4EFFA

Crystal structure of aromatic-amino-acid aminotransferase from burkholderia pseudomallei
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
383
structure length
383
Chain Sequence
b'LGLNEAFNADTRPTKVNLGVGVYTNEDGKIPLLRAVRDAEKARVEAGLPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVTAQALGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYYDAKTNGVNFDGMLAALNGYEPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIEADAAAVRLFAAANLNVFVSSSFSKSFSLYGERVGALSIITDSKDEAARVLSQLKRVIRTNYSNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLVERLKAAGIERDFSFINAQRGMFSYSGLTSAQVDRLREEFGIYAVSTGRICVAALNTRNLDVVANAIAAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic-amino-acid aminotransferase
publication title Crystal structure of aromatic-amino-acid aminotransferase from Burkholderia pseudomallei
rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 145
structure length 383
sequence length 383
ec nomenclature ec 2.6.1.57: Aromatic-amino-acid transaminase.
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4effA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4effA01
2VGSA 1B5PA 3NX3A 3JWAA 2D7YA 2VMYA 4ITGA 4ADBA 4DBCA 3JU7A 4N0WA 3RI6A 4TMRA 1B4XA 3NTJA 1DJUA 1WYUB 2ZSMA 3PDBB 3P6KA 3VK2A 1DGDA 3LVLB 4Y0HA 1LKCA 2E54A 4LNMA 3Q8NA 1EG5A 4WXGA 3BCBA 2CY8A 4KAMA 4TV7A 4W91A 3EI9A 3JW9A 1FG3A 5M46A 5FT4A 4F5KA 3ZRQA 5C6UA 3ASAA 2ZP7A 4CXRA 1ARSA 1BT4A 3HT4A 3EI8A 5EUNA 1N8PA 4JF0A 1BS0A 1GBNA 1LW4A 1G7WA 4RAEA 1MDZA 1RVUA 5J8QA 3GZCA 4JE5D 1AHGA 3VP6A 3HBXA 3WY7A 4XJLA 3LY1A 4AOAA 5G2QA 3D6KA 4F5HA 1D7RA 1YNUA 4F5LA 1O62A 1AJRA 2VMXA 4K2IA 5FT8A 2BWNA 1I48A 1ARHA 1I43A 1G4VA 4ZDLA 3AEOA 4IW7A 3FQAA 1W7MA 3QPGA 1ELQA 4LNJA 1J32A 2C0RA 3EIBA 2GSAA 3B1EA 3PD6B 4AZJA 1B8GA 4OCAA 3F0HA 2D66A 5E3KA 3TFUA 2HUUA 4FFCA 3CQ6A 1CZCA 1WYTB 2WKAA 1Z7DA 1DJEA 2AATA 3BC8A 2GB3A 3UE8A 2VGTA 3DC1A 1AAWA 4IX8A 1O69A 3WZFA 3W1JA 1GC2A 1BJWA 2BWPA 2DGKA 1RV4A 1C4KA 1GEWA 1MLYA 1JG8A 4OTLA 1RV3A 4ZSYA 2JGTA 1IBJA 2QB2A 4U2HA 3FRKA 4UQVA 1ZODA 4ZWMA 3E2ZB 3FQ7A 2OKJA 1AHFA 3BV0A 4OYTA 2VMNA 1G7XA 1N31A 4LNLA 4ZSWA 2FQ6A 2TPLA 1C7GA 3HLMA 4MGRA 2OGAA 1M6SA 4GDYA 3G8MA 5G2PA 2VMWA 3AOVA 3PDBA 4AH3A 2NMPA 2W8JA 3BCAA 2YKXA 1MDXA 3N75A 3BWNA 1AIAA 2HP2A 3K40A 3N0LA 2CINA 3DU4A 1CL1A 1B9HA 4JF1A 2WK8A 3DODA 4XJOA 1Y4IA 1MGVA 4WLHA 4WD2A 4A0FA 2EH6A 1IAXA 2YCTA 1V2DA 3AEJA 2R5CB 1ZC9A 3FZ7A 4M2KA 1C0NA 2BI2A 2D64A 2VIBA 4EB5A 3ZZKA 4RM1A 1P3WA 2RFVA 1M0OA 1GC3A 1VJOA 1YAAA 2VMPA 3ZRPA 2V1PA 4FL0A 4A0RA 3IHJA 3DXVA 3BS8A 2X5FA 3ATHA 4F5MA 2VMTA 2BYJA 3H7FA 3K7YA 4U1TA 4H51A 3FTBA 4WYEA 5M4DA 1MDOA 4A6TA 2C81A 1ECXA 2Z67A 2D61A 3PD6A 3OP7A 3NYUA 3E9KA 3NYTA 3M5UA 2YRRA 2Z61A 3B46A 1WYTA 1SFFA 3KE3A 3LVJA 2BI9A 3KGXA 3WGBA 1QISA 3AEPA 3GSBA 1SZUA 1AMSA 4IXOA 2Z20A 3E2FA 4RIZA 1M0NA 3UAKA 1ASAA 2DOUA 2VMOA 5EUEA 4J8LA 1TOGA 1H1CA 1X29A 3F9TA 1AHEA 2JJGA 2Z1ZA 3L8AA 4R5FA 3B8XA 2W8UA 3LG0A 3QM2A 3B1DA 3E2ZA 5FT6A 1UU2A 3NUIA 1AX4A 1ARIA 1S09A 1BJNA 1D2FA 4WXBA 1GC0A 1CJ0A 4GE7A 4LW2A 4XJPA 2VMUA 3ELEA 1AKCA 3NU7A 3FFRA 4F5GA 1IAYA 3DR7A 1AMQA 3BN1A 1KKJA 3FCRA 5EAVA 3AEMC 1ASGA 4MQPA 2QA3A 1TASA 3BCXA 1PFFA 1WSTA 3WKSA 2ZSLA 4M2JA 2VGUA 1YJZA 3CQ4A 3DZZA 4RJYA 2VGZA 5G4IA 2F8JA 4EMYA 1ASFA 4W5KA 2R5CA 5DX5A 3TCMA 4ATPA 1IVRA 2JJFA 1ASDA 2BI5A 5M4BA 1YJYA 1BQDA 2QBTA 2EZ1A 1SPAA 3JWBA 3HDOA 1E5EA 3NRAA 5G4JA 1V2FA 1CQ8A 2VGVA 3ACZA 4J5UA 2W8WA 2EGYA 1AIBA 2CH1A 4I8AA 2OATA 1VEFA 4B98A 2AY6A 1GDEA 1N2TA 2ZY4A 1EQBA 1LC5A 3CAIA 3EI5A 1QJ3A 1M4NA 1QGNA 2VI9A 2Z1YA 4IYOB 4TN4A 4W1VA 4ZDOA 1TARA 2YRIA 4OBUA 4F5FA 4IXSA 1AMAA 4UHNA 4Y0IA 3L44A 1AY5A 2WK9A 1YOOA 4DGTA 2VMQA 2W8TA 5DB5A 4K2BA 2Z9XA 1JS6A 3WGCA 3LVMA 4ADDA 1S0AA 1BQAA 3ZRRA 2W7IA 1BJ4A 1OHVA 5D95A 1QITA 1PMOA 3NUBA 4JEWA 2E7UA 2HP1A 3FQ8A 3DXWA 3H14A 3KGWA 4WB0B 4ADEA 1S08A 2W7MA 1J04A 2YOBA 1W23A 1X28A 3WCOA 4BQ0A 5BJ4A 2ZUKA 3PIUA 2PB2A 5E5IA 3I16A 2V0YA 2GMSA 1X2AA 2HUFA 3G7QA 3RBFA 4UOYA 5BJ3A 4WLJA 1KL2A 3ASBA 5EAAA 1W7NA 1LS3A 1QJ5A 3EUCA 4XEWA 1JF9A 1DKAA 2W8VA 3R4TA 4UHOA 3ELPA 1C7OA 1I41A 2GMUA 1IX7A 4A00A 3VOMA 1SZSA 3NNKA 3QN6A 4LC3A 4MKKA 4WYFA 2EO5A 3RCHB 3ISLA 4K2MA 1GEXA 3T32A 2VYCA 1KMJA 1C9CA 1EJIA 3MKJA 4Y0DA 2FN6A 4BA4A 2CB1A 1ASEA 1TATA 2QLRA 3FKDA 1U08A 4GEBA 5E4ZA 5TF5A 3AV7A 4AZKA 5M49A 3MC6C 2Z9WA 1G4XA 1DGEA 2AEVA 3GETA 2CH2A 4PVFA 1AY8A 3PPLA 4Q6RA 4GSAA 2HUIA 3RQ1A 3W1HA 4B9BA 3AOWA 4XJMA 2QB3A 1ASNA 2YCNA 4EU1A 3LWSA 1D7SA 4IYOA 4DQ6A 2C44A 1TOJA 2EZ2A 2ZJGA 7AATA 1KKPA 2W7LA 2BI1A 3GZDC 1Z3ZA 4F5IA 4RLGA 3TATA 4W1WA 5HHYA 1MAPA 