F51A 2VQEO 2QA4V 5LYJA 3RF2A 4ED7A 3K3WA 4E6NA 2ETNA 5CA0B 2A9HA 4A3LG 1B6SA 4XYLB 3OD4A 1XMOO 3ZJZA 3F5TA 3L72H 1BJTA 4CKBA 4I55B 5ITZA 2Q2TA 2UVUA 1VS0A 3RW0A 5J2TA 1KECA 3CB2A 3WB0A 3L2PA 4PWQA 4I50B 1BL8A 2Z5UA 3VPBA 4KXRA 3WO1A 4J9NA 1EFRG 3LMLA 3ZHQA 5CB4A 1OZ0A 4JI8O 3WO0A 3TQTA 4A3KG 3E22A 2NN4A 4J9RA 3LP8A 3OM3B 5J2UA 3CC2V 2JA5G 4DV3O 2UUCH 3SI8A 3WWJA 1OJHA 1PPJH 1ZWIC 2QDOA 3W1BA 2JJ1G 1A0IA 4BBSG 1NH2B 4GZRB 4DXWA 3F8NA 2BTOA 1VQ9V 3U9TA 4BXXG 4HR7A 2RCVA 2CAZC 4JI6O 1M7JA 1OCOB 3G8CA 4NYEA 1A48A 1W96A 3Q8QB 1XNRB 4G3IA 4J10A 1Z5WA 4YJ2B 4J7KA 5LA6B 5GTHZ 4JI0O 2HIVA 1RYSA 1SQBH 3Q4HB 5CR5A 2IU3A 1FXKB 4FK5C 2GHYA 2UXBB 3WG7C 4EFBA 4Q43A 4CHIA 3BVOA 3CXCU 1R6TA 4DR3O 5FPOA 2QR4A 5KA5A 3H3VH 3ZMUA 5KFQA 3TJTA 2YI8A 4X65O 5KFNA 3TY5A 2R87A 5BWRA 4TQSA 2HHFB 4FLWA 1AROP 4AQYH 4GKJB 1Q7YW 3VPDA 2JA8G 4O4JF 4LNUB 1H2MA 3Q8RB 3K5MA 2JGDB 1IBKH 2IH1C 4LF7B 1JMKC 5BWTA 4JI2O 5I5XA 3W7UA 4F4XA 3ZBHA 2Q7HA 1KB9F 1E4FT 3QO8A 2CGNA 5KFRA 5IYZB 1VF7A 1I7FA 1O9GA 3F7YC 5KFHA 1Y74B 5KFEA 2VQFB 4NR1A 3HOZG 4YR3A 5DLFA 5KFGA 2IM9A 4NVPA 4A3MG 3AG2C 1N0JA 1JJOA 3JZ6A 3T9FA 3TK1A 2Q69A 5DM6V 1YCIA 3CD6V 4PDBA 4JTCB 3G67A 3G6EV 1Q3EA 3MWEA 4FFBA 2B9ZA 1AJQA 4MS2A 3SJCC 5KHJA 4HAMA 4F6RB 4PDRA 1B6QA 4DV6H 2VUGA 3P3NA 5LXTF 5JCOA 2YW2A 1WP7A 5D1OA 4AILC 1TUBA 2DQ0A 3MR2A 4XBFA 1KBHA 4UUGA 1N56A 2Q4PA 4ED0A 4PHZA 4ZBMA 3GTJA 4FBTA 2FE3A 2VS0A 1WR2A 3QNEA 2HHHB 1S10A 4DQNA 5LYJB 4UVAA 2RMKB 4XZ3B 1YF2A 2JA6G 1I08A 3ZX6A 2ZM6B 2UUCO 3N6XA 2DYSC 1KC8W 2JA7G 5B1NA 3T4DA 4FM9A 1G1XB 3BA9A 2M6YA 4MTOA 3AK3A 4GUNA 1G8MA 5ITZB 1ZL8A 2CTQA 1S0VA 5J2TB 2NU7B 1B6RA 2CQYA 2JJ2G 1OHHG 3LWBA 2ATLA 3CJHA 3PN1A 1QQCA 5L3BA 4B3SB 3OR7C 3MR5A 3G6YA 5EK0A 3UO2A 3TIGA 1WB7A 2QWOB 2IJHA 4PA4A 1LNQA 1SA0A 3JARA 3VQWA 5CB4B 4GYCB 5D8DA 1YJWV 3E22B 4TV8F 2V1DA 3ZCCA 1EN6A 5J2UB 2NU8B 4H13B 3OSPA 4MTDA 3V4SA 1GN2A 2J6UA 1SQGA 3BCCH 4F50A 4CH5A 4LF5B 5H80A 4FZ1A 4JXUA 3H20A 3Q8SB 5GONA 1KQSU 3GIKA 1HR0B 4AQYO 4PBCA 3MHSC 3OAAG 4O3RA 2JGUA 3G4SV 3PO2G 4EBEA 4LFAH 4R8CA 5H9CA 3AG1C 1E4EA 3K5OA 4BAYA 1IBKO 3F7VC 2Y4RA 3CCQV 2W57A 3SPJA 2FKXA 5KFBA 1AUVA 1I50A 3QO5A 1XI1A 4FM0A 3G71V 2PBZA 1ET0A 3ZMSA 3TQ1A 4J9SA 3TXQA 4JV0A 4UV9A 2KQXA 1SETA 1V55B 2FPIB 3CC4V 4J41A 2R8KA 3SPHA 1FVIA 1NR1A 4J9MA 5BR8H 5L1LA 1SESA 5JUMA 4FLUA 2W6NA 4FM2A 2QK4A 2YXHA 4RZRA 2PMZA 4J80A 2DYRC 2HEPA 1CQIB 2ABJA 2Y69B 3ZRWA 1OCZC 3NC0B 4HN2A 2VOBA 2Q2UA 3SGIA 1PL0A 2AGPA 3ASOB 1P7GA 2CNQA 1XNRH 3E8FA 4H37A 2R93A 3KHHA 3AYHB 4B08A 1S9FA 1HNWH 3WNZA 2KB1A 4JI5H 4A3BG 4JV1A 3IGAC 3ETEA 5JQGA 2XCAA 4FFBB 1JX9A 1IX9A 2UUAB 4PA6A 3CRMA 3UYYA 1WPBA 4LCUC 4ED1A 2XASA 5B1OA 1HDJA 3H1KH 4DL2A 3WWHA 5JVDA 5FL7G 5D1OB 3TY8A 1TUBB 1NQTA 3JATA 1LUWA 2EULA 5KKNB 4BW9A 2C2EA 5KX5F 4K8ZA 3LSSA 2Y0SE 2EIJB 3HKCA 1WCMA 5DG9A 2XC9A 4ECQA 2VRZA 1M93A 1K33A 4I4TF 5DISC 4X1IA 4DIMA 1Q6IA 3RFRA 2X0LA 2ZT9B 2V9WA 1M4UA 1MABG 3DTGA 4O7SA 3ZRSA 1AP5A 5GTIZ 4ZI7A 2RN9A 3GWKC 5KS8A 4A3JG 4NB5A 1XMQH 3A0BZ 1T94A 2Y0IA 5C8YF 5CA0F 3ZN0A 4MV8A 1ZL8B 4MV1A 2ZIOA 2CK3G 2K9PA 2ZIMA 3CJHB 1M56C 4DV2B 2GLTA 4AYBA 1NS1A 1CPYA 2Q68A 4I55F 4LFAO 1VQ7V 3HT5A 1B33N 5EWFA 3RB6A 4DR4B 1SA0B 3JARB 2XAJA 2Y4UA 1I2LA 2PYLA 1KJ9A 2WLNA 3GILA 2HKOA 4I50F 1NBMG 4FZ0A 2OTLV 4O7TA 4DR1H 3RAXA 2NVXA 5HFMA 1SCUB 4X66B 3OSNA 1GM7A 2P4KA 4LH7A 3UM7A 1OCCC 3ABTA 3OMNB 2P90A 5GONB 2RGRA 1IXBA 5K3WA 2HHHH 4IWYA 5HBRB 5KFZA 4FLVA 1I0HA 1Z2PX 2LW7A 1W59A 5BR8O 4DV7B 4MW3A 2IBZH 5EC2C 1A0GA 1E4EB 1T3NA 4WHXA 5BMVF 1X4TA 1N34H 2JDIG 3ZHUA 1N36B 3OTFA 2BSKA 2M7WA 1K34A 3OMAB 3ABKB 5K1PA 5LA6F 4O7ZA 3CCVV 1GN3A 3APOA 3OGIB 5B1AC 4EYHB 4QE9A 2DW4A 2YZGA 3OE7G 1BS3A 1XNRO 3RYCB 3RIZA 4OPAA 1KUQA 4ECVA 2OIGA 1R1BA 1JDBB 4B3TB 1ZUQA 4QNHB 1NH2D 1HNWO 1T36A 3BQ1A 3RB4A 1B3QA 1F4MA 2VUMG 4K3AA 4IHJA 3KAKA 2ZXWB 3GTKA 2XHBA 4DR2B 2DMXA 4JI4B 1HNXB 3JCUZ 4X64B 4BWAA 3R5HA 4N21A 2R6FA 1SQXH 2N05A 3ASNB 5I5TA 5I5WA 2BQUA 4D7TA 3CWBH 2XCLA 2VWJA 1TWGA 5DGBA 1QLEB 3ZRWB 3K5HA 3OW2U 4LMYA 2OH2A 3PO3G 1JA8A 4J9QA 1X59A 2QWRB 4UUJC 5IYZF 3SYAA 4I0XA 2B63A 3T9AA 5KFYA 3GJXB 4PA3A 3X2QB 4CH3A 5C93A 4FLTA 5B1BC 5JQGB 1JX4A 5CAEB 2COJA 2R9IA 3MR3A 2ASDA 3T5LA 1SF9A 3VBBA 2HLDG 4K0KB 4LP8A 4RZQA 3UFXB 2R9AA 4TV9A 5JVDB 5HNEA 3SNOA 4O7VA 3ETDA 2FTKA 3JATB 3WFVA 3DTUB 5IT9N 1ZETA 2VPSA 3HKCB 4ZIBA 3WB1A 2W6QA 5KT5A 3NUAA 5KHIA 3B09A 1K4DC 5KG3A 4X1IB 4DR1O 1GSOA 4F4ZA 2JEUA 3VNNA 4U7OA 2E2HA 2CW8A 2C28A 5LYJF 3K08A 4ZI7B 4JYBA 3RWRD 4JYYA 5I5UA 3VA7A 1URFA 1CE8A 4Q44A 4HNVA 4LFCH 4QWCA 2R8IA 4B3RB 3KXYT 4CS4A 4MA5A 4CC6A 2EIMB 4R8UA 4F4WA 1SS3A 3CPWU 2HHHO 3JAMN 3BG5A 1P4RA 1S72V 5LOVA 4FS2A 3LDDA 4ETSA 1Q6UA 5BYAA 2PUSA 5KAFZ 5KAIZ 5I5YA 1KMIZ 1VQLV 5J2TF 2R7ZA 1TGOA 3OUSA 1BSMA 1BGYH 4O2BA 4NZOA 2Q0AA 4Q45A 3V4ZA 3M9OB 4M9UA 4JV5H 5CB4F 3BFRA 3F5WC 5C1PA 3HOVG 3TCUA 3GB7C 3RVYA 4O84A 5FLMG 2FMLA 2DN9A 2QE7G 4ZHQA 5D1PA 4A3GG 1M1KW 1ZHSA 1A9XA 4ED2A 5KHGA 4OX9H 4UCVA 2WE6A 2W9BA 4WFGA 2XGQA 1JLLB 1S76D 5EBWC 1XDNA 2BSKB 3LSUA 4MVMA 5KFDA 2QJ1A 2WLLA 4IIJA 1BE3H 1ENVA 5LMUB 4O3QA 4A3FG 4GX1A 2I8CA 5KT4A 4U7CA 2F95B 1GH6A 3V6HA 1WJZA 4PZ6A 1HR0O 4H0LB 3FD9A 4DV2H 1N8RW 1V4YA 1XDCA 4DAAA 1VF6C 2YICA 2LW1A 3AG3C 4DO2A 5IT9W 4KHPB 1AI4A 4IHJB 4DLKA 4X88A 5CBHA 3EYYA 3SJAC 4JI8H 5EZYF 3D8CA 4J9KA 2BR0A 4MV9A 2CTWA 1M6VA 2WDTA 5C5JA 3N27A 3RVZA 3FB8C 3JSLA 1EKVA 2R85A 4U7NA 4GX2A 1AI5A 5L3CA 2AHYA 5IP7G 1AP6A 4MVUA 3CMEV 3FB6C 1AJNA 4QWEA 2E75B 1K1QA 5KG6A 4DV7H 4EGJA 4I0XB 3JAMW 3L4JA 3SE7A 2N74A 4PA7A 1THZA 2OCHA 1N36H 2MW2B 4DW1A 4LFBH 3ZN1A 4JI0H 1OCRC 3D3QA 2W70A 3GIDA 1FS0G 2BE3A 2YWVA 3A0RA 3RGBA 3OTOH 4LFCO 3T9BA 4TV9B 1G6UA 4B3TH 2OYQA 3UZOA 4HNUA 1I5XA 2KKWA 1N33H 3OT7A 1E1QG 5LP6C 2R7NA 5B3SC 1WH2A 2FK3A 4DR2H 5BWXA 1L1FA 4JI4H 1GSAA 2YS7A 2E3CA 4PDMA 2B1GA 1Y1WG 2UVWA 2R92G 1V54C 3N44B 4LR3A 4JYAH 1US6A 3CXHF 4JAAA 2O57A 3HB9A 3STLC 2QTOA 3T1YH 1H8HG 1RFYA 4JV5O 4LF6H 4RNNA 2CTRA 1MOFA 5F9LA 4DV1B 4DK1A 1ZSPA 2FB5A 3FB5C 3SJQC 1JJ2U 2IMWP 4ASUG 2YSUB 3RFCA 3CVZA 1OV9A 5TISZ 1K1SA 5CE8A 2UXCH 4R8UB 3OUFA 5LOVB 1VF5B 2OT5A 2HG8A 2JEXA 3CRAA 3NXSA 2B1IA 2GDSA 4OX9O 1TWFA 1H2NA 2R7KA 2C22A 1DV1A 3JALA 4CC5A 4MTEA 3VMMA 4NKGB 2Q0OC 4O2BB 2FK1A 3E8BA 2ALZA 5KFXA 2GQSA 2RDJA 2ZNJA 2DPIA 4CKEA 5DG7A 4RCNA 3IN5A 3PW0A 4O4LA 5FD5A 4JV2A 3HOYG 5CN0A 4DV2O 5IY5C 4CKCA 4ZHQB 4DR4O 1GTOA 4FLYA 4RUFA 1KU9A 5KFLA 5GONF 3V6JA 2W9BB 3CCLV 1UPGA 4JI7B 1TWCA 5CA1A 2L6LA 2QKCA 5JWPA 2VR1A 4GT1A 4KUMA 2W6MA 4G27B 4X66O 2I87A 4UVCA 2ODTX 2WLLB 4Q0YA 3CCUV 4IIJB 4DL3A 3I4MG 3VQVA 2P4VA 4YY3B 2AGAA 3NBZB 3LULA 5KFTA 3M4IA 3RBDA 3PR4A 2W0FC 4KFMA 4YIOA 5L3EA 4DV7O 1Q43A 2J6SA 2DWEC 3K0DA 4WBNF 2RDCA 2R86A 4RU9A 4DR5B 3QZ8A 2V4QA 1XHZA 1N36O 2CFMA 1QNMA 4OGQB 4LFBO 3RR5A 3DAAA 3E8HA 4FFMA 2QB5A 