2ORDA 2CJHA 1YIZA 4L0OA 2Z9VA 1OATA 1SVVA 3AATA 3PJ0A 3PDXA 2ZY3A 2ZY2A 2W7FA 1TOEA 3FZ6A 4WBTA 2D5YA 3DRDA 4XAUA 4WB0A 3CBFA 1IX8A 4A0HA 4WYDA 1PMMA 1TOIA 3QI6A 2Z9UA 2CFBA 1LC7A 2D63A 3RBLA 2HOYA 2AY3A 1OHYA 3A9XA 3MEBA 3CQ5A 3NYSA 1WKGA 3FDBA 4HF8A 2GQNA 3MAUA 3NDNA 3JZLA 3FDDA 2YKVA 2DR1A 5AX8A 2ZY5A 1W3UA 4ZDPA 1OHWA 3P1TA 2CTZA 1TPLA 3PGYA 3HL2A 1GCKA 3QHXA 2R2NA 3GBXA 4ATQA 1ASMA 4NOGA 2CJGA 3COGA 1TOKA 5LHAA 2ZYJA 4A6RA 1AHXA 3EZSA 1B9IA 2AY2A 2G6WA 3BB8A 4EFFA 3RCHA 1PG8A 5G09A 8AATA 1DJ9A 1UU0A 1DFOA 2ZC0A 4E3QA 4OMAA 2JISA 4A72A 1QZ9A 1IUGA 2EPJA 3EI7A 1O61A 2XBNA 3A9ZA 4MKJA 4W8IA 2FYFA 5JAYA 4MQRA 1XEYA 2BHXA 4IXZA 1DTYA 1BW0A 3E2YA 4JE5A 3E6GA 4CXQA 3ZZJA 2CJDA 2VLHA 5EQCA 3HMUA 3WKRA 3VAXA 2DGLA 2YHKA 5F9SA 3AEMA 3JTXA 1ORDA 5HXXA 1OXOA 2BIEA 1AJSB 4QGRA 2FM1A 4A6UA 3II0A 1ARGA 3QGUA 4XQ2A 2XH1A 4PFFA 3BWOA 2VI8A 4A0GA 3HQTA 1E5FA 1ELUA 2JJHA 1GC4A 1M32A 1S07A 2PO3A 2JG2A 2X8UA 4OC9A 2YCPA 1QIRA 2C7TA 4P7YA 3G0TA 4BA5A 4E1OA 1M0PA 2YKUA 1AKBA 1M7YA 3TFTA 3AENB 4MQQA 3FVUA 4CBRA 3PA9A 4WYGA 2BIGA 3MADA 4ZM3A 1AICA 4OBVA 3QBOA 3NU8A 1WYVB 3OKSA 1UKJA 5K8BA 5FT5A 1D7UA 3RUYA 4HVKA 4ZLVA 4WYAA 3FSLA 2CSTA 3DR4A 2AEUA 1UU1A 1V2EA 2D7ZA 1GD9A 3FVXA 4GRXA 4O6ZA 1ARTA 2BWOA 1YJSA 3WLXA 4JEZA 9AATA 2AY8A 3HVYA 4WYCA 1FC4A 1VP4A 3N5MA 2OQXA 4E3RA 2BI3A 2BKWA 2AY7A 1M0QA 2X5DA 4WP0A 3B1CA 3FZ8A 2BYLA 3I4JA 2E7IA 2JJEA 2FNIA 1BJOA 3A9YA 2HOZA 1KMKA 4WXFA 1WKHA 2HZPA 4CVQA 3A2BA 2YKYA 3GR9A 3I5TA 4ZM4A 4LW4A 2VIAA 5D5SA 1IJIA 1C7NA 2WK7A 4JEYA 2AY9A 4N0BA 4Q75A 1X0MA 3BWNC 1AMRA 3MAFB 2HORA 3FD0A 3GWPA 5IWQA 4R8DA 1OXPA 2W7HA 2VMRA 4CBSA 4R2NA 1LC8A 1AJSA 1ASCA 3W1IA 3WCNA 2O0RA 3A8UX 3EIAA 4JEVA 4AO9A 1MLZA 2HOXA 4ITXA 4OT8A 2AY5A 5EIGB 1RVYA 3VK4A 3AEJC 4RJ0A 3WX9A 4PIWA 5F8VA 1WYUA 1GEYA 3F6TA 2O7CA 3TQXA 3DYDA 2DKBA 5DJ1A 4ZAHA 2R5EA 2VGWA 4UHMA 3GJUA 1SF2A 2W7JA 1ASLA 2CANA 2E7JA 3AELA 2Q7WA 3USFA 4F5JA 2W7KA 2VMSA 3ECDA 3MC6A 3AENA 1AAMA 2W7GA 4BMKA 4RKCA 1MAQA 5LH9A 2OKKA 2PB0A 3LVKA 1FG7A 2QMAA 4Q31A 4KXKA 1WYVA 4GE4A 3LV2A 1LW5A 2FNUA 4ZASA 3EI6A 4PFNA 4E77A 3UWCA 1KL1A 4BHDA 4IY7A 1B5OA 3GZDA 1LK9A 3MBBA 1T3IA 1CS1A 1ZOBA 4GE9A 1SZKA 2W7EA 5G0AA 1O4SA 2BIAA 1I29A 2O1BA 4ADCA 1ASBA 3FVSA 4KYOA 3IF2A 3FFHA 4R5ZA 1S06A 1W7LA 1XI9A 1IX6A 5EFSA 3E77A 5HDMA 1CQ7A 1V72A 4JEXA 4AO4A 2AY1A 1YIYA 4W1XA 4XK1A 4F4EA 1CQ6A 2VMVA 1AY4A 2VMZA 1CZEA 2DKJA 5EUDA 4MSOA 2OGEA 2DGMA 4Q76A 4RKDA 4RITA 4EB7A 3KKIA 2D65A 2R0TA 3R9AA 4ZWVA 4MY5A 1CL2A 1D7VA 3MAFA 1H0CA 1BJOB 2VLFA 2W7DA 1BKGA 2X3LA 3EZ1A 4M2MA 5I92A 1JS3A 1AKAA 5EIGA 4ISYA 1AHYA 3VK3A 3PAAA 2AY4A 5DJ9A 3K28A 4P3MA
chains in the Genus database with same CATH superfamily
2VGSA 1B5PA 3NX3A 3JWAA 2D7YA 2VMYA 4ITGA 4ADBA 4DBCA 3JU7A 4N0WA 3RI6A 4TMRA 3N4RA 1B4XA 3NTJA 1DJUA 1WYUB 2ZSMA 3PDBB 3P6KA 3VK2A 1DGDA 3LVLB 4Y0HA 1LKCA 2E54A 4LNMA 3Q8NA 1EG5A 4WXGA 3BCBA 2CY8A 4KAMA 4TV7A 4W91A 3EI9A 3JW9A 1FG3A 5M46A 5FT4A 4F5KA 3ZRQA 5C6UA 3ASAA 2ZP7A 4CXRA 1ARSA 1BT4A 3HT4A 3EI8A 5EUNA 1N8PA 4JF0A 1BS0A 1GBNA 1LW4A 1G7WA 4RAEA 1MDZA 1RVUA 5J8QA 3GZCA 4JE5D 1AHGA 3VP6A 3HBXA 3WY7A 4XJLA 3LY1A 4AOAA 5G2QA 3D6KA 4F5HA 1D7RA 1YNUA 4F5LA 1O62A 1AJRA 2VMXA 4K2IA 5FT8A 2BWNA 1I48A 1ARHA 1I43A 1G4VA 4ZDLA 3AEOA 4IW7A 3FQAA 1W7MA 3QPGA 1ELQA 4LNJA 1J32A 2C0RA 3EIBA 2GSAA 3B1EA 3PD6B 4AZJA 1B8GA 4OCAA 3F0HA 2D66A 5E3KA 3TFUA 2HUUA 4FFCA 3CQ6A 1CZCA 1WYTB 2WKAA 1Z7DA 1DJEA 2AATA 3BC8A 2GB3A 3UE8A 2VGTA 3DC1A 1AAWA 4IX8A 1O69A 3WZFA 3W1JA 1GC2A 1BJWA 2BWPA 2A1VA 2DGKA 1RV4A 1C4KA 1GEWA 1MLYA 1JG8A 4OTLA 1RV3A 4ZSYA 2JGTA 1IBJA 2QB2A 4U2HA 3FRKA 4UQVA 1ZODA 4ZWMA 3E2ZB 3FQ7A 2OKJA 1AHFA 3BV0A 4OYTA 2VMNA 1G7XA 1N31A 4LNLA 4ZSWA 2FQ6A 2TPLA 1C7GA 3HLMA 4MGRA 2OGAA 1M6SA 4GDYA 3G8MA 5G2PA 2VMWA 3AOVA 3PDBA 4AH3A 2NMPA 2W8JA 3BCAA 2YKXA 1MDXA 3N75A 3BWNA 1AIAA 2HP2A 3K40A 3N0LA 2CINA 3DU4A 1CL1A 1B9HA 4JF1A 2WK8A 3DODA 4XJOA 1Y4IA 1MGVA 4WLHA 4WD2A 4A0FA 2EH6A 1IAXA 2YCTA 1V2DA 3AEJA 2R5CB 1ZC9A 3FZ7A 4M2KA 1C0NA 2BI2A 2D64A 2VIBA 4EB5A 3ZZKA 4RM1A 1P3WA 2RFVA 1M0OA 1GC3A 1VJOA 1YAAA 2VMPA 3ZRPA 2V1PA 4FL0A 4A0RA 3IHJA 3DXVA 3BS8A 2X5FA 3ATHA 4F5MA 2VMTA 2BYJA 3H7FA 3K7YA 4U1TA 4H51A 3FTBA 4WYEA 5M4DA 1MDOA 4A6TA 2C81A 1ECXA 2Z67A 2D61A 3PD6A 3OP7A 3NYUA 3E9KA 3NYTA 3M5UA 2YRRA 2Z61A 3B46A 1WYTA 1SFFA 3KE3A 3LVJA 2BI9A 3KGXA 3WGBA 1QISA 3AEPA 3GSBA 1SZUA 1AMSA 4IXOA 2Z20A 3E2FA 4RIZA 1M0NA 3UAKA 1ASAA 2DOUA 2VMOA 5EUEA 4J8LA 1TOGA 1H1CA 1X29A 3F9TA 1AHEA 2JJGA 2Z1ZA 3L8AA 4R5FA 3B8XA 2W8UA 3LG0A 3QM2A 3B1DA 3E2ZA 5FT6A 1UU2A 3NUIA 1AX4A 1ARIA 1S09A 1BJNA 