1K7DA 2AGQA 5JJEB 3UQ8A 3SYQA 1MSDA 4ECZA 3OTOO 1NR7A 1PNLA 1VQPV 2L35A 2UU9B 1GKFA 3EHBB 4B3TO 3C90A 4CBCA 3RUPA 4BWSC 3K79A 1GRJA 1EKPA 4O2AF 2R70A 4LF8B 2QWNB 1N33O 1VQNV 2PI4A 2PGGA 3TW6A 4DL4A 3E86A 5BPFA 3HOUG 2JA5A 4DR2O 4FLXA 4JI4O 5I60A 3K58A 2DABA 2F4VH 3GV8B 4J7ZA 2ITCC 5E25A 2W9CA 1XILA 4JYAO 4ZQIA 1NJIW 2ITDC 1Z2OX 2Z02A 5DEDA 2K1EA 3JD3A 3T1YO 1P16A 5JQGF 2PY5A 4LF6O 4RAYA 1XQ8A 5LGUA 3I56V 1KC7A 1VKZA 1M57C 2ZDIC 2V59A 5KG7A 2EILB 2ZDGA 2FP4B 2LGWA 4X62H 2EZPA 3TIIA 5D5QA 2UXCO 2W7OA 1JOYA 2XD4A 5E1AC 5FNVA 3W7TA 5JVDF 1K73W 1EZVH 2DQ3A 4K6NA 3KCXA 2WTFA 3T5KA 3OFNG 1YHQV 2H3OA 1YITV 4DRXA 1SQVH 3KZIZ 3K9SA 3LSQA 3KHGA 1PNMA 3PW5A 4JASA 1XNQB 2OCCB 3G6VA 3RB0A 1EKFA 3M99B 1LR1A 4ZI7F 2CNVA 4JZ2A 5DG8A 1K83A 3SPCA 4UB6Z 2DJVA 1SEIA 2IA6A 3JALB 4FVMA 1B04A 1A3GA 4NXNH 1YXBA 5EBMC 4UCSA 2EX3A 4Z1MG 1K92A 2H94A 1OCRB 3FKIG 5KG1A 2EJ7A 4JTDB 1SRYA 2CKZB 4O4LB 2V7QG 3H01A 3N2KB 4PD4F 2LO1A 1IBMH 4U3FH 4WFBV 1GSHA 1MSWD 2NLJC 5T14A 1HNZH 4DL6A 4A3IG 2F1MA 4EBCA 5A2QN 3T1HB 2WA4A 3G6XA 5DECA 4L87A 3J7AK 1I1LA 1Y1VA 3FFQA 2A1HA 5CA1B 3FAVA 1GM8A 4TQDA 2W71A 1I94B 3ZMVA 5I5VA 2XIGA 3UKMA 2XCPA 4YBZB 4ECYA 2J6TA 4LF4H 5KT7A 4NXMB 1BQ0A 3CEBA 4L8JA 3TEKA 3ABLB 4PA9A 1WN7A 4FJCC 1JR9A 2JA7A 4R6ZA 2F4VO 1AUXA 1R73A 1K5QA 3DF7A 1L8DA 2D2CB 1KJJA 1L0NH 3ZEDA 3BA8A 2HGSA 1RP3B 4PI0A 3G6BA 4X20A 1XHXA 1YTFD 3L4KA 3RB3A 2AU0A 4JI3B 3FDSA 2YS8A 1FD9A 4O7RA 2W6ZA 4IHJF 3UT5A 3JASA 2PYJA 3AG4C 3RV3A 4WFEA 2P06A 4O7LA 5FLXN 1S77D 5KFUA 4X62O 4BW5A 4O7NA 2WB1E 3U11A 4DK0A 3RYCA 2JEGA 4PV1B 3I4NG 1EBOA 2FLLA 4JI7H 5EDWA 1VEWA 4JAUA 4J0MA 2QM4A 4I7ZB 2W9CB 2R93G 1DK1A 1DAAA 3KYHC 1ZAUA 5DLGA 2C2RA 4YJ3B 2Q9LA 1D2DA 4RB0A 2DZDA 3QZ7A 3GTLA 1Z2GA 3B2EE 1MG1A 2YXLA 2AW9A 3CRQA 1I6UA 3O9OA 3EXAA 1Q86W 1EN4A 5L3DA 3FKSG 4UVBA 1PKXA 3RT3C 1PD3A 5LHIA 1UC9A 4Q4CA 1PL4A 2E2IA 4DUZB 4DR5H 1P8LA 3GLKA 4QW9A 2ZR2A 5I5SA 1XUQA 3GV5B 3N42B 1GK9A 5FNVB 1I5YA 2YS6A 4IL6Z 1Q90D 1ZHQA 1RPRA 5A2QW 2UXBH 2ZD9A 1NVPB 5KG4A 4H33A 2XOKG 4MV4A 4NXNO 1SQFA 2CDYA 3NBYB 4PZ8A 1Y4MA 2Q67A 4UCTA 4DRXB 2JEIA 1TVKA 4Z2WA 2UU9H 3ZHVA 4DR6B 2RQ6A 1JKJB 2ZINA 3T9DA 2X0SA 3WG7B 1EZ1A 1PM9A 1E1RG 2OIEA 2ZE7A 4IRDA 5JQWA 4X9QA 1M90W 1IBMO 2DIKA 1VIBA 2YZNA 4UCUA 4O4HF 1FJGB 4GKJH 1HNZO 1BMFG 2NNUA 4O7WA 3BHPA 5KFCA 2JIZG 1SC5B 4NZMA 5C3EG 1MMMA 4LF7H 4GLWA 3GV7B 2VQDA 4MAMA 3N43B 3ABMC 4RAZA 3LUTB 4DV4B 4HYKA 4IR9A 3KKYA 4DV0B 3CS5A 1AVMA 2UXXA 5FD6A 4Q20A 5IYDO 1UJWB 4I9WA 3C0FB 5GW7A 4J9YB 2ZE5A 3W7WA 2VQFH 1RM1C 2XUMA 4TVIA 1K4CC 3KHRA 4I5SA 4LF4O 1KTAA 4QWDA 2YC0A 3UO3A 2PTMA 5FLXW 1NI8A 4BIUA 5BPHA 4RNMA 2LFSA 3C3SA 4DR7B 2DLNA 3JRXA 3GIJA 4ZHQF 1LUVA 3AG2B 1VAJA 2QF7A 2P67A 3FAVB 1GLVA 1S5HC 5KFWA 3FYIB 1XNQH 4A3DG 2P7TC 3TY9A 3JYCA 4BY7G 4RO2A 3CCSV 3KG2A 1XMOB 4TUYA 3ZRXA 1WPXA 4X1KA 3ORRA 4IIJF 3EVKA 4FFRA 2QM7A 1K97A 3ABUA 1PX2A 2HVQA 2RGVA 3HKEA 4JI7O 1R3IC 2ZM6H 1COWG 1GO3E 4ECSA 3SJBC 4X20B 3K06A 3ZMZA 1PP9H 4AI8A 4MTGA 1QHTA 4DV3B 4YJ2F 4JAVA 1S5LZ 4JYCA 3UT5B 3PZPA 3JASB 4X8AA 5C4XG 4MTXA 5H6QA 1YZBA 2DYSB 3ETGA 2IW5A 3A2FA 4G28B 3GTPA 4O83A 4B3SH 2QTSA 4DR5O 3T1HH 2YYAA 2XT9A 1N32B 1RJQA 1IZ3A 2QWQB 2FLPA 4FBUA 2YU9A 2UXBO 1I94H 1A32A 3DGEA 3J7AU 2MK3A 4CS2A 4ED3A 1BT8A 3RYHA 4XX0B 1R6KA 4NXMH 2UU9O 1SKVA 4LF5H 2Q6AA 4FIPC 3RYIA 4DR3B 1HR0H 2F23A 1F23A 4GKJO 1Y67A 4NTYA 4X65B 3E83A 1KYOF 4BIZA 5IJ0A 3T5JA 2AZ0A 1NTKH 2YIBD 3WWIA 4O82A 3AK2A 1GO3F 3IC7A 4LF7O 3R65A 4JI3H 3H0GG 4ECXA 2DPJA 1WA8A 2NUAB 2EIKC 2FPPB 1SFOA 3R5XA 5BWUA 4UCOA 3K3PA 3AG1B 4FFKA 1N0NA 2VQFO 1TVKB 2GV9A 2XAGA 5KUMA 4O4JB 5EIBD 2HFEC 4B3MB 4YR2A 3ZHTA 3IJ4A 4FPPA 2R9RB 3OEEG 5K2MA 1YJNV 1K8AW 2QYZA 4RAIA 4HZ3A 1GN4A 2ZDHA 4A3EG 3IAYA 5LMNB 2XTAA 4JGSA 5LHGA 3DTFA 1OBGA 2FPGB 1WRVA 4QIWA 5KFVA 2ASJA 3U0GA 3CCMV 2F43G 2QKAA 2YXYA 2B5UA 2MCTA 1MNGA 1XNQO 3OUZA 3OUUA 2HVJC 2ZJTA 4DUZH 4BBRG 1F7YA 3CCEV 1VQOV 1XREA 2EJ3A 3PFFA 4LC1A 2DYRB 2JVDA 3L73H 1V51A 3HKZA 1OCZB 3BEHA 4KL1A 3E2EA 3CQZA 5DQIA 1ZX3A 1Q5OA 3CCRV 5L1IA 2NR5A 1VBGA 3OEHG 4GCZA 3GB8B 4O4LF 3N41B 5KFFA 1CXZB 2R8JA 5DMXA 3U9SA 3I5DA 2UUAH 4PELA 3D36C 2ZM6O 3MWMA 2JRIA 2QGNA 4O3OA 3MFHA 5KMGA 4DR6H 1KP2A 3H1LH 2WPDG 3DC6A 3GIPA 4KP4A 1OCOC 2UXDB 3L9DA 1P84F 4A5UB 3QWUA 3W7XA 5J2UF 4CMDA 5KT6A 1VP7A 1S97A 4I4TA 4TUYB 2P6JA 4UV8A 4B3SO 1CKNA 3BACA 2R72A 2ILMA 4X1KB 1HWYA 3T1HO 2V4RA 1WP8A 1G2WA 1FXKC 3PR5B 1QBZA 1GMGA 5CBFA 1D5NA 2BQ3A 3HKEB 5EC1C 2RJZA 4IRCA 1U97A 4DV0H 2EINC 5I47A 3THOA 5DN6G 3U0ZA 1I94O 2BTQA 4IT5A 5EYPA 3ICXA 5C8YA 2PN1A 4E4TA 1S0MA 3DSQA 3I55V 3N2GA 3R5FA 3NGDA 5EWGA 2A06H 4NXMO 2JS3A 2GSMB 1I1KA 4LF5O 3QO7A 2YI9A 3APQA 2YZMA 2W8LA 3KTMA 4DYLA 3KAJA 2LGQA 1Q6HA 5EIBC 4ZKIA 5BWWA 2ADQB 2QEXV 3G80A 3DC5A 4DR4H 3H1IH 4AQYB 5DQHA 3R66A 5CMUA 4P9PA 2WLKA 3KALA 1FFTB 4JI3O 2DWCA 3QQMA 3K5NA 4HNAB 3HOWG 3UCSC 4HQ6A 1M56B 1O9HA 2W7PA 4EKWA 4NZNA 3K04A 2IJIA 2R84A 2Y0SA 4X66H 5E79Z 3RYHB 1UNNC 2KG7A 1N4CA 2CW7A 2A0LA 3A8TA 1YI2V 3RYIB 3ZRVA 5JH7A 3RV4A 3B8NA 1VQKV 2R82A 1H8EG 1AI6A 1KKDA 4Q4DA 3CHXA 5IJ0B 2Q7GA 3M9NB 2CUGA 5JJJB 1OCCB 5BWVA 3GTGA 1EM1A 3T5HA 2YZLA 1DF4A 1WA8B 3PW7A 1B06A 2FKLA 3T2MA 5FNVF 4DW0A 1S03G 4YAJB 5H5NA 4YXWG 2YRWA 4DV6B 2C00A 3GTMA 1KEEA 3QG5A 4DUZO 3CX5F 2WAQA 1SZTA 1EHIA 1PK8A 4ED6A 1H2GA 2BCCH 2DE0X 1N32H 2HR3A 3FX7A 2JEJA 1EUDB 4J9PA 1BNCA 3T54A 2JEFA 4IYIA 5B1AB 1H38A 2XGPA 3VQXA 1HNXH 2A3QA 1GAXA 1W0KG 4X64H 2C2DA 2UUAO 1MZEA 2AXTZ 1YEWA 1S5JA
chains in the Genus database with same CATH topology
2UUAB 1WPBA 3QF7A 4DRXA 3RGZA 1L2ZA 5JVDA 1XNQB 5D1OB 3TY8A 1TUBB 3JATA 4EB6A 4BW9A 4K8ZA 3SR2C 3HKCA 3K3VA 1SEIA 1M93A 5LXTB 5DISC 3JALB 4FVMA 1B04A 2F93B 4X1IA 4NXNH 5KMGB 3RFRA 4O4HA 4K0KH 1M4UA 4UCSA 2EX3A 1V9PA 4B3MH 4ZI7A 2UUCB 1XMQH 5KX5A 2OWOA 2E5LH 4X1YA 1WNSA 4O4LB 1FJGH 3N2KB 3N2KA 1IBMH 4I4TB 1CKNB 2ZIOA 2KSWA 4PI2A 1HNZH 5LMNH 2F1MA 2ZIMA 3HKBA 4DV2B 4K8XA 4DV4H 3T1HB 4DR4B 1SA0B 3JARB 1T5EA 2Q7EA 1CKMA 4LFAB 2HVRA 1D5AA 5LP6A 3J7AK 2PYLA 2BTQB 5C8YB 5EYPB 3RJ0A 3FFQA 3HXLA 4YHHB 5CA0A 4JI1B 4TQDA 5CA1B 4AHCA 4DR1H 2ZCEA 3N2GB 1I94B 4LSXA 4UFZA 2XIGA 4GKKB 1FFXA 2P22C 1Q8IA 4X66B 4B3RH 5IWAB 1BGWA 3RTXA 4LF9H 4LF4H 4I55A 4LH7A 4NXMB 4L8JA 5KHHA 2RGRA 5GONB 3VQYA 1M0WA 2HHHH 4TV8B 1WN7A 1MZBA 4MV7A 4DR7H 4FLVA 4I50A 1Z2PX 2VQEH 4DV7B 3DF7A 1L8DA 1HW7A 2F4VB 2HGSA 3ZEDA 5BR8B 3BA8A 1Z2NX 4PI0A 4X20A 2UXDH 1X4TA 1XHXA 1N36B 4RB3C 3L4KA 1N34H 3OTFA 4JI3B 1CKOA 1IBKB 5K1PA 3RGXA 3UT5A 4EEQA 3JASA 4CS3A 2PYJA 1XMOH 4UCRA 2UUBB 5JH7B 3J80W 4CH6A 3U11A 4DK0A 3RYCB 5BMVB 3RIZA 3RYCA 5BMVA 4X62B 4B3TB 4CH4A 4JI7H 4YJ2A 5LA6A 4IHJA 3RYFA 2QM4A 4JI5B 1HNWB 3KAKA 2XHBA 4DR2B 2PZSA 4JI4B 4J0MA 1HNXB 3U10A 4X64B 4BWAA 3KYHC 1ZAUA 5JCOC 4DV3H 4YJ3B 5LMUH 4YJ3A 4RB0A 4D7TA 4DUYB 3B2EE 2YIBA 4I9QA 