1D2FA 4WXBA 4H63Q 1GC0A 1CJ0A 4GE7A 4LW2A 4XJPA 2VMUA 3ELEA 1AKCA 3NU7A 3FFRA 4F5GA 1IAYA 3DR7A 1AMQA 3BN1A 1KKJA 3FCRA 5EAVA 3AEMC 1ASGA 4MQPA 2QA3A 1TASA 3BCXA 1PFFA 1WSTA 3WKSA 3N4XA 2ZSLA 4M2JA 2VGUA 1YJZA 3CQ4A 3DZZA 4RJYA 2VGZA 5G4IA 2F8JA 4EMYA 1ASFA 4W5KA 2R5CA 5DX5A 3TCMA 4ATPA 1IVRA 2JJFA 1ASDA 2BI5A 5M4BA 1YJYA 1BQDA 2QBTA 2EZ1A 1SPAA 3JWBA 3HDOA 1E5EA 1KAFA 3NRAA 5G4JA 1V2FA 1CQ8A 2VGVA 3ACZA 4J5UA 3N4SA 2W8WA 2EGYA 1AIBA 2CH1A 4I8AA 2OATA 1VEFA 4B98A 2AY6A 2KFPA 1GDEA 1N2TA 2ZY4A 1EQBA 1LC5A 3CAIA 3EI5A 1QJ3A 1M4NA 1QGNA 2VI9A 2Z1YA 4IYOB 4TN4A 4W1VA 4ZDOA 1TARA 2YRIA 4OBUA 4F5FA 4IXSA 1AMAA 4UHNA 4Y0IA 3L44A 1AY5A 2WK9A 3N7NA 1YOOA 4DGTA 5KTBA 2VMQA 2W8TA 5DB5A 4K2BA 2Z9XA 2QSRA 1JS6A 3WGCA 3LVMA 4ADDA 1S0AA 1BQAA 3ZRRA 2W7IA 1BJ4A 1OHVA 5D95A 1QITA 1PMOA 3NUBA 4JEWA 2E7UA 2HP1A 3FQ8A 3DXWA 3H14A 3KGWA 4WB0B 4ADEA 1S08A 2W7MA 1J04A 2YOBA 1W23A 1X28A 3WCOA 4BQ0A 5BJ4A 2ZUKA 3PIUA 2PB2A 5E5IA 3I16A 2V0YA 2GMSA 1X2AA 2HUFA 3G7QA 3RBFA 4UOYA 5BJ3A 4WLJA 1KL2A 3ASBA 5EAAA 1W7NA 1LS3A 1QJ5A 3EUCA 4XEWA 1JF9A 1DKAA 2W8VA 3R4TA 4UHOA 3ELPA 1C7OA 1I41A 2GMUA 1IX7A 4A00A 3VOMA 1SZSA 3NNKA 3QN6A 4LC3A 4MKKA 4WYFA 2EO5A 3RCHB 3ISLA 4K2MA 1GEXA 3T32A 2VYCA 1KMJA 1C9CA 1EJIA 3MKJA 4Y0DA 2FN6A 4BA4A 2CB1A 1ASEA 1TATA 2QLRA 3FKDA 1U08A 4GEBA 5E4ZA 5TF5A 3AV7A 4AZKA 5M49A 3MC6C 2Z9WA 1G4XA 1DGEA 2AEVA 3GETA 2CH2A 4PVFA 1AY8A 3PPLA 4Q6RA 4GSAA 2HUIA 3RQ1A 3W1HA 4B9BA 3AOWA 2EYQA 4XJMA 2QB3A 1ASNA 2YCNA 4EU1A 3LWSA 1D7SA 4IYOA 4DQ6A 2C44A 1TOJA 2EZ2A 2ZJGA 7AATA 1KKPA 2W7LA 2BI1A 3GZDC 1Z3ZA 4F5IA 4RLGA 3TATA 4W1WA 5HHYA 1MAPA 2ORDA 2CJHA 1YIZA 4L0OA 2Z9VA 1OATA 1SVVA 3AATA 3PJ0A 3PDXA 2ZY3A 2ZY2A 2W7FA 1TOEA 3FZ6A 4WBTA 2D5YA 3DRDA 4XAUA 4WB0A 3CBFA 1IX8A 4K05A 4A0HA 4WYDA 1PMMA 1TOIA 3QI6A 2Z9UA 2CFBA 1LC7A 2D63A 3RBLA 2HOYA 2AY3A 1OHYA 3A9XA 3MEBA 3CQ5A 3NYSA 1WKGA 3FDBA 4HF8A 2GQNA 3MAUA 3NDNA 3JZLA 3FDDA 2YKVA 2DR1A 5AX8A 2ZY5A 1W3UA 4ZDPA 1OHWA 3P1TA 2CTZA 1TPLA 3PGYA 3HL2A 1GCKA 3QHXA 2R2NA 3GBXA 4ATQA 1ASMA 4NOGA 2CJGA 3COGA 1TOKA 5LHAA 2ZYJA 4A6RA 1AHXA 3EZSA 1B9IA 2AY2A 2G6WA 3BB8A 4EFFA 3RCHA 1PG8A 5G09A 8AATA 1DJ9A 1UU0A 1DFOA 2ZC0A 4E3QA 4OMAA 2JISA 4A72A 1QZ9A 1IUGA 2EPJA 3EI7A 1O61A 2XBNA 3A9ZA 4MKJA 4W8IA 2FYFA 5JAYA 4MQRA 1XEYA 2BHXA 4IXZA 1DTYA 1BW0A 3E2YA 4JE5A 3E6GA 4CXQA 2WB6A 3ZZJA 2CJDA 2VLHA 5EQCA 3HMUA 3WKRA 3VAXA 2DGLA 2YHKA 5F9SA 3AEMA 3JTXA 1ORDA 5HXXA 1OXOA 2BIEA 1AJSB 4QGRA 2FM1A 4A6UA 3II0A 1ARGA 3QGUA 4XQ2A 2XH1A 4PFFA 3BWOA 2VI8A 4A0GA 3HQTA 1E5FA 1ELUA 2JJHA 1GC4A 1M32A 1S07A 2PO3A 2JG2A 2X8UA 4OC9A 2YCPA 1QIRA 2C7TA 4P7YA 3G0TA 4BA5A 4E1OA 1M0PA 2YKUA 1AKBA 1M7YA 3TFTA 3AENB 4MQQA 3FVUA 4CBRA 3PA9A 4WYGA 2BIGA 3MADA 4ZM3A 1AICA 4OBVA 3QBOA 3NU8A 1WYVB 3OKSA 1UKJA 5K8BA 5FT5A 1D7UA 3RUYA 4HVKA 4ZLVA 4WYAA 3FSLA 2CSTA 3DR4A 2AEUA 1UU1A 1V2EA 2D7ZA 1GD9A 3FVXA 4GRXA 4O6ZA 1ARTA 2BWOA 1YJSA 3WLXA 4JEZA 9AATA 2AY8A 3HVYA 4WYCA 1FC4A 1VP4A 3N5MA 2OQXA 4E3RA 2BI3A 2BKWA 2AY7A 1M0QA 2X5DA 4WP0A 3B1CA 3FZ8A 2BYLA 3I4JA 2E7IA 2JJEA 2FNIA 1BJOA 3A9YA 2HOZA 1KMKA 4WXFA 1WKHA 2HZPA 4CVQA 3A2BA 2YKYA 3GR9A 3I5TA 4ZM4A 4LW4A 2VIAA 5D5SA 1IJIA 1C7NA 2WK7A 4JEYA 2AY9A 4N0BA 4Q75A 1X0MA 3BWNC 1AMRA 3MAFB 2HORA 3FD0A 3GWPA 5IWQA 4R8DA 1OXPA 2W7HA 2VMRA 4CBSA 4R2NA 1LC8A 1AJSA 1ASCA 3W1IA 3WCNA 2O0RA 3A8UX 3EIAA 4JEVA 4AO9A 1MLZA 2HOXA 4ITXA 4OT8A 2AY5A 5EIGB 1RVYA 3VK4A 3AEJC 4RJ0A 3WX9A 4PIWA 5F8VA 1WYUA 1GEYA 3F6TA 2O7CA 3TQXA 3DYDA 2DKBA 5DJ1A 4ZAHA 2R5EA 2VGWA 4UHMA 3GJUA 1SF2A 2W7JA 1ASLA 2CANA 2E7JA 3AELA 2Q7WA 3USFA 4F5JA 2W7KA 2VMSA 3ECDA 3MC6A 3AENA 1AAMA 2W7GA 4BMKA 4RKCA 1MAQA 5LH9A 2OKKA 2G7JA 2PB0A 3LVKA 1FG7A 2QMAA 4Q31A 4KXKA 1WYVA 4GE4A 3LV2A 1LW5A 2FNUA 4ZASA 3EI6A 4PFNA 4E77A 3UWCA 1KL1A 4BHDA 4IY7A 1B5OA 3GZDA 1LK9A 3MBBA 1T3IA 1CS1A 1ZOBA 4GE9A 1SZKA 2W7EA 5G0AA 1O4SA 2BIAA 1I29A 2O1BA 4ADCA 1ASBA 3FVSA 4KYOA 3IF2A 3FFHA 4R5ZA 1S06A 1W7LA 1XI9A 1IX6A 5EFSA 3E77A 5HDMA 1CQ7A 1V72A 4JEXA 4AO4A 2FKIA 2AY1A 1YIYA 4W1XA 4XK1A 4F4EA 1CQ6A 2VMVA 1AY4A 2VMZA 1CZEA 2DKJA 5EUDA 4MSOA 2OGEA 2DGMA 4Q76A 4RKDA 4RITA 4EB7A 3KKIA 2D65A 2R0TA 3R9AA 4ZWVA 4MY5A 1CL2A 1D7VA 3MAFA 1H0CA 1BJOB 2VLFA 2W7DA 3H9XA 1BKGA 2X3LA 3EZ1A 4M2MA 5I92A 1JS3A 1AKAA 5EIGA 4ISYA 1AHYA 3VK3A 3PAAA 2AY4A 5DJ9A 3K28A 4P3MA
chains in the Genus database with same CATH topology