2YXLA 2VWJA 1I6UA 3HKDA 2O03A 4LMYA 3ZS8C 4JI6H 1JFFB 1JFFA 5EZYA 4DUZB 3W5OA 3BAAA 3K57A 4DR5H 1P8LA 1M5IA 3JAWB 4KHPH 3N42B 5D5PA 5FNVB 4LNUA 1O75A 3GJXB 4CH3A 4FLTA 4PZ7A 5JQGB 3K5LA 1ZHQA 5A2QW 2UXBH 1H2SB 1TA8A 1SQFA 4TQFA 3NBYB 4PZ8A 4NXNB 1IBLB 5IYZA 4UCTA 4DRXB 4DR3H 1TVKA 2UU9H 4K0KB 4RZQA 4DR6B 2RQ6A 3ETQA 2ZINA 2R9AA 4A2AA 4TV9A 1XMQB 4X65H 5JVDB 4GKJH 4UCUA 1FJGB 1S68A 3JATB 4EB6B 3BHPA 1IBMB 2VPSA 3HKCB 4ZIBA 1HNZB 3WB1A 4LF7H 1DGSA 1M0TA 3N43B 4RAZA 5KHIA 4DV4B 4LH6A 3CSXA 4F6RA 4JI2H 4X1IB 1SYXB 5K1XA 4DV0B 3N40P 4DV5B 5FD6A 4O4HB 3VNNA 3C0FB 2CW8A 1XK5A 3BRCA 4ZI7B 4DR1B 2VQFH 2F66C 3RWRD 5KX5B 4Q6GA 4X1YB 4LFCH 2PTMA 4B3RB 3KXYT 4RB2C 4CS4A 4LF4B 4CC6A 5FLXW 4TOIA 4O4IA 5LOVA 3HKBB 5FPRA 3S24A 1J5EB 4ETSA 2PUSA 4DR7B 4IAJA 4DRFA 5LYJA 3RF2A 1KMIZ 5JJNB 1TGOA 5LP6B 4E6NA 4O2BA 2Q0AA 5CA0B 4DV1H 1N34B 4JV5H 1RSOA 1XNQH 1FFXB 4ZOLA 3TY9A 1BJTA 3M7MX 4I55B 5ITZA 1XMOB 2Q2TA 4I7HA 1VS0A 4TUYA 5J2TA 4X1KA 4ZHQA 5D1PA 3W1GA 3LNNA 3CB2A 1ZHSA 3WB0A 3L2PA 2HVQA 2RGVA 4I50B 3HKEA 5EOYA 3LMLA 5KHGA 4OX9H 5CB4A 4UCVA 2WE6A 4GLXA 3E22A 2ZM6H 4RB1A 3SJBC 5J2UA 4M7EA 4X20B 2UUCH 1XDNA 3W1BA 1QHTA 2QJ1A 4DV3B 4IIJA 1A0IA 5LMUB 3UT5B 2HVSA 2F95B 3JASB 2BTOA 3F8NA 1AN7A 4PZ6A 2CAZC 3A2FA 4DV2H 4FLZA 4B3SH 1TAEA 3T1HH 1N32B 1XNRB 4EFEA 5IT9W 4KHPB 1Z5WA 4YJ2B 4YHHH 4JI1H 5LA6B 4IHJB 3RYFB 4EQ5A 3EYYA 3SJAC 4JI8H 2HIVA 1I94H 4MV9A 1X9NA 4GKKH 3QTCA 4CS2A 2UXBB 2WDTA 4EFBA 2V4DA 5IWAH 4YY3H 3JSLA 3RYHA 4NXMH 5FPOA 1SKVA 3HKDB 4LF5H 3RYIA 4WBNA 4DR3B 2YI8A 1HR0H 3TY5A 4APMA 5EZYB 4X65B 3K59A 4FLWA 3JAKA 4AQYH 4DV7H 4GKJB 5IJ0A 2YIBD 4LNUB 3JAMW 3L4JA 3BABA 3K5MA 1N36H 4JI3H 4LFBH 1IBKH 4LF7B 4JI0H 1JMKC 2Q7HA 4UCOA 4O2AA 1E4FT 2UUBH 5IYZB 1VF7A 1TVKB 1I7FA 5IJ9A 2GV9A 1O9GA 4O4JB 3RGBA 5EIBD 3OTOH 2VQFB 4O4JA 4D7SA 4B3MB 4TV9B 4LF8H 1G6UA 4B3TH 2E5LB 4LFCB 2OYQA 4U3JA 2KKWA 2IM9A 1N33H 4NVPA 5LP6C 1WH2A 2WYOA 1JJOA 4DR2H 4JI4H 2E3CA 3IAYA 4PDBA 5LMNB 1Q3EA 3N44B 5KHKA 4FFBA 4LR3A 4JYAH 4LSAA 3SJCC 4DUYH 1Z5VA 5KHJA 4F6RB 4R7RA 4DV6H 3T1YH 4FM1A 2MCTA 4LF6H 2VUGA 4DV1B 4DK1A 2ZJTA 4DUZH 1FKAH 5JCOA 4JV5B 1GYFA 3CVZA 5D1OA 4AILC 1TUBA 4LF9B 2UXCH 2JVDA 3WB2A 4KL1A 4PHZA 4O4IB 5LOVB 1Q5OA 2FE3A 3N41B 3GB8B 2HHHB 5LYJB 2UUAH 5LXTA 3MWMA 3JALA 4CC5A 4MTEA 1IBLH 4OX9B 2VQEB 5KMGA 4O2BB 2ZM6B 4DR6H 3N6XA 2ZNIA 2ZNJA 4FM9A 2UXDB 3BA9A 3QWUA 4ZOLB 4O4LA 5FD5A 5ITZB 3IG0A 4I4TA 4TUYB 5J2TB 1CKNA 2R72A 4X1KB 4ZHQB 3PN1A 1QQCA 4FLYA 4B3SB 1KU9A 3HKEB 2RJZA 1SA0A 3JARA 3VQWA 5CB4B 4DV0H 4GYCB 4DV5H 3THOA 3U0ZA 3E22B 2BTQA 5C8YA 5EYPA 3ICXA 4JI7B 5J2UB 5CA1A 3DSQA 4JI8B 3N2GA 2VWKA 4MTDA 4Q0YA 4IIJB 3MAQA 3VQVA 4YY3B 2YI9A 3NBZB 1SQGA 4CH5A 3M4IA 4LF5B 3H20A 3KAJA 5GONA 5EIBC 1J5EH 1HR0B 3FMAA 4TV8A 3JSNA 4JI6B 1Q43A 4DR4H 2JGUA 1E4GT 4AQYB 4DR5B 4LFAH 2YIAA 2YCHA 1XHZA 2CFMA 3KALA 3K5NA 4HNAB 3K5OA 4HNAA 3RR5A 1O9HA 2W57A 4LFBB 4JI0B 4X66H 3J81W 3RYHB 1XI1A 5JJEB 3UQ8A 4FM0A 4A2BA 2CW7A 2JS5A 3RYIB 4WBNB 1NT2B 5JH7A 2UU9B 3OTOB 4BWSC 2P5OA 2R70A 3JAKB 4LF8B 2PGGA 3GDEA 3CHXA 5IJ0B 2Q7GA 4FLXA 5JJJB 1N33B 3K58A 1FVIA 2F4VH 5BR8H 3BPZA 4FLUA 1Z2OX 4FM2A 4JYAB 1S03G 4O2AB 1P16A 1P49A 2PY5A 4JI2B 2HEPA 4DV6B 4HBNA 4RAYA 1XQ8A 5IJ9B 3T1YB 3QG5A 3NC0B 4LF6B 2VOBA 2Q2UA 3SGIA 1N32H 4X62H 1XNRH 5D5QA 4U3JB 3JAWA 5FNVA 4B08A 1HNWH 2UXCB 4JI5H 3VQXA 1HNXH 5LL6b 4X64H 5JQGA 2HIXA 4FFBB 1YEWA 1S5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 B;  4OX9 B;  2VQE B;  2UUA B;  1ZAU A;  3KYH C;  2ZM6 B;  1XDN A;  3W1B A;  4DUY B;  4DV3 B;  2UXD B;  1A0I A;  5LMU B;  3BA9 A;  2HVS A;  3QWU A;  4PZ6 A;  1XNQ B;  5D1O B;  3TY8 A;  3W5O A;  4DUZ B;  3BAA A;  1TAE A;  1CKN A;  1P8L A;  3PN1 A;  4B3S B;  1N32 B;  1XNR B;  3GJX B;  4EFE A;  4KHP B;  4PZ7 A;  4EQ5 A;  2HIV A;  5DIS C;  4JI7 B;  1B04 A;  1X9N A;  2UXB B;  4JI8 B;  1TA8 A;  4EFB A;  4UCS A;  3JSL A;  4NXN B;  1IBL B;  1V9P A;  3NBY B;  4PZ8 A;  4UCT A;  5FPO A;  2UUC B;  4K0K B;  4DR6 B;  4YY3 B;  2OWO A;  3NBZ B;  4DR3 B;  1XMQ B;  4LF5 B;  3TY5 A;  4UCU A;  4X65 B;  1FJG B;  1CKN B;  1HR0 B;  1S68 A;  1IBM B;  3JSN A;  4JI6 B;  4GKJ B;  4DV2 B;  1HNZ B;  4AQY B;  4DR5 B;  3T1H B;  3BAB A;  1DGS A;  4DR4 B;  2CFM A;  1CKM A;  4LFA B;  2HVR A;  4DV4 B;  4LF7 B;  4LH6 A;  3RR5 A;  4YHH B;  4JI1 B;  4DV0 B;  4LFB B;  4DV5 B;  4JI0 B;  4UCO A;  1I94 B;  3VNN A;  4UFZ A;  4GKK B;  1XK5 A;  3UQ8 A;  4DR1 B;  4X66 B;  5IWA B;  3RTX A;  2VQF B;  4B3M B;  4LH7 A;  4NXM B;  2UU9 B;  4B3R B;  3OTO B;  2E5L B;  4LF4 B;  4LFC B;  4CC6 A;  4TOI A;  4LF8 B;  3GDE A;  5FPR A;  3S24 A;  1J5E B;  1N33 B;  1FVI A;  4DR7 B;  5LMN B;  4DV7 B;  4DRF A;  2F4V B;  5BR8 B;  3BA8 A;  4E6N A;  1N36 B;  4JYA B;  4JI3 B;  1CKO A;  1IBK B;  1P16 A;  1N34 B;  4JI2 B;  4DV6 B;  2VUG A;  4EEQ A;  4DV1 B;  3T1Y B;  3NC0 B;  3TY9 A;  4UCR A;  4JV5 B;  4LF6 B;  2UUB B;  2Q2U A;  3SGI A;  1XMO B;  2Q2T A;  5D1O A;  1VS0 A;  4LF9 B;  5D1P A;  3W1G A;  4X62 B;  4B3T B;  2HVQ A;  2UXC B;  3L2P A;  3GB8 B;  2HHH B;  1HNW B;  4UCV A;  4JI5 B;  2HIX A;  4DR2 B;  4GLX A;  4JI4 B;  1HNX B;  4CC5 A; 
#chains in the Genus database with same CATH topology
 1VF6 A;  2PVP A;  3M8A A;  3K03 A;  4DR6 O;  2PI5 A;  2HJF C;  3GWO A;  1ZTE A;  1IYE A;  1DTO A;  2QSA A;  3RGZ A;  4P2Z A;  3AEI A;  1BHB A;  4ICG A;  3T9C A;  4QWA A;  3J80 N;  4XDJ A;  4JUZ A;  2HGW A;  4F4L A;  1NZ6 A;  2WSS G;  3IFX A;  4O3N A;  1KT8 A;  2WLI A;  4FGR A;  4NTW A;  4JPR A;  4MVQ A;  4PDV A;  1S3J A;  3R23 A;  1K9M W;  3SR2 C;  2HVK C;  1IXM A;  2FMA A;  4B7E A;  4ED8 A;  3L75 H;  4DV0 O;  3TW7 A;  3V6K A;  4IZO A;  3RBZ A;  2IJK A;  5KMG B;  4E4E A;  4ABM A;  2GBO A;  1BHA A;  4K0K H;  4CE5 A;  2RNB A;  5B1B B;  1V9P A;  5C44 G;  2CE4 A;  4B3M H;  2P0A A;  3P3P A;  2IBK A;  1EN5 A;  2M05 A;  2OWO A;  1FYJ A;  2ZDQ A;  4X1Y A;  1N48 A;  2LQT A;  3TET A;  1HP8 A;  3N2K A;  2R92 A;  4IYH A;  3SPG A;  4I4T B;  2XAQ A;  1CKN B;  1OBD A;  4PI2 A;  5DGA A;  5LMN H;  4Q8E A;  1PV0 A;  3HKB A;  2IJJ A;  4UB8 Z;  2PMZ E;  1R9T A;  1KJQ A;  1AB3 A;  4O86 A;  1QLN A;  4D6T H;  2XAF A;  4MSW C;  1CKM A;  4LFA B;  1SZX A;  1D5A A;  5LP6 A;  4WF9 V;  2BTQ B;  5C8Y B;  5EYP B;  1QVF U;  1C30 A;  1Y14 B;  4YHH B;  3HXL A;  4JI1 B;  3B40 A;  1R3L C;  3N2G B;  3RBE A;  3OHA A;  4UFZ A;  5BY1 A;  3P30 A;  4GKK B;  1V55 C;  1FFX A;  2P22 C;  1Q8I A;  1XBL A;  2EJR A;  3T1C A;  4B3R H;  5IWA B;  1Y76 A;  2N04 A;  1BGW A;  3BQ2 A;  1KJI A;  4MW8 A;  1F4N A;  3VQY A;  1M0W A;  3E5N A;  4MV7 A;  1MZB A;  1ULZ A;  2YDE A;  4QJF A;  2OLS A;  4PDL A;  1W2B U;  4MV3 A;  2Y69 C;  2Y0P A;  5BR8 B;  5CBG A;  4NYK A;  5BYB A;  2UXD H;  4K35 A;  4MVO A;  5DGI A;  1CKO A;  3ASO C;  3MHH C;  2EZO A;  2KG7 B;  4GC6 A;  3HB3 B;  4CS3 A;  3E35 A;  5KFM A;  4BY1 G;  4UCR A;  2WLM A;  4J9L A;  2UUB B;  3S3W A;  5JH7 B;  2R8H A;  1N32 O;  2RF4 A;  3J80 W;  2ADP A;  4CH6 A;  5BMV B;  5KFP A;  2X5R A;  4C5C A;  4CH4 A;  4FS1 A;  3WU2 Z;  3A0H Z;  1HNX O;  4X64 O;  3RYF A;  1HNW B;  4JI5 B;  3CCJ V;  3LNM B;  2PZS A;  5IYB O;  3U10 A;  1AR1 B;  3TXS A;  5IDJ A;  5JCO C;  3O65 A;  5LMU H;  4YJ3 A;  1JPX A;  2EIN B;  3H9V A;  3SPI A;  3LQS A;  3RN4 A;  3TIN A;  4DUY B;  2J9G A;  1I3Q A;  4AYB E;  4ECW A;  1R6N A;  3HKD A;  1KD1 W;  2W6I G;  2W6J G;  2EIJ C;  2AGO A;  3EFF K;  4XYM B;  2QKS A;  1JFF B;  3JZI A;  1DV2 A;  5EZY A;  1KKC A;  1VAR A;  4RUE A;  3K57 A;  2EIY A;  4KHP H;  1EZJ A;  5D5P A;  5CM0 A;  2GUZ A;  1SER A;  3T99 A;  3GTQ A;  2NVY A;  3K5L A;  4TSF G;  1PNK A;  1JIH A;  2D3O W;  1I7N A;  4RUC A;  3AG3 B;  1TA8 A;  4WFF A;  3H4D A;  4K0K O;  2BOC C;  3U54 A;  1IBL B;  4B3M O;  2EJ0 A;  2FYU H;  1EUC B;  1BCC H;  3JD1 A;  4J7J A;  3ETQ A;  4W4L A;  1WLE A;  4A2A A;  1XMQ B;  3NR7 A;  2WLI B;  1S68 A;  5LMN O;  5IE9 A;  2C35 B;  4OPH A;  3OR6 C;  2ZE8 A;  4O3P A;  1DGS A;  1M0T A;  3S3X A;  1EYZ A;  5DAA A;  3UZB A;  3DXR A;  1XEQ A;  3CSX A;  1SYX B;  5K1X A;  3LDC A;  3N40 P;  4DV5 B;  4EG0 A;  2Q5Z A;  1VQ5 V;  1QR8 A;  1L0L H;  2Y48 A;  4DR1 B;  2FLN A;  2Q73 A;  4B3R O;  1CP9 A;  3JD4 A;  1IOW A;  1Y1V G;  4X1Y B;  2AZ2 A;  3ZMT A;  1K5S A;  5DGH A;  2YID A;  2RDI A;  5B5E Z;  2WLH A;  4TOI A;  1I2K A;  4O4I A;  4LWS A;  3HKB B;  5FPR A;  2ZDI A;  3JD0 A;  1J5E B;  3SYP A;  1CS0 A;  4IAJ A;  4DRF A;  1IYD A;  3ABK C;  4TUY F;  5JJN B;  3EPG A;  2AHZ A;  5LP6 B;  5B3S B;  4N23 A;  2UXD O;  2ARH A;  3Q2O A;  2DWD C;  5KFA A;  4DV1 H;  1V54 B;  1N34 B;  1RSO A;  1QR9 A;  1W93 A;  1FFX B;  4TM5 A;  4ZOL A;  3GIQ A;  1Y76 B;  3M7M X;  2R7L A;  2YUA A;  4L1K A;  4I7H A;  4C2M A;  3MFI A;  1KUT A;  4DL7 A;  1TWH A;  2ZXW C;  3W1G A;  3LNN A;  2FK2 A;  3U55 A;  5KG0 A;  2JA6 A;  3VOU A;  5EOY A;  3ASN C;  4QJF B;  4GC7 A;  1IUR A;  3GVM A;  4GLX A;  3FKI A;  2ZQM A;  4U6P A;  4RB1 A;  1QLE C;  4M7E A;  2YRX A;  1MA1 A;  1WB8 A;  1AJP A;  2VA2 A;  5LMU O;  5KFS A;  2LFR A;  1S0N A;  2X6A A;  2HVS A;  3ORQ A;  1AN7 A;  3KCY A;  5IYB G;  3X2Q C;  4JZG A;  4FLZ A;  1GM9 A;  4QGP A;  4QIW E;  1TAE A;  4IRK A;  4JF3 A;  4BIO A;  4TT3 G;  4KHP O;  4ME6 A;  5KG5 A;  1QU7 A;  4EFE A;  4FFL A;  5IY5 B;  4YHH H;  4JI1 H;  3RYF B;  4EQ5 A;  3CSW A;  1RJR A;  1X9N A;  4GKK H;  3QTC A;  1AR5 A;  2X6B A;  3HKZ E;  3ETH A;  2V4D A;  5IWA H;  4YY3 H;  4G2K A;  5L3G A;  4MTF A;  2XAH A;  2ASL A;  2QWP B;  5FR9 A;  5L1K A;  3HKD B;  4WBN A;  2XND G;  3CYO A;  4APM A;  5EZY B;  3K59 A;  4JTA B;  3JAK A;  4UXN A;  2SCU B;  3PW4 A;  5F2V O;  3B4S A;  4YR0 A;  2GUZ B;  2BQR A;  3BAB A;  4TV9 F;  3GQC A;  3GTO A;  5HFL A;  1AR4 A;  4DV6 O;  1YJ9 V;  1TWA A;  3N8D A;  3SYC A;  4O2A A;  4GX0 A;  1WCM G;  2UUB H;  2EIM C;  4WCE V;  5IJ9 A;  3LDE A;  4J11 A;  5BXZ A;  3OMI B;  4QIW F;  4O4J A;  4D7S A;  2YL2 A;  4LF8 H;  2E5L B;  4LFC B;  3EPI A;  3HPL C;  4U3J A;  5J9P C;  4P30 A;  2WYO A;  3M9M B;  1NU1 H;  1BZK A;  2R8G A;  3BQ0 A;  3HBL A;  4MVR A;  2C2A A;  5KHK A;  4LSA A;  3DXR B;  4E2L A;  4DUY H;  1Z5V A;  5H6R A;  4C7U A;  4R7R A;  3QVN A;  3J81 N;  4MA0 A;  5LOV F;  2LP7 A;  4FFP A;  4DV1 O;  4FM1 A;  3H40 A;  2LJ2 A;  4A93 G;  1FKA H;  4JV5 B;  1GYF A;  1KBL A;  4O2B F;  2E76 B;  4LF9 B;  3WB2 A;  3JD2 A;  4FU0 A;  1RYR A;  4O4I B;  1M9N A;  4LWS B;  1M57 B;  2W8K A;  2ZGI A;  5LXT A;  1E79 G;  5IYC O;  2E74 B;  1IBL H;  4OX9 B;  2VQE B;  3CP1 A;  4HYO A;  1WAZ A;  3OHB A;  1ORQ C;  2ZNI A;  5KG2 A;  5HV6 A;  2CGO A;  1RSO B;  3FB7 C;  3P32 A;  2HG5 C;  3N6R A;  1DLB A;  3L70 H;  4ZOL B;  1RPO A;  3IG0 A;  2Q7D A;  1VQ6 V;  4CZZ A;  2QM8 A;  2WAM A;  3R9R A;  3AX6 A;  2VPQ A;  2UXN A;  4YHH O;  1ZQ7 A;  4JI1 O;  4DV5 H;  2WAQ E;  1J95 A;  1W0J G;  3MJF A;  4GKK O;  3B77 A;  1FXV A;  4JI8 B;  5IWA O;  4YY3 O;  2VWK A;  4LBE C;  1CQJ B;  3MAQ A;  1VQ4 V;  1ZLZ A;  4FE2 A;  4RNO A;  2X6C A;  1BXR A;  1MZF A;  3ZHS A;  1BQZ A;  1J5E H;  2UVV A;  3JCZ A;  4XDK A;  4A3C G;  4B7K A;  3FMA A;  4TV8 A;  4RQF A;  4TQR A;  3I12 A;  4QPJ A;  3JSN A;  4JI6 B;  3T4Z A;  1ROP A;  1E4G T;  5JH7 F;  2YIA A;  1C3O A;  2YCH A;  1GGO A;  3HOX G;  2H8P C;  5L1J A;  4HNA A;  2I80 A;  1VBH A;  4LFB B;  4JI0 B;  4ECT A;  2B63 G;  5A9G A;  3J81 W;  3PJS K;  2UUB O;  4A2B A;  2JS5 A;  4WBN B;  3HO8 A;  1NT2 B;  4LF8 O;  4EYI B;  5EBL C;  3OTO B;  2P5O A;  3GIM A;  3STZ C;  3JAK B;  3JZF A;  3GII A;  3GDE A;  4JI5 O;  4J9O A;  3D3I A;  2WA3 A;  2CH7 A;  1N33 B;  4QPK A;  1NTM H;  3BPZ A;  5B66 Z;  4C5B A;  4MT8 A;  4DUY O;  1U96 A;  1UC8 A;  4JYA B;  4EGQ A;  2YEV A;  3W7S A;  4O2A B;  1P49 A;  4JI2 B;  4FFO A;  2IU0 A;  4HBN A;  5IJ9 B;  1AIL A;  3T1Y B;  3CRR A;  1FKA O;  4LF6 B;  2VUM A;  4U3J B;  3AG4 B;  3JAW A;  5IYD G;  5C1O A;  1AI7 A;  2UXC B;  1RJP A;  1P7B A;  5LL6 b;  1Y66 A;  2EBO A;  4RUA A;  4RWU A;  2HIX A;  5AG2 A;  1NKD A;  3KHL A;  4GX5 A;  2CZG A;  1IBL O;  2HDK A;  3ETJ A;  5KT3 A;  5KFI A;  3QF7 A;  5JVL A;  5LHH A;  1XMQ O;  2NU6 B;  5L9X A;  4QWB A;  2R7Z G;  4YAK B;  3AW8 A;  2Z3Y A;  1TUE B;  3OGC C;  1JDE A;  1L2Z A;  4IGG A;  3CE2 A;  5IYC G;  4NLG A;  2A79 B;  3ZIA G;  4M0J A;  4OXS A;  1IDS A;  3K9A A;  4C5A A;  3H0G A;  4EB6 A;  2ZE6 A;  4O7Y A;  2COI A;  4J9Z B;  3K3V A;  3CC7 V;  4FMT A;  1WSC A;  1SQQ H;  3QFF A;  2IH3 C;  3B8M A;  5KFJ A;  4DV5 O;  4R50 A;  2HJW A;  4MVZ A;  5LXT B;  3ML0 A;  1XL6 A;  1YSC A;  2WB1 A;  3FYE B;  2F93 B;  2CNU A;  4W4K A;  2GQR A;  1QVG U;  4O4H A;  1JVM A;  1VQM V;  3BY6 A;  4YQW A;  2UUC B;  4ECU A;  5KX5 A;  3PW2 A;  5LP6 F;  2E5L H;  4RQE A;  1WNS A;  4YP3 A;  1H2L A;  1FJG H;  2ATK C;  5CA1 F;  5KT2 A;  1J5E O;  2KSW A;  1I1M A;  3SYO A;  5L3F A;  5CA3 A;  3T9E A;  3MD0 A;  1YDX A;  4K8X A;  1DIK A;  4DV4 H;  1R3K C;  3VOT A;  3K0G A;  1T5E A;  2Q7E A;  2HVR A;  4X89 A;  3JRW A;  2UVR A;  1G4Y B;  3RJ0 A;  1GN6 A;  1N34 O;  1KJ8 A;  5CA0 A;  4BR6 A;  3SDL A;  4AHC A;  3E8G A;  2ZCE A;  4LSX A;  2WWW A;  4NTX A;  5LGT A;  2IP4 A;  4MVS A;  4XDL A;  4EEY A;  3ABM B;  2CTP A;  3MDS A;  3AK1 A;  4WFA V;  1DF5 A;  4P9O A;  2HGX A;  3T7A A;  4LF9 H;  3RTX A;  5KFK A;  4I55 A;  3VPC A;  5LBQ A;  5KHH A;  1YTF B;  1H2K A;  2GTS A;  3TGU H;  3RAQ A;  1RM1 B;  3MWD A;  1QCE A;  4TV8 B;  5KFO A;  4DR7 H;  2JK5 C;  4I50 A;  2VQE H;  2OTJ V;  3ZHR A;  1FXH A;  1HW7 A;  2F4V B;  5EWE A;  1Z2N X;  3CEI A;  4F4Y A;  1YIJ V;  2NU9 B;  3K5I A;  4RB3 C;  3G8D A;  2HJD A;  2EIL C;  1IBK B;  3AG7 A;  3D36 A;  3RGX A;  3PVX A;  