2VGSA 1B5PA 3NX3A 3JWAA 2D7YA 2VMYA 4ITGA 4ADBA 4DBCA 3JU7A 4N0WA 3RI6A 4TMRA 3N4RA 1B4XA 3NTJA 1DJUA 1WYUB 2ZSMA 3PDBB 3P6KA 3VK2A 1DGDA 3LVLB 4Y0HA 1LKCA 2E54A 4LNMA 3Q8NA 1EG5A 4WXGA 3BCBA 2CY8A 4KAMA 4TV7A 4W91A 3EI9A 3JW9A 1FG3A 5M46A 5FT4A 4F5KA 3ZRQA 5C6UA 3ASAA 2ZP7A 4CXRA 1ARSA 1BT4A 3HT4A 3EI8A 5EUNA 1N8PA 4JF0A 1BS0A 1GBNA 1LW4A 1G7WA 4RAEA 1MDZA 1RVUA 5J8QA 3GZCA 4JE5D 1AHGA 3VP6A 3HBXA 3WY7A 4XJLA 3LY1A 4AOAA 5G2QA 3D6KA 4F5HA 1D7RA 1YNUA 4F5LA 1O62A 1AJRA 2VMXA 4K2IA 5FT8A 2BWNA 1I48A 1ARHA 1I43A 1G4VA 4ZDLA 3AEOA 4IW7A 3FQAA 1W7MA 3QPGA 1ELQA 4LNJA 1J32A 2C0RA 3EIBA 2GSAA 3B1EA 3PD6B 4AZJA 1B8GA 4OCAA 3F0HA 2D66A 5E3KA 3TFUA 2HUUA 4FFCA 3CQ6A 1CZCA 1WYTB 2WKAA 1Z7DA 1DJEA 2AATA 3BC8A 2GB3A 3UE8A 2VGTA 3DC1A 1AAWA 4IX8A 1O69A 3WZFA 3W1JA 1GC2A 1BJWA 2BWPA 2A1VA 2DGKA 1RV4A 1C4KA 1GEWA 1MLYA 1JG8A 4OTLA 1RV3A 4ZSYA 2JGTA 1IBJA 2QB2A 4U2HA 3FRKA 4UQVA 1ZODA 4ZWMA 3E2ZB 3FQ7A 2OKJA 1AHFA 3BV0A 4OYTA 2VMNA 1G7XA 1N31A 4LNLA 4ZSWA 2FQ6A 2TPLA 1C7GA 3HLMA 4MGRA 2OGAA 1M6SA 4GDYA 3G8MA 5G2PA 2VMWA 3AOVA 3PDBA 4AH3A 2NMPA 2W8JA 3BCAA 2YKXA 1MDXA 3N75A 3BWNA 1AIAA 2HP2A 3K40A 3N0LA 2CINA 3DU4A 1CL1A 1B9HA 4JF1A 2WK8A 3DODA 4XJOA 1Y4IA 1MGVA 4WLHA 4WD2A 4A0FA 2EH6A 1IAXA 2YCTA 1V2DA 3AEJA 2R5CB 1ZC9A 3FZ7A 4M2KA 1C0NA 2BI2A 2D64A 2VIBA 4EB5A 3ZZKA 4RM1A 1P3WA 2RFVA 1M0OA 1GC3A 1VJOA 1YAAA 2VMPA 3ZRPA 2V1PA 4FL0A 4A0RA 3IHJA 3DXVA 3BS8A 2X5FA 3ATHA 4F5MA 2VMTA 2BYJA 3H7FA 3K7YA 4U1TA 4H51A 3FTBA 4WYEA 5M4DA 1MDOA 4A6TA 2C81A 1ECXA 2Z67A 2D61A 3PD6A 3OP7A 3NYUA 3E9KA 3NYTA 3M5UA 2YRRA 2Z61A 3B46A 1WYTA 1SFFA 3KE3A 3LVJA 2BI9A 3KGXA 3WGBA 1QISA 3AEPA 3GSBA 1SZUA 1AMSA 4IXOA 2Z20A 3E2FA 4RIZA 1M0NA 3UAKA 1ASAA 2DOUA 2VMOA 5EUEA 4J8LA 1TOGA 1H1CA 1X29A 3F9TA 1AHEA 2JJGA 2Z1ZA 3L8AA 4R5FA 3B8XA 2W8UA 3LG0A 3QM2A 3B1DA 3E2ZA 5FT6A 1UU2A 3NUIA 1AX4A 1ARIA 1S09A 1BJNA 1D2FA 4WXBA 4H63Q 1GC0A 1CJ0A 4GE7A 4LW2A 4XJPA 2VMUA 3ELEA 1AKCA 3NU7A 3FFRA 4F5GA 1IAYA 3DR7A 1AMQA 3BN1A 1KKJA 3FCRA 5EAVA 3AEMC 1ASGA 4MQPA 2QA3A 1TASA 3BCXA 1PFFA 1WSTA 3WKSA 3N4XA 2ZSLA 4M2JA 2VGUA 1YJZA 3CQ4A 3DZZA 4RJYA 2VGZA 5G4IA 2F8JA 4EMYA 1ASFA 4W5KA 2R5CA 5DX5A 3TCMA 4ATPA 1IVRA 2JJFA 1ASDA 2BI5A 5M4BA 1YJYA 1BQDA 2QBTA 2EZ1A 1SPAA 3JWBA 3HDOA 1E5EA 3NRAA 5G4JA 1V2FA 1CQ8A 2VGVA 3ACZA 4J5UA 3N4SA 2W8WA 2EGYA 1AIBA 2CH1A 4I8AA 2OATA 1VEFA 4B98A 2AY6A 2KFPA 1GDEA 1N2TA 2ZY4A 1EQBA 1LC5A 3CAIA 3EI5A 1QJ3A 1M4NA 1QGNA 2VI9A 2Z1YA 4IYOB 4TN4A 4W1VA 4ZDOA 1TARA 2YRIA 4OBUA 4F5FA 4IXSA 1AMAA 4UHNA 4Y0IA 3L44A 1AY5A 2WK9A 3N7NA 1YOOA 4DGTA 5KTBA 2VMQA 2W8TA 5DB5A 4K2BA 2Z9XA 2QSRA 1JS6A 3WGCA 3LVMA 4ADDA 1S0AA 1BQAA 3ZRRA 2W7IA 1BJ4A 1OHVA 5D95A 1QITA 1PMOA 3NUBA 4JEWA 2E7UA 2HP1A 3FQ8A 3DXWA 3H14A 3KGWA 4WB0B 4ADEA 1S08A 2W7MA 1J04A 2YOBA 1W23A 1X28A 3WCOA 4BQ0A 5BJ4A 2ZUKA 3PIUA 2PB2A 5E5IA 3I16A 2V0YA 2GMSA 1X2AA 2HUFA 3G7QA 3RBFA 4UOYA 5BJ3A 4WLJA 1KL2A 3ASBA 5EAAA 1W7NA 1LS3A 1QJ5A 3EUCA 4XEWA 1JF9A 1DKAA 2W8VA 3R4TA 4UHOA 3ELPA 1C7OA 1I41A 2GMUA 1IX7A 4A00A 3VOMA 1SZSA 3NNKA 3QN6A 4LC3A 4MKKA 4WYFA 2EO5A 3RCHB 3ISLA 4K2MA 1GEXA 3T32A 2VYCA 1KMJA 1C9CA 1EJIA 3MKJA 4Y0DA 2FN6A 4BA4A 2CB1A 1ASEA 1TATA 2QLRA 3FKDA 1U08A 4GEBA 5E4ZA 5TF5A 3AV7A 4AZKA 5M49A 3MC6C 2Z9WA 1G4XA 1DGEA 2AEVA 3GETA 2CH2A 4PVFA 1AY8A 3PPLA 4Q6RA 4GSAA 2HUIA 3RQ1A 3W1HA 4B9BA 3AOWA 2EYQA 4XJMA 2QB3A 1ASNA 2YCNA 4EU1A 3LWSA 1D7SA 4IYOA 4DQ6A 2C44A 1TOJA 2EZ2A 2ZJGA 7AATA 1KKPA 2W7LA 2BI1A 3GZDC 1Z3ZA 4F5IA 4RLGA 3TATA 4W1WA 5HHYA 1MAPA 2ORDA 2CJHA 1YIZA 4L0OA 2Z9VA 1OATA 1SVVA 3AATA 3PJ0A 3PDXA 2ZY3A 2ZY2A 2W7FA 1TOEA 3FZ6A 4WBTA 2D5YA 3DRDA 4XAUA 4WB0A 3CBFA 1IX8A 4K05A 4A0HA 4WYDA 1PMMA 1TOIA 3QI6A 2Z9UA 2CFBA 1LC7A 2D63A 3RBLA 2HOYA 2AY3A 1OHYA 3A9XA 3MEBA 3CQ5A 3NYSA 1WKGA 3FDBA 4HF8A 2GQNA 3MAUA 3NDNA 3JZLA 3FDDA 2YKVA 2DR1A 5AX8A 2ZY5A 1W3UA 4ZDPA 1OHWA 3P1TA 2CTZA 1TPLA 3PGYA 3HL2A 1GCKA 3QHXA 2R2NA 3GBXA 4ATQA 1ASMA 4NOGA 2CJGA 3COGA 1TOKA 5LHAA 2ZYJA 4A6RA 1AHXA 3EZSA 1B9IA 2AY2A 2G6WA 3BB8A 4EFFA 3RCHA 1PG8A 5G09A 8AATA 1DJ9A 1UU0A 1DFOA 2ZC0A 4E3QA 4OMAA 2JISA 4A72A 1QZ9A 1IUGA 2EPJA 3EI7A 1O61A 2XBNA 3A9ZA 4MKJA 4W8IA 2FYFA 5JAYA 4MQRA 1XEYA 2BHXA 4IXZA 1DTYA 1BW0A 3E2YA 4JE5A 3E6GA 4CXQA 2WB6A 3ZZJA 2CJDA 2VLHA 5EQCA 3HMUA 3WKRA 3VAXA 2DGLA 2YHKA 5F9SA 3AEMA 3JTXA 1ORDA 5HXXA 1OXOA 2BIEA 1AJSB 4QGRA 2FM1A 4A6UA 3II0A 1ARGA 3QGUA 4XQ2A 2XH1A 4PFFA 3BWOA 2VI8A 4A0GA 3HQTA 1E5FA 1ELUA 2JJHA 1GC4A 1M32A 1S07A 2PO3A 2JG2A 2X8UA 4OC9A 2YCPA 1QIRA 2C7TA 4P7YA 3G0TA 4BA5A 4E1OA 1M0PA 2YKUA 1AKBA 1M7YA 3TFTA 3AENB 4MQQA 3FVUA 4CBRA 3PA9A 4WYGA 2BIGA 3MADA 4ZM3A 1AICA 4OBVA 3QBOA 3NU8A 1WYVB 3OKSA 1UKJA 5K8BA 5FT5A 1D7UA 3RUYA 4HVKA 4ZLVA 4WYAA 3FSLA 2CSTA 3DR4A 2AEUA 1UU1A 1V2EA 2D7ZA 1GD9A 3FVXA 4GRXA 4O6ZA 1ARTA 2BWOA 1YJSA 3WLXA 4JEZA 9AATA 2AY8A 3HVYA 4WYCA 