1JQ0 A;  4EEQ A;  2AQ4 A;  1XMO H;  1UFI A;  2Q8V A;  3L71 H;  1XL4 A;  3Q1K A;  4O3S A;  2FL4 A;  3KRE A;  3BJY A;  4YJ3 F;  5FJ8 G;  1SQP H;  2GPW A;  4CMF A;  4QE7 A;  5BMV A;  4X62 B;  2W6P A;  3C3T A;  2CH7 B;  4Q8F A;  4YJ2 A;  5LGN A;  5LA6 A;  2A7W A;  4O81 A;  5LL6 Y;  2G38 A;  3Q4H A;  2X7R B;  4YIP A;  1FXK A;  4TWK A;  4DV3 H;  2BOB C;  1RK5 A;  3L74 H;  2GTA A;  2YEV B;  2OCC C;  1FAF A;  1OWT A;  5KA6 A;  2YIB A;  4I9Q A;  3MR6 A;  2Z04 A;  4Y8V B;  2O03 A;  1XOU A;  1S0O A;  2KSD A;  3ZS8 C;  4JI6 H;  1R3J C;  2HP8 A;  1JFF A;  3W5O A;  2HHF A;  3BAA A;  2FJZ A;  4IWX A;  1JCH A;  1M5I A;  3IC9 A;  3JAW B;  2WLJ A;  3E89 A;  3H1H H;  4LNU A;  1O75 A;  4H44 B;  2JGD A;  2R7M A;  1JXL A;  2GPS A;  4PZ7 A;  4YB8 B;  3H4B A;  1H2S B;  4Z1V A;  1Q82 W;  4FFN A;  2FB9 A;  2Y4T A;  4TQF A;  4HNT A;  4NXN B;  5IYZ A;  2EJ2 A;  4DR3 H;  4ECR A;  2W0X A;  3CMA V;  2ZKO A;  2E5L O;  5F9N A;  3H1J H;  1Y74 A;  2ZR3 A;  4DL5 A;  4X65 H;  1FJG O;  2W9A A;  4WFH A;  1NVP D;  2V58 A;  4PJ0 Z;  1IVS A;  1YVW A;  2DOS A;  4EB6 B;  4QSH A;  2COG A;  1IBM B;  3CRC A;  5BZB A;  4IR1 A;  1HNZ B;  1VMG A;  2VA3 A;  4DV4 O;  5KLV H;  2ODM A;  2DAA A;  2W6O A;  4J42 A;  4LH6 A;  4R7C A;  4F6E A;  4F6R A;  1IOV A;  4O4I F;  4JI2 H;  4O4H B;  1Y6X A;  5KUK A;  1XK5 A;  3BRC A;  3ABL C;  1VQ8 V;  2EIK B;  5DQG A;  2F66 C;  3HR0 A;  5KX5 B;  4MV6 A;  4Q6G A;  4LF9 O;  5IP9 G;  2V5A A;  1Y1W A;  4RB2 C;  1NTZ H;  1Q81 W;  4LF4 B;  1CEZ A;  5H2F Z;  4DR7 O;  4EBD A;  1KP3 A;  4ZOL F;  2Z0A A;  4WD3 A;  2PF4 E;  3Q8P B;  1K3E A;  1I7L A;  3S24 A;  4QW8 A;  1FPO A;  1RK6 A;  1F51 A;  2VQE O;  2QA4 V;  5LYJ A;  3RF2 A;  4ED7 A;  3K3W A;  4E6N A;  2ETN A;  5CA0 B;  2A9H A;  4A3L G;  1B6S A;  4XYL B;  3OD4 A;  1XMO O;  3ZJZ A;  3F5T A;  3L72 H;  1BJT A;  4CKB A;  4I55 B;  5ITZ A;  2Q2T A;  2UVU A;  1VS0 A;  3RW0 A;  5J2T A;  1KEC A;  3CB2 A;  3WB0 A;  3L2P A;  4PWQ A;  4I50 B;  1BL8 A;  2Z5U A;  3VPB A;  4KXR A;  3WO1 A;  4J9N A;  1EFR G;  3LML A;  3ZHQ A;  5CB4 A;  1OZ0 A;  4JI8 O;  3WO0 A;  3TQT A;  4A3K G;  3E22 A;  2NN4 A;  4J9R A;  3LP8 A;  3OM3 B;  5J2U A;  3CC2 V;  2JA5 G;  4DV3 O;  2UUC H;  3SI8 A;  3WWJ A;  1OJH A;  1PPJ H;  1ZWI C;  2QDO A;  3W1B A;  2JJ1 G;  1A0I A;  4BBS G;  1NH2 B;  4GZR B;  4DXW A;  3F8N A;  2BTO A;  1VQ9 V;  3U9T A;  4BXX G;  4HR7 A;  2RCV A;  2CAZ C;  4JI6 O;  1M7J A;  1OCO B;  3G8C A;  4NYE A;  1A48 A;  1W96 A;  3Q8Q B;  1XNR B;  4G3I A;  4J10 A;  1Z5W A;  4YJ2 B;  4J7K A;  5LA6 B;  5GTH Z;  4JI0 O;  2HIV A;  1RYS A;  1SQB H;  3Q4H B;  5CR5 A;  2IU3 A;  1FXK B;  4FK5 C;  2GHY A;  2UXB B;  3WG7 C;  4EFB A;  4Q43 A;  4CHI A;  3BVO A;  3CXC U;  1R6T A;  4DR3 O;  5FPO A;  2QR4 A;  5KA5 A;  3H3V H;  3ZMU A;  5KFQ A;  3TJT A;  2YI8 A;  4X65 O;  5KFN A;  3TY5 A;  2R87 A;  5BWR A;  4TQS A;  2HHF B;  4FLW A;  1ARO P;  4AQY H;  4GKJ B;  1Q7Y W;  3VPD A;  2JA8 G;  4O4J F;  4LNU B;  1H2M A;  3Q8R B;  3K5M A;  2JGD B;  1IBK H;  2IH1 C;  4LF7 B;  1JMK C;  5BWT A;  4JI2 O;  5I5X A;  3W7U A;  4F4X A;  3ZBH A;  2Q7H A;  1KB9 F;  1E4F T;  3QO8 A;  2CGN A;  5KFR A;  5IYZ B;  1VF7 A;  1I7F A;  1O9G A;  3F7Y C;  5KFH A;  1Y74 B;  5KFE A;  2VQF B;  4NR1 A;  3HOZ G;  4YR3 A;  5DLF A;  5KFG A;  2IM9 A;  4NVP A;  4A3M G;  3AG2 C;  1N0J A;  1JJO A;  3JZ6 A;  3T9F A;  3TK1 A;  2Q69 A;  5DM6 V;  1YCI A;  3CD6 V;  4PDB A;  4JTC B;  3G67 A;  3G6E V;  1Q3E A;  3MWE A;  4FFB A;  2B9Z A;  1AJQ A;  4MS2 A;  3SJC C;  5KHJ A;  4HAM A;  4F6R B;  4PDR A;  1B6Q A;  4DV6 H;  2VUG A;  3P3N A;  5LXT F;  5JCO A;  2YW2 A;  1WP7 A;  5D1O A;  4AIL C;  1TUB A;  2DQ0 A;  3MR2 A;  4XBF A;  1KBH A;  4UUG A;  1N56 A;  2Q4P A;  4ED0 A;  4PHZ A;  4ZBM A;  3GTJ A;  4FBT A;  2FE3 A;  2VS0 A;  1WR2 A;  3QNE A;  2HHH B;  1S10 A;  4DQN A;  5LYJ B;  4UVA A;  2RMK B;  4XZ3 B;  1YF2 A;  2JA6 G;  1I08 A;  3ZX6 A;  2ZM6 B;  2UUC O;  3N6X A;  2DYS C;  1KC8 W;  2JA7 G;  5B1N A;  3T4D A;  4FM9 A;  1G1X B;  3BA9 A;  2M6Y A;  4MTO A;  3AK3 A;  4GUN A;  1G8M A;  5ITZ B;  1ZL8 A;  2CTQ A;  1S0V A;  5J2T B;  2NU7 B;  1B6R A;  2CQY A;  2JJ2 G;  1OHH G;  3LWB A;  2ATL A;  3CJH A;  3PN1 A;  1QQC A;  5L3B A;  4B3S B;  3OR7 C;  3MR5 A;  3G6Y A;  5EK0 A;  3UO2 A;  3TIG A;  1WB7 A;  2QWO B;  2IJH A;  4PA4 A;  1LNQ A;  1SA0 A;  3JAR A;  3VQW A;  5CB4 B;  4GYC B;  5D8D A;  1YJW V;  3E22 B;  4TV8 F;  2V1D A;  3ZCC A;  1EN6 A;  5J2U B;  2NU8 B;  4H13 B;  3OSP A;  4MTD A;  3V4S A;  1GN2 A;  2J6U A;  1SQG A;  3BCC H;  4F50 A;  4CH5 A;  4LF5 B;  5H80 A;  4FZ1 A;  4JXU A;  3H20 A;  3Q8S B;  5GON A;  1KQS U;  3GIK A;  1HR0 B;  4AQY O;  4PBC A;  3MHS C;  3OAA G;  4O3R A;  2JGU A;  3G4S V;  3PO2 G;  4EBE A;  4LFA H;  4R8C A;  5H9C A;  3AG1 C;  1E4E A;  3K5O A;  4BAY A;  1IBK O;  3F7V C;  2Y4R A;  3CCQ V;  2W57 A;  3SPJ A;  2FKX A;  5KFB A;  1AUV A;  1I50 A;  3QO5 A;  1XI1 A;  4FM0 A;  3G71 V;  2PBZ A;  1ET0 A;  3ZMS A;  3TQ1 A;  4J9S A;  3TXQ A;  4JV0 A;  4UV9 A;  2KQX A;  1SET A;  1V55 B;  2FPI B;  3CC4 V;  4J41 A;  2R8K A;  3SPH A;  1FVI A;  1NR1 A;  4J9M A;  5BR8 H;  5L1L A;  1SES A;  5JUM A;  4FLU A;  2W6N A;  4FM2 A;  2QK4 A;  2YXH A;  4RZR A;  2PMZ A;  4J80 A;  2DYR C;  2HEP A;  1CQI B;  2ABJ A;  2Y69 B;  3ZRW A;  1OCZ C;  3NC0 B;  4HN2 A;  2VOB A;  2Q2U A;  3SGI A;  1PL0 A;  2AGP A;  3ASO B;  1P7G A;  2CNQ A;  1XNR H;  3E8F A;  4H37 A;  2R93 A;  3KHH A;  3AYH B;  4B08 A;  1S9F A;  1HNW H;  3WNZ A;  2KB1 A;  4JI5 H;  4A3B G;  4JV1 A;  3IGA C;  3ETE A;  5JQG A;  2XCA A;  4FFB B;  1JX9 A;  1IX9 A;  2UUA B;  4PA6 A;  3CRM A;  3UYY A;  1WPB A;  4LCU C;  4ED1 A;  2XAS A;  5B1O A;  1HDJ A;  3H1K H;  4DL2 A;  3WWH A;  5JVD A;  5FL7 G;  5D1O B;  3TY8 A;  1TUB B;  1NQT A;  3JAT A;  1LUW A;  2EUL A;  5KKN B;  4BW9 A;  2C2E A;  5KX5 F;  4K8Z A;  3LSS A;  2Y0S E;  2EIJ B;  3HKC A;  1WCM A;  5DG9 A;  2XC9 A;  4ECQ A;  2VRZ A;  1M93 A;  1K33 A;  4I4T F;  5DIS C;  4X1I A;  4DIM A;  1Q6I A;  3RFR A;  2X0L A;  2ZT9 B;  2V9W A;  1M4U A;  1MAB G;  3DTG A;  4O7S A;  3ZRS A;  1AP5 A;  5GTI Z;  4ZI7 A;  2RN9 A;  3GWK C;  5KS8 A;  4A3J G;  4NB5 A;  1XMQ H;  3A0B Z;  1T94 A;  2Y0I A;  5C8Y F;  5CA0 F;  3ZN0 A;  4MV8 A;  1ZL8 B;  4MV1 A;  2ZIO A;  2CK3 G;  2K9P A;  2ZIM A;  3CJH B;  1M56 C;  4DV2 B;  2GLT A;  4AYB A;  1NS1 A;  1CPY A;  2Q68 A;  4I55 F;  4LFA O;  1VQ7 V;  3HT5 A;  1B33 N;  5EWF A;  3RB6 A;  4DR4 B;  1SA0 B;  3JAR B;  2XAJ A;  2Y4U A;  1I2L A;  2PYL A;  1KJ9 A;  2WLN A;  3GIL A;  2HKO A;  4I50 F;  1NBM G;  4FZ0 A;  2OTL V;  4O7T A;  4DR1 H;  3RAX A;  2NVX A;  5HFM A;  1SCU B;  4X66 B;  3OSN A;  1GM7 A;  2P4K A;  4LH7 A;  3UM7 A;  1OCC C;  3ABT A;  3OMN B;  2P90 A;  5GON B;  2RGR A;  1IXB A;  5K3W A;  2HHH