1FC4A 1VP4A 3N5MA 2OQXA 4E3RA 2BI3A 2BKWA 2AY7A 1M0QA 2X5DA 4WP0A 3B1CA 3FZ8A 2BYLA 3I4JA 2E7IA 2JJEA 2FNIA 1BJOA 3A9YA 2HOZA 1KMKA 4WXFA 1WKHA 2HZPA 4CVQA 3A2BA 2YKYA 3GR9A 3I5TA 4ZM4A 4LW4A 2VIAA 5D5SA 1IJIA 1C7NA 2WK7A 4JEYA 2AY9A 4N0BA 4Q75A 1X0MA 3BWNC 1AMRA 3MAFB 2HORA 3FD0A 3GWPA 5IWQA 4R8DA 1OXPA 2W7HA 2VMRA 4CBSA 4R2NA 1LC8A 1AJSA 1ASCA 3W1IA 3WCNA 2O0RA 3A8UX 3EIAA 4JEVA 4AO9A 1MLZA 2HOXA 4ITXA 4OT8A 2AY5A 5EIGB 1RVYA 3VK4A 3AEJC 4RJ0A 3WX9A 4PIWA 5F8VA 1WYUA 1GEYA 3F6TA 2O7CA 3TQXA 3DYDA 2DKBA 5DJ1A 4ZAHA 2R5EA 2VGWA 4UHMA 3GJUA 1SF2A 2W7JA 1ASLA 2CANA 2E7JA 3AELA 2Q7WA 3USFA 4F5JA 2W7KA 2VMSA 3ECDA 3MC6A 3AENA 1AAMA 2W7GA 4BMKA 4RKCA 1MAQA 5LH9A 2OKKA 2G7JA 2PB0A 3LVKA 1FG7A 2QMAA 4Q31A 4KXKA 1WYVA 4GE4A 3LV2A 1LW5A 2FNUA 4ZASA 3EI6A 4PFNA 4E77A 3UWCA 1KL1A 4BHDA 4IY7A 1B5OA 3GZDA 1LK9A 3MBBA 1T3IA 1CS1A 1ZOBA 4GE9A 1SZKA 2W7EA 5G0AA 1O4SA 2BIAA 1I29A 2O1BA 4ADCA 1ASBA 3FVSA 4KYOA 3IF2A 3FFHA 4R5ZA 1S06A 1W7LA 1XI9A 1IX6A 5EFSA 3E77A 5HDMA 1CQ7A 1V72A 4JEXA 4AO4A 2FKIA 2AY1A 1YIYA 4W1XA 4XK1A 4F4EA 1CQ6A 2VMVA 1AY4A 2VMZA 1CZEA 2DKJA 5EUDA 4MSOA 2OGEA 2DGMA 4Q76A 4RKDA 4RITA 4EB7A 3KKIA 2D65A 2R0TA 3R9AA 4ZWVA 4MY5A 1CL2A 1D7VA 3MAFA 1H0CA 1BJOB 2VLFA 2W7DA 3H9XA 1BKGA 2X3LA 3EZ1A 4M2MA 5I92A 1JS3A 1AKAA 5EIGA 4ISYA 1AHYA 3VK3A 3PAAA 2AY4A 5DJ9A 3K28A 4P3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VGS A;  1B5P A;  3NX3 A;  3JWA A;  2D7Y A;  2VMY A;  4ITG A;  4ADB A;  4DBC A;  3JU7 A;  4N0W A;  3RI6 A;  4TMR A;  1B4X A;  3NTJ A;  1DJU A;  1WYU B;  2ZSM A;  3PDB B;  3P6K A;  3VK2 A;  1DGD A;  3LVL B;  4Y0H A;  1LKC A;  2E54 A;  4LNM A;  3Q8N A;  1EG5 A;  4WXG A;  3BCB A;  2CY8 A;  4KAM A;  4TV7 A;  4W91 A;  3EI9 A;  3JW9 A;  1FG3 A;  5M46 A;  5FT4 A;  4F5K A;  3ZRQ A;  5C6U A;  3ASA A;  2ZP7 A;  4CXR A;  1ARS A;  1BT4 A;  3HT4 A;  3EI8 A;  5EUN A;  1N8P A;  4JF0 A;  1BS0 A;  1GBN A;  1LW4 A;  1G7W A;  4RAE A;  1MDZ A;  1RVU A;  5J8Q A;  3GZC A;  4JE5 D;  1AHG A;  3VP6 A;  3HBX A;  3WY7 A;  4XJL A;  3LY1 A;  4AOA A;  5G2Q A;  3D6K A;  4F5H A;  1D7R A;  1YNU A;  4F5L A;  1O62 A;  1AJR A;  2VMX A;  4K2I A;  5FT8 A;  2BWN A;  1I48 A;  1ARH A;  1I43 A;  1G4V A;  4ZDL A;  3AEO A;  4IW7 A;  3FQA A;  1W7M A;  3QPG A;  1ELQ A;  4LNJ A;  1J32 A;  2C0R A;  3EIB A;  2GSA A;  3B1E A;  3PD6 B;  4AZJ A;  1B8G A;  4OCA A;  3F0H A;  2D66 A;  5E3K A;  3TFU A;  2HUU A;  4FFC A;  3CQ6 A;  1CZC A;  1WYT B;  2WKA A;  1Z7D A;  1DJE A;  2AAT A;  3BC8 A;  2GB3 A;  3UE8 A;  2VGT A;  3DC1 A;  1AAW A;  4IX8 A;  1O69 A;  3WZF A;  3W1J A;  1GC2 A;  1BJW A;  2BWP A;  2DGK A;  1RV4 A;  1C4K A;  1GEW A;  1MLY A;  1JG8 A;  4OTL A;  1RV3 A;  4ZSY A;  2JGT A;  1IBJ A;  2QB2 A;  4U2H A;  3FRK A;  4UQV A;  1ZOD A;  4ZWM A;  3E2Z B;  3FQ7 A;  2OKJ A;  1AHF A;  3BV0 A;  4OYT A;  2VMN A;  1G7X A;  1N31 A;  4LNL A;  4ZSW A;  2FQ6 A;  2TPL A;  1C7G A;  3HLM A;  4MGR A;  2OGA A;  1M6S A;  4GDY A;  3G8M A;  5G2P A;  2VMW A;  3AOV A;  3PDB A;  4AH3 A;  2NMP A;  2W8J A;  3BCA A;  2YKX A;  1MDX A;  3N75 A;  3BWN A;  1AIA A;  2HP2 A;  3K40 A;  3N0L A;  2CIN A;  3DU4 A;  1CL1 A;  1B9H A;  4JF1 A;  2WK8 A;  3DOD A;  4XJO A;  1Y4I A;  1MGV A;  4WLH A;  4WD2 A;  4A0F A;  2EH6 A;  1IAX A;  2YCT A;  1V2D A;  3AEJ A;  2R5C B;  1ZC9 A;  3FZ7 A;  4M2K A;  1C0N A;  2BI2 A;  2D64 A;  2VIB A;  4EB5 A;  3ZZK A;  4RM1 A;  1P3W A;  2RFV A;  1M0O A;  1GC3 A;  1VJO A;  1YAA A;  2VMP A;  3ZRP A;  2V1P A;  4FL0 A;  4A0R A;  3IHJ A;  3DXV A;  3BS8 A;  2X5F A;  3ATH A;  4F5M A;  2VMT A;  2BYJ A;  3H7F A;  3K7Y A;  4U1T A;  4H51 A;  3FTB A;  4WYE A;  5M4D A;  1MDO A;  4A6T A;  2C81 A;  1ECX A;  2Z67 A;  2D61 A;  3PD6 A;  3OP7 A;  3NYU A;  3E9K A;  3NYT A;  3M5U A;  2YRR A;  2Z61 A;  3B46 A;  1WYT A;  1SFF A;  3KE3 A;  3LVJ A;  2BI9 A;  3KGX A;  3WGB A;  1QIS A;  3AEP A;  3GSB A;  1SZU A;  1AMS A;  4IXO A;  2Z20 A;  3E2F A;  4RIZ A;  1M0N A;  3UAK A;  1ASA A;  2DOU A;  2VMO A;  5EUE A;  4J8L A;  1TOG A;  1H1C A;  1X29 A;  3F9T A;  1AHE A;  2JJG A;  2Z1Z A;  3L8A A;  4R5F A;  3B8X A;  2W8U A;  3LG0 A;  3QM2 A;  3B1D A;  3E2Z A;  5FT6 A;  1UU2 A;  3NUI A;  1AX4 A;  1ARI A;  1S09 A;  1BJN A;  1D2F A;  4WXB A;  1GC0 A;  1CJ0 A;  4GE7 A;  4LW2 A;  4XJP A;  2VMU A;  3ELE A;  1AKC A;  3NU7 A;  3FFR A;  4F5G A;  1IAY A;  3DR7 A;  1AMQ A;  3BN1 A;  1KKJ A;  3FCR A;  5EAV A;  3AEM C;  1ASG A;  4MQP A;  2QA3 A;  1TAS A;  3BCX A;  1PFF A;  1WST A;  3WKS A;  2ZSL A;  4M2J A;  2VGU A;  1YJZ A;  3CQ4 A;  3DZZ A;  4RJY A;  2VGZ A;  5G4I A;  2F8J A;  4EMY A;  1ASF A;  4W5K A;  2R5C A;  5DX5 A;  3TCM A;  4ATP A;  1IVR A;  2JJF A;  1ASD A;  2BI5 A;  5M4B A;  1YJY A;  1BQD A;  2QBT A;  2EZ1 A;  1SPA A;  3JWB A;  3HDO A;  1E5E A;  3NRA A;  5G4J A;  1V2F A;  1CQ8 A;  2VGV A;  3ACZ A;  4J5U A;  2W8W A;  2EGY A;  1AIB A;  2CH1 A;  4I8A A;  2OAT A;  1VEF A;  4B98 A;  2AY6 A;  1GDE A;  1N2T A;  2ZY4 A;  1EQB A;  1LC5 A;  3CAI A;  3EI5 A;  1QJ3 A;  1M4N A;  1QGN A;  2VI9 A;  2Z1Y A;  4IYO B;  4TN4 A;  4W1V A;  4ZDO A;  1TAR A;  2YRI A;  4OBU A;  4F5F A;  4IXS A;  1AMA A;  4UHN A;  4Y0I A;  3L44 A;  1AY5 A;  2WK9 A;  1YOO A;  4DGT A;  2VMQ A;  2W8T A;  5DB5 A;  4K2B A;  2Z9X A;  1JS6 A;  3WGC A;  3LVM A;  4ADD A;  1S0A A;  1BQA A;  3ZRR A;  2W7I A;  1BJ4 A;  1OHV A;  5D95 A;  1QIT A;  1PMO A;  3NUB A;  4JEW A;  2E7U A;  2HP1 A;  3FQ8 A;  3DXW A;  3H14 A;  3KGW A;  4WB0 B;  4ADE A;  1S08 A;  2W7M A;  1J04 A;  2YOB A;  1W23 A;  1X28 A;  3WCO A;  4BQ0 A;  5BJ4 A;  2ZUK A;  3PIU A;  2PB2 A;  5E5I A;  3I16 A;  2V0Y A;  2GMS A;  1X2A A;  2HUF A;  3G7Q A;  3RBF A;  4UOY A;  5BJ3 A;  4WLJ A;  1KL2 A;  3ASB A;  5EAA A;  1W7N A;  1LS3 A;  1QJ5 A;  3EUC A;  4XEW A;  1JF9 A;  1DKA A;  2W8V A;  3R4T A;  4UHO A;  3ELP A;  1C7O A;  1I41 A;  2GMU A;  1IX7 A;  4A00 A;  3VOM A;  1SZS A;  3NNK A;  3QN6 A;  4LC3 A;  4MKK A;  4WYF A;  2EO5 A;  3RCH B;  3ISL A;  4K2M A;  1GEX A;  3T32 A;  2VYC A;  1KMJ A;  1C9C A;  1EJI A;  3MKJ A;  4Y0D A;  2FN6 A;  4BA4 A;  2CB1 A;  1ASE A;  1TAT A;  2QLR A;  3FKD A;  1U08 A;  4GEB A;  5E4Z A;  5TF5 A;  3AV7 A;  4AZK A;  5M49 A;  3MC6 C;  2Z9W A;  1G4X A;  1DGE A;  2AEV A;  3GET A;  2CH2 A;  4PVF A;  1AY8 A;  3PPL A;  4Q6R A;  4GSA A;  2HUI A;  3RQ1 A;  3W1H A;  4B9B A;  3AOW A;  4XJM A;  2QB3 A;  1ASN A;  2YCN A;  4EU1 A;  3LWS A;  1D7S A;  4IYO A;  4DQ6 A;  2C44 A;  1TOJ A;  2EZ2 A;  2ZJG A;  7AAT A;  1KKP A;  2W7L A;  2BI1 A;  3GZD C;  1Z3Z A;  4F5I A;  4RLG A;  3TAT A;  4W1W A;  5HHY A;  1MAP A;  2ORD A;  2CJH A;  1YIZ A;  4L0O A;  2Z9V A;  1OAT A;  1SVV A;  3AAT A;  3PJ0 A;  3PDX A;  2ZY3 A;  2ZY2 A;  2W7F A;  1TOE A;  3FZ6 A;  4WBT A;  2D5Y A;  3DRD A;  4XAU A;  4WB0 A;  3CBF A;  1IX8 A;  4A0H A;  4WYD A;  1PMM A;  1TOI A;  3QI6 A;  2Z9U A;  2CFB A;  1LC7 A;  2D63 A;  3RBL A;  2HOY A;  2AY3 A;  1OHY A;  3A9X A;  3MEB A;  3CQ5 A;  3NYS A;  1WKG A;  3FDB A;  4HF8 A;  2GQN A;  3MAU A;  3NDN A;  3JZL A;  3FDD A;  2YKV A;  2DR1 A;  5AX8 A;  2ZY5 A;  1W3U A;  4ZDP A;  1OHW A;  3P1T A;  2CTZ A;  1TPL A;  3PGY A;  3HL2 A;  1GCK A;  3QHX A;  2R2N A;  3GBX A;  4ATQ A;  1ASM A;  4NOG A;  2CJG A;  3COG A;  1TOK A;  5LHA A;  2ZYJ A;  4A6R A;  1AHX A;  3EZS A;  1B9I A;  2AY2 A;  2G6W A;  3BB8 A;  4EFF A;  3RCH A;  1PG8 A;  5G09 A;  8AAT A;  1DJ9 A;  1UU0 A;  1DFO A;  2ZC0 A;  4E3Q A;  4OMA A;  2JIS A;  4A72 A;  1QZ9 A;  1IUG A;  2EPJ A;  3EI7 A;  1O61 A;  2XBN A;  3A9Z A;  4MKJ A;  4W8I A;  2FYF A;  5JAY A;  4MQR A;  1XEY A;  2BHX A;  4IXZ A;  1DTY A;  1BW0 A;  3E2Y A;  4JE5 A;  3E6G A;  4CXQ A;  3ZZJ A;  2CJD A;  2VLH A;  5EQC A;  3HMU A;  3WKR A;  3VAX A;  2DGL A;  2YHK A;  5F9S A;  3AEM A;  3JTX A;  1ORD A;  5HXX A;  1OXO A;  2BIE A;  1AJS B;  4QGR A;  2FM1 A;  4A6U A;  3II0 A;  1ARG A;  3QGU A;  4XQ2 A;  2XH1 A;  4PFF A;  3BWO A;  2VI8 A;  4A0G A;  3HQT A;  1E5F A;  1ELU A;  2JJH A;  1GC4 A;  1M32 A;  1S07 A;  2PO3 A;  2JG2 A;  2X8U A;  4OC9 A;  2YCP A;  1QIR A;  2C7T A;  4P7Y A;  3G0T A;  4BA5 A;  4E1O A;  1M0P A;  2YKU A;  1AKB A;  1M7Y A;  3TFT A;  3AEN B;  4MQQ A;  3FVU A;  4CBR A;  3PA9 A;  4WYG A;  2BIG A;  3MAD A;  4ZM3 A;  1AIC A;  4OBV A;  3QBO A;  3NU8 A;  1WYV B;  3OKS A;  1UKJ A;  5K8B A;  5FT5 A;  1D7U A;  3RUY A;  4HVK A;  4ZLV A;  4WYA A;  3FSL A;  2CST A;  3DR4 A;  2AEU A;  1UU1 A;  1V2E A;  2D7Z A;  1GD9 A;  3FVX A;  4GRX A;  4O6Z A;  1ART A;  2BWO A;  1YJS A;  3WLX A;  4JEZ A;  9AAT A;  2AY8 A;  3HVY A;  4WYC A;  1FC4 A;  1VP4 A;  3N5M A;  2OQX A;  4E3R A;  2BI3 A;  2BKW A;  2AY7 A;  1M0Q A;  2X5D A;  4WP0 A;  3B1C A;  3FZ8 A;  2BYL A;  3I4J A;  2E7I A;  2JJE A;  2FNI A;  1BJO A;  3A9Y A;  2HOZ A;  1KMK A;  4WXF A;  1WKH A;  2HZP A;  4CVQ A;  3A2B A;  2YKY A;  3GR9 A;  3I5T A;  4ZM4 A;  4LW4 A;  2VIA A;  5D5S A;  1IJI A;  1C7N A;  2WK7 A;  4JEY A;  2AY9 A;  4N0B A;  4Q75 A;  1X0M A;  3BWN C;  1AMR A;  3MAF B;  2HOR A;  3FD0 A;  3GWP A;  5IWQ A;  4R8D A;  1OXP A;  2W7H A;  2VMR A;  4CBS A;  4R2N A;  1LC8 A;  1AJS A;  1ASC A;  3W1I A;  3WCN A;  2O0R A;  3A8U X;  3EIA A;  4JEV A;  4AO9 A;  1MLZ A;  2HOX A;  4ITX A;  4OT8 