H;  4IWY A;  5HBR B;  5KFZ A;  4FLV A;  1I0H A;  1Z2P X;  2LW7 A;  1W59 A;  5BR8 O;  4DV7 B;  4MW3 A;  2IBZ H;  5EC2 C;  1A0G A;  1E4E B;  1T3N A;  4WHX A;  5BMV F;  1X4T A;  1N34 H;  2JDI G;  3ZHU A;  1N36 B;  3OTF A;  2BSK A;  2M7W A;  1K34 A;  3OMA B;  3ABK B;  5K1P A;  5LA6 F;  4O7Z A;  3CCV V;  1GN3 A;  3APO A;  3OGI B;  5B1A C;  4EYH B;  4QE9 A;  2DW4 A;  2YZG A;  3OE7 G;  1BS3 A;  1XNR O;  3RYC B;  3RIZ A;  4OPA A;  1KUQ A;  4ECV A;  2OIG A;  1R1B A;  1JDB B;  4B3T B;  1ZUQ A;  4QNH B;  1NH2 D;  1HNW O;  1T36 A;  3BQ1 A;  3RB4 A;  1B3Q A;  1F4M A;  2VUM G;  4K3A A;  4IHJ A;  3KAK A;  2ZXW B;  3GTK A;  2XHB A;  4DR2 B;  2DMX A;  4JI4 B;  1HNX B;  3JCU Z;  4X64 B;  4BWA A;  3R5H A;  4N21 A;  2R6F A;  1SQX H;  2N05 A;  3ASN B;  5I5T A;  5I5W A;  2BQU A;  4D7T A;  3CWB H;  2XCL A;  2VWJ A;  1TWG A;  5DGB A;  1QLE B;  3ZRW B;  3K5H A;  3OW2 U;  4LMY A;  2OH2 A;  3PO3 G;  1JA8 A;  4J9Q A;  1X59 A;  2QWR B;  4UUJ C;  5IYZ F;  3SYA A;  4I0X A;  2B63 A;  3T9A A;  5KFY A;  3GJX B;  4PA3 A;  3X2Q B;  4CH3 A;  5C93 A;  4FLT A;  5B1B C;  5JQG B;  1JX4 A;  5CAE B;  2COJ A;  2R9I A;  3MR3 A;  2ASD A;  3T5L A;  1SF9 A;  3VBB A;  2HLD G;  4K0K B;  4LP8 A;  4RZQ A;  3UFX B;  2R9A A;  4TV9 A;  5JVD B;  5HNE A;  3SNO A;  4O7V A;  3ETD A;  2FTK A;  3JAT B;  3WFV A;  3DTU B;  5IT9 N;  1ZET A;  2VPS A;  3HKC B;  4ZIB A;  3WB1 A;  2W6Q A;  5KT5 A;  3NUA A;  5KHI A;  3B09 A;  1K4D C;  5KG3 A;  4X1I B;  4DR1 O;  1GSO A;  4F4Z A;  2JEU A;  3VNN A;  4U7O A;  2E2H A;  2CW8 A;  2C28 A;  5LYJ F;  3K08 A;  4ZI7 B;  4JYB A;  3RWR D;  4JYY A;  5I5U A;  3VA7 A;  1URF A;  1CE8 A;  4Q44 A;  4HNV A;  4LFC H;  4QWC A;  2R8I A;  4B3R B;  3KXY T;  4CS4 A;  4MA5 A;  4CC6 A;  2EIM B;  4R8U A;  4F4W A;  1SS3 A;  3CPW U;  2HHH O;  3JAM N;  3BG5 A;  1P4R A;  1S72 V;  5LOV A;  4FS2 A;  3LDD A;  4ETS A;  1Q6U A;  5BYA A;  2PUS A;  5KAF Z;  5KAI Z;  5I5Y A;  1KMI Z;  1VQL V;  5J2T F;  2R7Z A;  1TGO A;  3OUS A;  1BSM A;  1BGY H;  4O2B A;  4NZO A;  2Q0A A;  4Q45 A;  3V4Z A;  3M9O B;  4M9U A;  4JV5 H;  5CB4 F;  3BFR A;  3F5W C;  5C1P A;  3HOV G;  3TCU A;  3GB7 C;  3RVY A;  4O84 A;  5FLM G;  2FML A;  2DN9 A;  2QE7 G;  4ZHQ A;  5D1P A;  4A3G G;  1M1K W;  1ZHS A;  1A9X A;  4ED2 A;  5KHG A;  4OX9 H;  4UCV A;  2WE6 A;  2W9B A;  4WFG A;  2XGQ A;  1JLL B;  1S76 D;  5EBW C;  1XDN A;  2BSK B;  3LSU A;  4MVM A;  5KFD A;  2QJ1 A;  2WLL A;  4IIJ A;  1BE3 H;  1ENV A;  5LMU B;  4O3Q A;  4A3F G;  4GX1 A;  2I8C A;  5KT4 A;  4U7C A;  2F95 B;  1GH6 A;  3V6H A;  1WJZ A;  4PZ6 A;  1HR0 O;  4H0L B;  3FD9 A;  4DV2 H;  1N8R W;  1V4Y A;  1XDC A;  4DAA A;  1VF6 C;  2YIC A;  2LW1 A;  3AG3 C;  4DO2 A;  5IT9 W;  4KHP B;  1AI4 A;  4IHJ B;  4DLK A;  4X88 A;  5CBH A;  3EYY A;  3SJA C;  4JI8 H;  5EZY F;  3D8C A;  4J9K A;  2BR0 A;  4MV9 A;  2CTW A;  1M6V A;  2WDT A;  5C5J A;  3N27 A;  3RVZ A;  3FB8 C;  3JSL A;  1EKV A;  2R85 A;  4U7N A;  4GX2 A;  1AI5 A;  5L3C A;  2AHY A;  5IP7 G;  1AP6 A;  4MVU A;  3CME V;  3FB6 C;  1AJN A;  4QWE A;  2E75 B;  1K1Q A;  5KG6 A;  4DV7 H;  4EGJ A;  4I0X B;  3JAM W;  3L4J A;  3SE7 A;  2N74 A;  4PA7 A;  1THZ A;  2OCH A;  1N36 H;  2MW2 B;  4DW1 A;  4LFB H;  3ZN1 A;  4JI0 H;  1OCR C;  3D3Q A;  2W70 A;  3GID A;  1FS0 G;  2BE3 A;  2YWV A;  3A0R A;  3RGB A;  3OTO H;  4LFC O;  3T9B A;  4TV9 B;  1G6U A;  4B3T H;  2OYQ A;  3UZO A;  4HNU A;  1I5X A;  2KKW A;  1N33 H;  3OT7 A;  1E1Q G;  5LP6 C;  2R7N A;  5B3S C;  1WH2 A;  2FK3 A;  4DR2 H;  5BWX A;  1L1F A;  4JI4 H;  1GSA A;  2YS7 A;  2E3C A;  4PDM A;  2B1G A;  1Y1W G;  2UVW A;  2R92 G;  1V54 C;  3N44 B;  4LR3 A;  4JYA H;  1US6 A;  3CXH F;  4JAA A;  2O57 A;  3HB9 A;  3STL C;  2QTO A;  3T1Y H;  1H8H G;  1RFY A;  4JV5 O;  4LF6 H;  4RNN A;  2CTR A;  1MOF A;  5F9L A;  4DV1 B;  4DK1 A;  1ZSP A;  2FB5 A;  3FB5 C;  3SJQ C;  1JJ2 U;  2IMW P;  4ASU G;  2YSU B;  3RFC A;  3CVZ A;  1OV9 A;  5TIS Z;  1K1S A;  5CE8 A;  2UXC H;  4R8U B;  3OUF A;  5LOV B;  1VF5 B;  2OT5 A;  2HG8 A;  2JEX A;  3CRA A;  3NXS A;  2B1I A;  2GDS A;  4OX9 O;  1TWF A;  1H2N A;  2R7K A;  2C22 A;  1DV1 A;  3JAL A;  4CC5 A;  4MTE A;  3VMM A;  4NKG B;  2Q0O C;  4O2B B;  2FK1 A;  3E8B A;  2ALZ A;  5KFX A;  2GQS A;  2RDJ A;  2ZNJ A;  2DPI A;  4CKE A;  5DG7 A;  4RCN A;  3IN5 A;  3PW0 A;  4O4L A;  5FD5 A;  4JV2 A;  3HOY G;  5CN0 A;  4DV2 O;  5IY5 C;  4CKC A;  4ZHQ B;  4DR4 O;  1GTO A;  4FLY A;  4RUF A;  1KU9 A;  5KFL A;  5GON F;  3V6J A;  2W9B B;  3CCL V;  1UPG A;  4JI7 B;  1TWC A;  5CA1 A;  2L6L A;  2QKC A;  5JWP A;  2VR1 A;  4GT1 A;  4KUM A;  2W6M A;  4G27 B;  4X66 O;  2I87 A;  4UVC A;  2ODT X;  2WLL B;  4Q0Y A;  3CCU V;  4IIJ B;  4DL3 A;  3I4M G;  3VQV A;  2P4V A;  4YY3 B;  2AGA A;  3NBZ B;  3LUL A;  5KFT A;  3M4I A;  3RBD A;  3PR4 A;  2W0F C;  4KFM A;  4YIO A;  5L3E A;  4DV7 O;  1Q43 A;  2J6S A;  2DWE C;  3K0D A;  4WBN F;  2RDC A;  2R86 A;  4RU9 A;  4DR5 B;  3QZ8 A;  2V4Q A;  1XHZ A;  1N36 O;  2CFM A;  1QNM A;  4OGQ B;  4LFB O;  3RR5 A;  3DAA A;  3E8H A;  4FFM A;  2QB5 A;  1K7D A;  2AGQ A;  5JJE B;  3UQ8 A;  3SYQ A;  1MSD A;  4ECZ A;  3OTO O;  1NR7 A;  1PNL A;  1VQP V;  2L35 A;  2UU9 B;  1GKF A;  3EHB B;  4B3T O;  3C90 A;  4CBC A;  3RUP A;  4BWS C;  3K79 A;  1GRJ A;  1EKP A;  4O2A F;  2R70 A;  4LF8 B;  2QWN B;  1N33 O;  1VQN V;  2PI4 A;  2PGG A;  3TW6 A;  4DL4 A;  3E86 A;  5BPF A;  3HOU G;  2JA5 A;  4DR2 O;  4FLX A;  4JI4 O;  5I60 A;  3K58 A;  2DAB A;  2F4V H;  3GV8 B;  4J7Z A;  2ITC C;  5E25 A;  2W9C A;  1XIL A;  4JYA O;  4ZQI A;  1NJI W;  2ITD C;  1Z2O X;  2Z02 A;  5DED A;  2K1E A;  3JD3 A;  3T1Y O;  1P16 A;  5JQG F;  2PY5 A;  4LF6 O;  4RAY A;  1XQ8 A;  5LGU A;  3I56 V;  1KC7 A;  1VKZ A;  1M57 C;  2ZDI C;  2V59 A;  5KG7 A;  2EIL B;  2ZDG A;  2FP4 B;  2LGW A;  4X62 H;  2EZP A;  3TII A;  5D5Q A;  2UXC O;  2W7O A;  1JOY A;  2XD4 A;  5E1A C;  5FNV A;  3W7T A;  5JVD F;  1K73 W;  1EZV H;  2DQ3 A;  4K6N A;  3KCX A;  2WTF A;  3T5K A;  3OFN G;  1YHQ V;  2H3O A;  1YIT V;  4DRX A;  1SQV H;  3KZI Z;  3K9S A;  3LSQ A;  3KHG A;  1PNM A;  3PW5 A;  4JAS A;  1XNQ B;  2OCC B;  3G6V A;  3RB0 A;  1EKF A;  3M99 B;  1LR1 A;  4ZI7 F;  2CNV A;  4JZ2 A;  5DG8 A;  1K83 A;  3SPC A;  4UB6 Z;  2DJV A;  1SEI A;  2IA6 A;  3JAL B;  4FVM A;  1B04 A;  1A3G A;  4NXN H;  1YXB A;  5EBM C;  4UCS A;  2EX3 A;  4Z1M G;  1K92 A;  2H94 A;  1OCR B;  3FKI G;  5KG1 A;  2EJ7 A;  4JTD B;  1SRY A;  2CKZ B;  4O4L B;  2V7Q G;  3H01 A;  3N2K B;  4PD4 F;  2LO1 A;  1IBM H;  4U3F H;  4WFB V;  1GSH A;  1MSW D;  2NLJ C;  5T14 A;  1HNZ H;  4DL6 A;  4A3I G;  2F1M A;  4EBC A;  5A2Q N;  3T1H B;  2WA4 A;  3G6X A;  5DEC A;  4L87 A;  3J7A K;  1I1L A;  1Y1V A;  3FFQ A;  2A1H A;  5CA1 B;  3FAV A;  1GM8 A;  4TQD A;  2W71 A;  1I94 B;  3ZMV A;  