A;  2AY5 A;  5EIG B;  1RVY A;  3VK4 A;  3AEJ C;  4RJ0 A;  3WX9 A;  4PIW A;  5F8V A;  1WYU A;  1GEY A;  3F6T A;  2O7C A;  3TQX A;  3DYD A;  2DKB A;  5DJ1 A;  4ZAH A;  2R5E A;  2VGW A;  4UHM A;  3GJU A;  1SF2 A;  2W7J A;  1ASL A;  2CAN A;  2E7J A;  3AEL A;  2Q7W A;  3USF A;  4F5J A;  2W7K A;  2VMS A;  3ECD A;  3MC6 A;  3AEN A;  1AAM A;  2W7G A;  4BMK A;  4RKC A;  1MAQ A;  5LH9 A;  2OKK A;  2PB0 A;  3LVK A;  1FG7 A;  2QMA A;  4Q31 A;  4KXK A;  1WYV A;  4GE4 A;  3LV2 A;  1LW5 A;  2FNU A;  4ZAS A;  3EI6 A;  4PFN A;  4E77 A;  3UWC A;  1KL1 A;  4BHD A;  4IY7 A;  1B5O A;  3GZD A;  1LK9 A;  3MBB A;  1T3I A;  1CS1 A;  1ZOB A;  4GE9 A;  1SZK A;  2W7E A;  5G0A A;  1O4S A;  2BIA A;  1I29 A;  2O1B A;  4ADC A;  1ASB A;  3FVS A;  4KYO A;  3IF2 A;  3FFH A;  4R5Z A;  1S06 A;  1W7L A;  1XI9 A;  1IX6 A;  5EFS A;  3E77 A;  5HDM A;  1CQ7 A;  1V72 A;  4JEX A;  4AO4 A;  2AY1 A;  1YIY A;  4W1X A;  4XK1 A;  4F4E A;  1CQ6 A;  2VMV A;  1AY4 A;  2VMZ A;  1CZE A;  2DKJ A;  5EUD A;  4MSO A;  2OGE A;  2DGM A;  4Q76 A;  4RKD A;  4RIT A;  4EB7 A;  3KKI A;  2D65 A;  2R0T A;  3R9A A;  4ZWV A;  4MY5 A;  1CL2 A;  1D7V A;  3MAF A;  1H0C A;  1BJO B;  2VLF A;  2W7D A;  1BKG A;  2X3L A;  3EZ1 A;  4M2M A;  5I92 A;  1JS3 A;  1AKA A;  5EIG A;  4ISY A;  1AHY A;  3VK3 A;  3PAA A;  2AY4 A;  5DJ9 A;  3K28 A;  4P3M A; 
#chains in the Genus database with same CATH topology
 2VGS A;  1B5P A;  3NX3 A;  3JWA A;  2D7Y A;  2VMY A;  4ITG A;  4ADB A;  4DBC A;  3JU7 A;  4N0W A;  3RI6 A;  4TMR A;  3N4R A;  1B4X A;  3NTJ A;  1DJU A;  1WYU B;  2ZSM A;  3PDB B;  3P6K A;  3VK2 A;  1DGD A;  3LVL B;  4Y0H A;  1LKC A;  2E54 A;  4LNM A;  3Q8N A;  1EG5 A;  4WXG A;  3BCB A;  2CY8 A;  4KAM A;  4TV7 A;  4W91 A;  3EI9 A;  3JW9 A;  1FG3 A;  5M46 A;  5FT4 A;  4F5K A;  3ZRQ A;  5C6U A;  3ASA A;  2ZP7 A;  4CXR A;  1ARS A;  1BT4 A;  3HT4 A;  3EI8 A;  5EUN A;  1N8P A;  4JF0 A;  1BS0 A;  1GBN A;  1LW4 A;  1G7W A;  4RAE A;  1MDZ A;  1RVU A;  5J8Q A;  3GZC A;  4JE5 D;  1AHG A;  3VP6 A;  3HBX A;  3WY7 A;  4XJL A;  3LY1 A;  4AOA A;  5G2Q A;  3D6K A;  4F5H A;  1D7R A;  1YNU A;  4F5L A;  1O62 A;  1AJR A;  2VMX A;  4K2I A;  5FT8 A;  2BWN A;  1I48 A;  1ARH A;  1I43 A;  1G4V A;  4ZDL A;  3AEO A;  4IW7 A;  3FQA A;  1W7M A;  3QPG A;  1ELQ A;  4LNJ A;  1J32 A;  2C0R A;  3EIB A;  2GSA A;  3B1E A;  3PD6 B;  4AZJ A;  1B8G A;  4OCA A;  3F0H A;  2D66 A;  5E3K A;  3TFU A;  2HUU A;  4FFC A;  3CQ6 A;  1CZC A;  1WYT B;  2WKA A;  1Z7D A;  1DJE A;  2AAT A;  3BC8 A;  2GB3 A;  3UE8 A;  2VGT A;  3DC1 A;  1AAW A;  4IX8 A;  1O69 A;  3WZF A;  3W1J A;  1GC2 A;  1BJW A;  2BWP A;  2A1V A;  2DGK A;  1RV4 A;  1C4K A;  1GEW A;  1MLY A;  1JG8 A;  4OTL A;  1RV3 A;  4ZSY A;  2JGT A;  1IBJ A;  2QB2 A;  4U2H A;  3FRK A;  4UQV A;  1ZOD A;  4ZWM A;  3E2Z B;  3FQ7 A;  2OKJ A;  1AHF A;  3BV0 A;  4OYT A;  2VMN A;  1G7X A;  1N31 A;  4LNL A;  4ZSW A;  2FQ6 A;  2TPL A;  1C7G A;  3HLM A;  4MGR A;  2OGA A;  1M6S A;  4GDY A;  3G8M A;  5G2P A;  2VMW A;  3AOV A;  3PDB A;  4AH3 A;  2NMP A;  2W8J A;  3BCA A;  2YKX A;  1MDX A;  3N75 A;  3BWN A;  1AIA A;  2HP2 A;  3K40 A;  3N0L A;  2CIN A;  3DU4 A;  1CL1 A;  1B9H A;  4JF1 A;  2WK8 A;  3DOD A;  4XJO A;  1Y4I A;  1MGV A;  4WLH A;  4WD2 A;  4A0F A;  2EH6 A;  1IAX A;  2YCT A;  1V2D A;  3AEJ A;  2R5C B;  1ZC9 A;  3FZ7 A;  4M2K A;  1C0N A;  2BI2 A;  2D64 A;  2VIB A;  4EB5 A;  3ZZK A;  4RM1 A;  1P3W A;  2RFV A;  1M0O A;  1GC3 A;  1VJO A;  1YAA A;  2VMP A;  3ZRP A;  2V1P A;  4FL0 A;  4A0R A;  3IHJ A;  3DXV A;  3BS8 A;  2X5F A;  3ATH A;  4F5M A;  2VMT A;  2BYJ A;  3H7F A;  3K7Y A;  4U1T A;  4H51 A;  3FTB A;  4WYE A;  5M4D A;  1MDO A;  4A6T A;  2C81 A;  1ECX A;  2Z67 A;  2D61 A;  3PD6 A;  3OP7 A;  3NYU A;  3E9K A;  3NYT A;  3M5U A;  2YRR A;  2Z61 A;  3B46 A;  1WYT A;  1SFF A;  3KE3 A;  3LVJ A;  2BI9 A;  3KGX A;  3WGB A;  1QIS A;  3AEP A;  3GSB A;  1SZU A;  1AMS A;  4IXO A;  2Z20 A;  3E2F A;  4RIZ A;  1M0N A;  3UAK A;  1ASA A;  2DOU A;  2VMO A;  5EUE A;  4J8L A;  1TOG A;  1H1C A;  1X29 A;  3F9T A;  1AHE A;  2JJG A;  2Z1Z A;  3L8A A;  4R5F A;  3B8X A;  2W8U A;  3LG0 A;  3QM2 A;  3B1D A;  3E2Z A;  5FT6 A;  1UU2 A;  3NUI A;  1AX4 A;  1ARI A;  1S09 A;  1BJN A;  1D2F A;  4WXB A;  4H63 Q;  1GC0 A;  1CJ0 A;  4GE7 A;  4LW2 A;  4XJP A;  2VMU A;  3ELE A;  1AKC A;  3NU7 A;  3FFR A;  4F5G A;  1IAY A;  3DR7 A;  1AMQ A;  3BN1 A;  1KKJ A;  3FCR A;  5EAV A;  3AEM C;  1ASG A;  4MQP A;  2QA3 A;  1TAS A;  3BCX A;  1PFF A;  1WST A;  3WKS A;  3N4X A;  2ZSL A;  4M2J A;  2VGU A;  1YJZ A;  3CQ4 A;  3DZZ A;  