5I5V A;  2XIG A;  3UKM A;  2XCP A;  4YBZ B;  4ECY A;  2J6T A;  4LF4 H;  5KT7 A;  4NXM B;  1BQ0 A;  3CEB A;  4L8J A;  3TEK A;  3ABL B;  4PA9 A;  1WN7 A;  4FJC C;  1JR9 A;  2JA7 A;  4R6Z A;  2F4V O;  1AUX A;  1R73 A;  1K5Q A;  3DF7 A;  1L8D A;  2D2C B;  1KJJ A;  1L0N H;  3ZED A;  3BA8 A;  2HGS A;  1RP3 B;  4PI0 A;  3G6B A;  4X20 A;  1XHX A;  1YTF D;  3L4K A;  3RB3 A;  2AU0 A;  4JI3 B;  3FDS A;  2YS8 A;  1FD9 A;  4O7R A;  2W6Z A;  4IHJ F;  3UT5 A;  3JAS A;  2PYJ A;  3AG4 C;  3RV3 A;  4WFE A;  2P06 A;  4O7L A;  5FLX N;  1S77 D;  5KFU A;  4X62 O;  4BW5 A;  4O7N A;  2WB1 E;  3U11 A;  4DK0 A;  3RYC A;  2JEG A;  4PV1 B;  3I4N G;  1EBO A;  2FLL A;  4JI7 H;  5EDW A;  1VEW A;  4JAU A;  4J0M A;  2QM4 A;  4I7Z B;  2W9C B;  2R93 G;  1DK1 A;  1DAA A;  3KYH C;  1ZAU A;  5DLG A;  2C2R A;  4YJ3 B;  2Q9L A;  1D2D A;  4RB0 A;  2DZD A;  3QZ7 A;  3GTL A;  1Z2G A;  3B2E E;  1MG1 A;  2YXL A;  2AW9 A;  3CRQ A;  1I6U A;  3O9O A;  3EXA A;  1Q86 W;  1EN4 A;  5L3D A;  3FKS G;  4UVB A;  1PKX A;  3RT3 C;  1PD3 A;  5LHI A;  1UC9 A;  4Q4C A;  1PL4 A;  2E2I A;  4DUZ B;  4DR5 H;  1P8L A;  3GLK A;  4QW9 A;  2ZR2 A;  5I5S A;  1XUQ A;  3GV5 B;  3N42 B;  1GK9 A;  5FNV B;  1I5Y A;  2YS6 A;  4IL6 Z;  1Q90 D;  1ZHQ A;  1RPR A;  5A2Q W;  2UXB H;  2ZD9 A;  1NVP B;  5KG4 A;  4H33 A;  2XOK G;  4MV4 A;  4NXN O;  1SQF A;  2CDY A;  3NBY B;  4PZ8 A;  1Y4M A;  2Q67 A;  4UCT A;  4DRX B;  2JEI A;  1TVK A;  4Z2W A;  2UU9 H;  3ZHV A;  4DR6 B;  2RQ6 A;  1JKJ B;  2ZIN A;  3T9D A;  2X0S A;  3WG7 B;  1EZ1 A;  1PM9 A;  1E1R G;  2OIE A;  2ZE7 A;  4IRD A;  5JQW A;  4X9Q A;  1M90 W;  1IBM O;  2DIK A;  1VIB A;  2YZN A;  4UCU A;  4O4H F;  1FJG B;  4GKJ H;  1HNZ O;  1BMF G;  2NNU A;  4O7W A;  3BHP A;  5KFC A;  2JIZ G;  1SC5 B;  4NZM A;  5C3E G;  1MMM A;  4LF7 H;  4GLW A;  3GV7 B;  2VQD A;  4MAM A;  3N43 B;  3ABM C;  4RAZ A;  3LUT B;  4DV4 B;  4HYK A;  4IR9 A;  3KKY A;  4DV0 B;  3CS5 A;  1AVM A;  2UXX A;  5FD6 A;  4Q20 A;  5IYD O;  1UJW B;  4I9W A;  3C0F B;  5GW7 A;  4J9Y B;  2ZE5 A;  3W7W A;  2VQF H;  1RM1 C;  2XUM A;  4TVI A;  1K4C C;  3KHR A;  4I5S A;  4LF4 O;  1KTA A;  4QWD A;  2YC0 A;  3UO3 A;  2PTM A;  5FLX W;  1NI8 A;  4BIU A;  5BPH A;  4RNM A;  2LFS A;  3C3S A;  4DR7 B;  2DLN A;  3JRX A;  3GIJ A;  4ZHQ F;  1LUV A;  3AG2 B;  1VAJ A;  2QF7 A;  2P67 A;  3FAV B;  1GLV A;  1S5H C;  5KFW A;  3FYI B;  1XNQ H;  4A3D G;  2P7T C;  3TY9 A;  3JYC A;  4BY7 G;  4RO2 A;  3CCS V;  3KG2 A;  1XMO B;  4TUY A;  3ZRX A;  1WPX A;  4X1K A;  3ORR A;  4IIJ F;  3EVK A;  4FFR A;  2QM7 A;  1K97 A;  3ABU A;  1PX2 A;  2HVQ A;  2RGV A;  3HKE A;  4JI7 O;  1R3I C;  2ZM6 H;  1COW G;  1GO3 E;  4ECS A;  3SJB C;  4X20 B;  3K06 A;  3ZMZ A;  1PP9 H;  4AI8 A;  4MTG A;  1QHT A;  4DV3 B;  4YJ2 F;  4JAV A;  1S5L Z;  4JYC A;  3UT5 B;  3PZP A;  3JAS B;  4X8A A;  5C4X G;  4MTX A;  5H6Q A;  1YZB A;  2DYS B;  3ETG A;  2IW5 A;  3A2F A;  4G28 B;  3GTP A;  4O83 A;  4B3S H;  2QTS A;  4DR5 O;  3T1H H;  2YYA A;  2XT9 A;  1N32 B;  1RJQ A;  1IZ3 A;  2QWQ B;  2FLP A;  4FBU A;  2YU9 A;  2UXB O;  1I94 H;  1A32 A;  3DGE A;  3J7A U;  2MK3 A;  4CS2 A;  4ED3 A;  1BT8 A;  3RYH A;  4XX0 B;  1R6K A;  4NXM H;  2UU9 O;  1SKV A;  4LF5 H;  2Q6A A;  4FIP C;  3RYI A;  4DR3 B;  1HR0 H;  2F23 A;  1F23 A;  4GKJ O;  1Y67 A;  4NTY A;  4X65 B;  3E83 A;  1KYO F;  4BIZ A;  5IJ0 A;  3T5J A;  2AZ0 A;  1NTK H;  2YIB D;  3WWI A;  4O82 A;  3AK2 A;  1GO3 F;  3IC7 A;  4LF7 O;  3R65 A;  4JI3 H;  3H0G G;  4ECX A;  2DPJ A;  1WA8 A;  2NUA B;  2EIK C;  2FPP B;  1SFO A;  3R5X A;  5BWU A;  4UCO A;  3K3P A;  3AG1 B;  4FFK A;  1N0N A;  2VQF O;  1TVK B;  2GV9 A;  2XAG A;  5KUM A;  4O4J B;  5EIB D;  2HFE C;  4B3M B;  4YR2 A;  3ZHT A;  3IJ4 A;  4FPP A;  2R9R B;  3OEE G;  5K2M A;  1YJN V;  1K8A W;  2QYZ A;  4RAI A;  4HZ3 A;  1GN4 A;  2ZDH A;  4A3E G;  3IAY A;  5LMN B;  2XTA A;  4JGS A;  5LHG A;  3DTF A;  1OBG A;  2FPG B;  1WRV A;  4QIW A;  5KFV A;  2ASJ A;  3U0G A;  3CCM V;  2F43 G;  2QKA A;  2YXY A;  2B5U A;  2MCT A;  1MNG A;  1XNQ O;  3OUZ A;  3OUU A;  2HVJ C;  2ZJT A;  4DUZ H;  4BBR G;  1F7Y A;  3CCE V;  1VQO V;  1XRE A;  2EJ3 A;  3PFF A;  4LC1 A;  2DYR B;  2JVD A;  3L73 H;  1V51 A;  3HKZ A;  1OCZ B;  3BEH A;  4KL1 A;  3E2E A;  3CQZ A;  5DQI A;  1ZX3 A;  1Q5O A;  3CCR V;  5L1I A;  2NR5 A;  1VBG A;  3OEH G;  4GCZ A;  3GB8 B;  4O4L F;  3N41 B;  5KFF A;  1CXZ B;  2R8J A;  5DMX A;  3U9S A;  3I5D A;  2UUA H;  4PEL A;  3D36 C;  2ZM6 O;  3MWM A;  2JRI A;  2QGN A;  4O3O A;  3MFH A;  5KMG A;  4DR6 H;  1KP2 A;  3H1L H;  2WPD G;  3DC6 A;  3GIP A;  4KP4 A;  1OCO C;  2UXD B;  3L9D A;  1P84 F;  4A5U B;  3QWU A;  3W7X A;  5J2U F;  4CMD A;  5KT6 A;  1VP7 A;  1S97 A;  4I4T A;  4TUY B;  2P6J A;  4UV8 A;  4B3S O;  1CKN A;  3BAC A;  2R72 A;  2ILM A;  4X1K B;  1HWY A;  3T1H O;  2V4R A;  1WP8 A;  1G2W A;  1FXK C;  3PR5 B;  1QBZ A;  1GMG A;  5CBF A;  1D5N A;  2BQ3 A;  3HKE B;  5EC1 C;  2RJZ A;  4IRC A;  1U97 A;  4DV0 H;  2EIN C;  5I47 A;  3THO A;  5DN6 G;  3U0Z A;  1I94 O;  2BTQ A;  4IT5 A;  5EYP A;  3ICX A;  5C8Y A;  2PN1 A;  4E4T A;  1S0M A;  3DSQ A;  3I55 V;  3N2G A;  3R5F A;  3NGD A;  5EWG A;  2A06 H;  4NXM O;  2JS3 A;  2GSM B;  1I1K A;  4LF5 O;  3QO7 A;  2YI9 A;  3APQ A;  2YZM A;  2W8L A;  3KTM A;  4DYL A;  3KAJ A;  2LGQ A;  1Q6H A;  5EIB C;  4ZKI A;  5BWW A;  2ADQ B;  2QEX V;  3G80 A;  3DC5 A;  4DR4 H;  3H1I H;  4AQY B;  5DQH A;  3R66 A;  5CMU A;  4P9P A;  2WLK A;  3KAL A;  1FFT B;  4JI3 O;  2DWC A;  3QQM A;  3K5N A;  4HNA B;  3HOW G;  3UCS C;  4HQ6 A;  1M56 B;  1O9H A;  2W7P A;  4EKW A;  4NZN A;  3K04 A;  2IJI A;  2R84 A;  2Y0S A;  4X66 H;  5E79 Z;  3RYH B;  1UNN C;  2KG7 A;  1N4C A;  2CW7 A;  2A0L A;  3A8T A;  1YI2 V;  3RYI B;  3ZRV A;  5JH7 A;  3RV4 A;  3B8N A;  1VQK V;  2R82 A;  1H8E G;  1AI6 A;  1KKD A;  4Q4D A;  3CHX A;  5IJ0 B;  2Q7G A;  3M9N B;  2CUG A;  5JJJ B;  1OCC B;  5BWV A;  3GTG A;  1EM1 A;  3T5H A;  2YZL A;  1DF4 A;  1WA8 B;  3PW7 A;  1B06 A;  2FKL A;  3T2M A;  5FNV F;  4DW0 A;  1S03 G;  4YAJ B;  5H5N A;  4YXW G;  2YRW A;  4DV6 B;  2C00 A;  3GTM A;  1KEE A;  3QG5 A;  4DUZ O;  3CX5 F;  2WAQ A;  1SZT A;  1EHI A;  1PK8 A;  4ED6 A;  1H2G A;  2BCC H;  2DE0 X;  1N32 H;  2HR3 A;  3FX7 A;  2JEJ A;  1EUD B;  4J9P A;  1BNC A;  3T54 A;  2JEF A;  4IYI A;  5B1A B;  1H38 A;  2XGP A;  3VQX A;  1HNX H;  2A3Q A;  1GAX A;  1W0K G;  4X64 H;  2C2D A;  2UUA O;  1MZE A;  2AXT Z;  1YEW A;  1S5J A; 
#chains in the Genus database with same CATH homology
 2UUA B;  1WPB A;  3QF7 A;  4DRX A;  3RGZ A;  1L2Z A;  5JVD A;  1XNQ B;  5D1O B;  3TY8 A;  1TUB B;  3JAT A;  4EB6 A;  4BW9 A;  4K8Z A;  3SR2 C;  3HKC A;  3K3V A;  1SEI A;  1M93 A;  5LXT B;  5DIS C;  3JAL B;  4FVM A;  1B04 A;  2F93 B;  4X1I A;  4NXN H;  5KMG B;  3RFR A;  4O4H A;  4K0K H;  1M4U A;  4UCS A;  2EX3 A;  1V9P A;  4B3M H;  4ZI7 A;  2UUC B;  1XMQ H;  5KX5 A;  2OWO A;  2E5L H;  4X1Y A;  1WNS A;  4O4L B;  1FJG H;  3N2K B;  3N2K A;  1IBM H;  4I4T B;  1CKN B;  2ZIO A;  2KSW A;  4PI2 A;  1HNZ H;  5LMN H;  2F1M A;  2ZIM A;  3HKB A;  4DV2 B;  4K8X A;  4DV4 H;  3T1H B;  4DR4 B;  1SA0 B;  3JAR B;  1T5E A;  2Q7E A;  1CKM A;  4LFA B;  2HVR A;  1D5A A;  5LP6 A;  3J7A K;  2PYL A;  2BTQ B;  5C8Y B;  5EYP B;  3RJ0 A;  3FFQ A;  3HXL A;  4YHH B;  5CA0 A;  4JI1 B;  4TQD A;  5CA1 B;  4AHC A;  4DR1 H;  2ZCE A;  3N2G B;  1I94 B;  4LSX A;  4UFZ A;  2XIG A;  4GKK B;  1FFX A;  2P22 C;  1Q8I A;  4X66 B;  4B3R H;  5IWA B;  1BGW A;  3RTX A;  4LF9 H;  4LF4 H;  4I55 A;  4LH7 A;  4NXM B;  4L8J A;  5KHH A;  2RGR A;  5GON B;  3VQY A;  1M0W A;  2HHH H;  4TV8 B;  1WN7 A;  1MZB A;  4MV7 A;  4DR7 H;  4FLV A;  4I50 A;  1Z2P X;  2VQE H;  4DV7 B;  3DF7 A;  1L8D A;  1HW7 A;  2F4V B;  2HGS A;  3ZED A;  5BR8 B;  3BA8 A;  1Z2N X;  4PI0 A;  4X20 A;  2UXD H;  1X4T A;  1XHX A;  1N36 B;  4RB3 C;  3L4K A;  1N34 H;  3OTF A;  4JI3 B;  1CKO A;  1IBK B;  5K1P A;  3RGX A;  3UT5 A;  4EEQ A;  3JAS A;  4CS3 A;  2PYJ A;  1XMO H;  4UCR A;  2UUB B;  5JH7 B;  3J80 W;  4CH6 A;  3U11 A;  4DK0 A;  3RYC B;  5BMV B;  3RIZ A;  3RYC A;  5BMV A;  4X62 B;  4B3T B;  4CH4 A;  4JI7 H;  4YJ2 A;  5LA6 A;  4IHJ A;  3RYF A;  2QM4 A;  4JI5 B;  1HNW B;  3KAK A;  2XHB A;  4DR2 B;  2PZS A;  4JI4 B;  4J0M A;  1HNX B;  3U10 A;  4X64 B;  4BWA A;  3KYH C;  1ZAU A;  5JCO C;  4DV3 H;  4YJ3 B;  5LMU H;  4YJ3 A;  4RB0 A;  4D7T A;  4DUY B;  3B2E E;  2YIB A;  4I9Q A;  2YXL A;  2VWJ A;  1I6U A;  3HKD A;  2O03 A;  4LMY A;  3ZS8 C;  4JI6 H;  1JFF B;  1JFF A;  5EZY A;  4DUZ B;  3W5O A;  3BAA A;  3K57 A;  4DR5 H;  1P8L A;  1M5I A;  3JAW B;  4KHP H;  3N42 B;  5D5P A;  5FNV B;  4LNU A;  1O75 A;  3GJX B;  4CH3 A;  4FLT A;  4PZ7 A;  5JQG B;  3K5L A;  1ZHQ A;  5A2Q W;  2UXB H;  1H2S B;  1TA8 A;  1SQF A;  4TQF A;  3NBY B;  4PZ8 A;  4NXN B;  1IBL B;  5IYZ A;  4UCT A;  4DRX B;  4DR3 H;  1TVK A;  2UU9 H;  4K0K B;  4RZQ A;  4DR6 B;  2RQ6 A;  3ETQ A;  2ZIN A;  2R9A A;  4A2A A;  4TV9 A;  1XMQ B;  4X65 H;  5JVD B;  4GKJ H;  4UCU A;  1FJG B;  1S68 A;  3JAT B;  4EB6 B;  3BHP A;  1IBM B;  2VPS A;  3HKC B;  4ZIB A;  1HNZ B;  3WB1 A;  4LF7 H;  1DGS A;  1M0T A;  3N43 B;  4RAZ A;  5KHI A;  4DV4 B;  4LH6 A;  3CSX A;  4F6R A;  4JI2 H;  4X1I B;  1SYX B;  5K1X A;  4DV0 B;  3N40 P;  4DV5 B;  5FD6 A;  4O4H B;  3VNN A;  3C0F B;  2CW8 A;  1XK5 A;  3BRC A;  4ZI7 B;  4DR1 B;  2VQF H;  2F66 C;  3RWR D;  5KX5 B;  4Q6G A;  4X1Y B;  4LFC H;  2PTM A;  4B3R B;  3KXY T;  4RB2 C;  4CS4 A;  4LF4 B;  4CC6 A;  5FLX W;  4TOI A;  4O4I A;  5LOV A;  3HKB B;  5FPR A;  3S24 A;  1J5E B;  4ETS A;  2PUS A;  4DR7 B;  4IAJ A;  4DRF A;  5LYJ A;  3RF2 A;  1KMI Z;  5JJN B;  1TGO A;  5LP6 B;  4E6N A;  4O2B A;  2Q0A A;  5CA0 B;  4DV1 H;  1N34 B;  4JV5 H;  1RSO A;  1XNQ H;  1FFX B;  4ZOL A;  3TY9 A;  1BJT A;  3M7M X;  4I55 B;  5ITZ A;  1XMO B;  2Q2T A;  4I7H A;  1VS0 A;  4TUY A;  5J2T A;  4X1K A;  4ZHQ A;  5D1P A;  3W1G A;  3LNN A;  3CB2 A;  1ZHS A;  3WB0 A;  3L2P A;  2HVQ A;  2RGV A;  4I50 B;  3HKE A;  5EOY A;  3LML A;  5KHG A;  4OX9 H;  5CB4 A;  4UCV A;  2WE6 A;  4GLX A;  3E22 A;  2ZM6 H;  4RB1 A;  3SJB C;  5J2U A;  4M7E A;  4X20 B;  2UUC H;  1XDN A;  3W1B A;  1QHT A;  2QJ1 A;  4DV3 B;  4IIJ A;  1A0I A;  5LMU B;  3UT5 B;  2HVS A;  2F95 B;  3JAS B;  2BTO A;  3F8N A;  1AN7 A;  4PZ6 A;  2CAZ C;  3A2F A;  4DV2 H;  4FLZ A;  4B3S H;  1TAE A;  3T1H H;  1N32 B;  1XNR B;  4EFE A;  5IT9 W;  4KHP B;  1Z5W A;  4YJ2 B;  4YHH H;  4JI1 H;  5LA6 B;  4IHJ B;  3RYF B;  4EQ5 A;  3EYY A;  3SJA C;  4JI8 H;  2HIV A;  1I94 H;  4MV9 A;  1X9N A;  4GKK H;  3QTC A;  4CS2 A;  2UXB B;  2WDT A;  4EFB A;  2V4D A;  5IWA H;  4YY3 H;  3JSL A;  3RYH A;  4NXM H;  5FPO A;  1SKV A;  3HKD B;  4LF5 H;  3RYI A;  4WBN A;  4DR3 B;  2YI8 A;  1HR0 H;  3TY5 A;  4APM A;  5EZY B;  4X65 B;  3K59 A;  4FLW A;  3JAK A;  4AQY H;  4DV7 H;  4GKJ B;  5IJ0 A;  2YIB D;  4LNU B;  3JAM W;  3L4J A;  3BAB A;  3K5M A;  1N36 H;  4JI3 H;  4LFB H;  1IBK H;  4LF7 B;  4JI0 H;  1JMK C;  2Q7H A;  4UCO A;  4O2A A;  1E4F T;  2UUB H;  5IYZ B;  1VF7 A;  1TVK B;  1I7F A;  5IJ9 A;  2GV9 A;  1O9G A;  4O4J B;  3RGB A;  5EIB D;  3OTO H;  2VQF B;  4O4J A;  4D7S A;  4B3M B;  4TV9 B;  4LF8 H;  1G6U A;  4B3T H;  2E5L B;  4LFC B;  2OYQ A;  4U3J A;  2KKW A;  2IM9 A;  1N33 H;  4NVP A;  5LP6 C;  1WH2 A;  2WYO A;  1JJO A;  4DR2 H;  4JI4 H;  2E3C A;  3IAY A;  4PDB A;  5LMN B;  1Q3E A;  3N44 B;  5KHK A;  4FFB A;  4LR3 A;  4JYA H;  4LSA A;  3SJC C;  4DUY H;  1Z5V A;  5KHJ A;  4F6R B;  4R7R A;  4DV6 H;  3T1Y H;  4FM1 A;  2MCT A;  4LF6 H;  2VUG A;  4DV1 B;  4DK1 A;  2ZJT A;  4DUZ H;  1FKA H;  5JCO A;  4JV5 B;  1GYF A;  3CVZ A;  5D1O A;  4AIL C;  1TUB A;  4LF9 B;  2UXC H;  2JVD A;  3WB2 A;  4KL1 A;  4PHZ A;  4O4I B;  5LOV B;  1Q5O A;  2FE3 A;  3N41 B;  3GB8 B;  2HHH B;  5LYJ B;  2UUA H;  5LXT A;  3MWM A;  3JAL A;  4CC5 A;  4MTE A;  1IBL H;  4OX9 B;  2VQE B;  5KMG A;  4O2B B;  2ZM6 B;  4DR6 H;  3N6X A;  2ZNI A;  2ZNJ A;  4FM9 A;  2UXD B;  3BA9 A;  3QWU A;  4ZOL B;  4O4L A;  5FD5 A;  5ITZ B;  3IG0 A;  4I4T A;  4TUY B;  5J2T B;  1CKN A;  2R72 A;  4X1K B;  4ZHQ B;  3PN1 A;  1QQC A;  4FLY A;  4B3S B;  1KU9 A;  3HKE B;  2RJZ A;  1SA0 A;  3JAR A;  3VQW A;  5CB4 B;  4DV0 H;  4GYC B;  4DV5 H;  3THO A;  3U0Z A;  3E22 B;  2BTQ A;  5C8Y A;  5EYP A;  3ICX A;  4JI7 B;  5J2U B;  5CA1 A;  3DSQ A;  4JI8 B;  3N2G A;  2VWK A;  4MTD A;  4Q0Y A;  4IIJ B;  3MAQ A;  3VQV A;  4YY3 B;  2YI9 A;  3NBZ B;  1SQG A;  4CH5 A;  3M4I A;  4LF5 B;  3H20 A;  3KAJ A;  5GON A;  5EIB C;  1J5E H;  1HR0 B;  3FMA A;  4TV8 A;  3JSN A;  4JI6 B;  1Q43 A;  4DR4 H;  2JGU A;  1E4G T;  4AQY B;  4DR5 B;  4LFA H;  2YIA A;  2YCH A;  1XHZ A;  2CFM A;  3KAL A;  3K5N A;  4HNA B;  3K5O A;  4HNA A;  3RR5 A;  1O9H A;  2W57 A;  4LFB B;  4JI0 B;  4X66 H;  3J81 W;  3RYH B;  1XI1 A;  5JJE B;  3UQ8 A;  4FM0 A;  4A2B A;  2CW7 A;  2JS5 A;  3RYI B;  4WBN B;  1NT2 B;  5JH7 A;  2UU9 B;  3OTO B;  4BWS C;  2P5O A;  2R70 A;  3JAK B;  4LF8 B;  2PGG A;  3GDE A;  3CHX A;  5IJ0 B;  2Q7G A;  4FLX A;  5JJJ B;  1N33 B;  3K58 A;  1FVI A;  2F4V H;  5BR8 H;  3BPZ A;  4FLU A;  1Z2O X;  4FM2 A;  4JYA B;  1S03 G;  4O2A B;  1P16 A;  1P49 A;  2PY5 A;  4JI2 B;  2HEP A;  4DV6 B;  4HBN A;  4RAY A;  1XQ8 A;  5IJ9 B;  3T1Y B;  3QG5 A;  3NC0 B;  4LF6 B;  2VOB A;  2Q2U A;  3SGI A;  1N32 H;  4X62 H;  1XNR H;  5D5Q A;  4U3J B;  3JAW A;  5FNV A;  4B08 A;  1HNW H;  2UXC B;  4JI5 H;  3VQX A;  1HNX H;  5LL6 b;  4X64 H;  5JQG A;  2HIX A;  4FFB B;  1YEW A;  1S5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...