4RJY A;  2VGZ A;  5G4I A;  2F8J A;  4EMY A;  1ASF A;  4W5K A;  2R5C A;  5DX5 A;  3TCM A;  4ATP A;  1IVR A;  2JJF A;  1ASD A;  2BI5 A;  5M4B A;  1YJY A;  1BQD A;  2QBT A;  2EZ1 A;  1SPA A;  3JWB A;  3HDO A;  1E5E A;  1KAF A;  3NRA A;  5G4J A;  1V2F A;  1CQ8 A;  2VGV A;  3ACZ A;  4J5U A;  3N4S A;  2W8W A;  2EGY A;  1AIB A;  2CH1 A;  4I8A A;  2OAT A;  1VEF A;  4B98 A;  2AY6 A;  2KFP A;  1GDE A;  1N2T A;  2ZY4 A;  1EQB A;  1LC5 A;  3CAI A;  3EI5 A;  1QJ3 A;  1M4N A;  1QGN A;  2VI9 A;  2Z1Y A;  4IYO B;  4TN4 A;  4W1V A;  4ZDO A;  1TAR A;  2YRI A;  4OBU A;  4F5F A;  4IXS A;  1AMA A;  4UHN A;  4Y0I A;  3L44 A;  1AY5 A;  2WK9 A;  3N7N A;  1YOO A;  4DGT A;  5KTB A;  2VMQ A;  2W8T A;  5DB5 A;  4K2B A;  2Z9X A;  2QSR A;  1JS6 A;  3WGC A;  3LVM A;  4ADD A;  1S0A A;  1BQA A;  3ZRR A;  2W7I A;  1BJ4 A;  1OHV A;  5D95 A;  1QIT A;  1PMO A;  3NUB A;  4JEW A;  2E7U A;  2HP1 A;  3FQ8 A;  3DXW A;  3H14 A;  3KGW A;  4WB0 B;  4ADE A;  1S08 A;  2W7M A;  1J04 A;  2YOB A;  1W23 A;  1X28 A;  3WCO A;  4BQ0 A;  5BJ4 A;  2ZUK A;  3PIU A;  2PB2 A;  5E5I A;  3I16 A;  2V0Y A;  2GMS A;  1X2A A;  2HUF A;  3G7Q A;  3RBF A;  4UOY A;  5BJ3 A;  4WLJ A;  1KL2 A;  3ASB A;  5EAA A;  1W7N A;  1LS3 A;  1QJ5 A;  3EUC A;  4XEW A;  1JF9 A;  1DKA A;  2W8V A;  3R4T A;  4UHO A;  3ELP A;  1C7O A;  1I41 A;  2GMU A;  1IX7 A;  4A00 A;  3VOM A;  1SZS A;  3NNK A;  3QN6 A;  4LC3 A;  4MKK A;  4WYF A;  2EO5 A;  3RCH B;  3ISL A;  4K2M A;  1GEX A;  3T32 A;  2VYC A;  1KMJ A;  1C9C A;  1EJI A;  3MKJ A;  4Y0D A;  2FN6 A;  4BA4 A;  2CB1 A;  1ASE A;  1TAT A;  2QLR A;  3FKD A;  1U08 A;  4GEB A;  5E4Z A;  5TF5 A;  3AV7 A;  4AZK A;  5M49 A;  3MC6 C;  2Z9W A;  1G4X A;  1DGE A;  2AEV A;  3GET A;  2CH2 A;  4PVF A;  1AY8 A;  3PPL A;  4Q6R A;  4GSA A;  2HUI A;  3RQ1 A;  3W1H A;  4B9B A;  3AOW A;  2EYQ A;  4XJM A;  2QB3 A;  1ASN A;  2YCN A;  4EU1 A;  3LWS A;  1D7S A;  4IYO A;  4DQ6 A;  2C44 A;  1TOJ A;  2EZ2 A;  2ZJG A;  7AAT A;  1KKP A;  2W7L A;  2BI1 A;  3GZD C;  1Z3Z A;  4F5I A;  4RLG A;  3TAT A;  4W1W A;  5HHY A;  1MAP A;  2ORD A;  2CJH A;  1YIZ A;  4L0O A;  2Z9V A;  1OAT A;  1SVV A;  3AAT A;  3PJ0 A;  3PDX A;  2ZY3 A;  2ZY2 A;  2W7F A;  1TOE A;  3FZ6 A;  4WBT A;  2D5Y A;  3DRD A;  4XAU A;  4WB0 A;  3CBF A;  1IX8 A;  4K05 A;  4A0H A;  4WYD A;  1PMM A;  1TOI A;  3QI6 A;  2Z9U A;  2CFB A;  1LC7 A;  2D63 A;  3RBL A;  2HOY A;  2AY3 A;  1OHY A;  3A9X A;  3MEB A;  3CQ5 A;  3NYS A;  1WKG A;  3FDB A;  4HF8 A;  2GQN A;  3MAU A;  3NDN A;  3JZL A;  3FDD A;  2YKV A;  2DR1 A;  5AX8 A;  2ZY5 A;  1W3U A;  4ZDP A;  1OHW A;  3P1T A;  2CTZ A;  1TPL A;  3PGY A;  3HL2 A;  1GCK A;  3QHX A;  2R2N A;  3GBX A;  4ATQ A;  1ASM A;  4NOG A;  2CJG A;  3COG A;  1TOK A;  5LHA A;  2ZYJ A;  4A6R A;  1AHX A;  3EZS A;  1B9I A;  2AY2 A;  2G6W A;  3BB8 A;  4EFF A;  3RCH A;  1PG8 A;  5G09 A;  8AAT A;  1DJ9 A;  1UU0 A;  1DFO A;  2ZC0 A;  4E3Q A;  4OMA A;  2JIS A;  4A72 A;  1QZ9 A;  1IUG A;  2EPJ A;  3EI7 A;  1O61 A;  2XBN A;  3A9Z A;  4MKJ A;  4W8I A;  2FYF A;  5JAY A;  4MQR A;  1XEY A;  2BHX A;  4IXZ A;  1DTY A;  1BW0 A;  3E2Y A;  4JE5 A;  3E6G A;  4CXQ A;  2WB6 A;  3ZZJ A;  2CJD A;  2VLH A;  5EQC A;  3HMU A;  3WKR A;  3VAX A;  2DGL A;  2YHK A;  5F9S A;  3AEM A;  3JTX A;  1ORD A;  5HXX A;  1OXO A;  2BIE A;  1AJS B;  4QGR A;  2FM1 A;  4A6U A;  3II0 A;  1ARG A;  3QGU A;  4XQ2 A;  2XH1 A;  4PFF A;  3BWO A;  2VI8 A;  4A0G A;  3HQT A;  1E5F A;  1ELU A;  2JJH A;  1GC4 A;  1M32 A;  1S07 A;  2PO3 A;  2JG2 A;  2X8U A;  4OC9 A;  2YCP A;  1QIR A;  2C7T A;  4P7Y A;  3G0T A;  4BA5 A;  4E1O A;  1M0P A;  2YKU A;  1AKB A;  1M7Y A;  3TFT A;  3AEN B;  4MQQ A;  3FVU A;  4CBR A;  3PA9 A;  4WYG A;  2BIG A;  3MAD A;  4ZM3 A;  1AIC A;  4OBV A;  3QBO A;  3NU8 A;  1WYV B;  3OKS A;  1UKJ A;  5K8B A;  5FT5 A;  1D7U A;  3RUY A;  4HVK A;  4ZLV A;  4WYA A;  3FSL A;  2CST A;  3DR4 A;  2AEU A;  1UU1 A;  1V2E A;  2D7Z A;  1GD9 A;  3FVX A;  4GRX A;  4O6Z A;  1ART A;  2BWO A;  1YJS A;  3WLX A;  4JEZ A;  9AAT A;  2AY8 A;  3HVY A;  4WYC A;  1FC4 A;  1VP4 A;  3N5M A;  2OQX A;  4E3R A;  2BI3 A;  2BKW A;  2AY7 A;  1M0Q A;  2X5D A;  4WP0 A;  3B1C A;  3FZ8 A;  2BYL A;  3I4J A;  2E7I A;  2JJE A;  2FNI A;  1BJO A;  3A9Y A;  2HOZ A;  1KMK A;  4WXF A;  1WKH A;  2HZP A;  4CVQ A;  3A2B A;  2YKY A;  3GR9 A;  3I5T A;  4ZM4 A;  4LW4 A;  2VIA A;  5D5S A;  1IJI A;  1C7N A;  2WK7 A;  4JEY A;  2AY9 A;  4N0B A;  4Q75 A;  1X0M A;  3BWN C;  1AMR A;  3MAF B;  2HOR A;  3FD0 A;  3GWP A;  5IWQ A;  4R8D A;  1OXP A;  2W7H A;  2VMR A;  4CBS A;  4R2N A;  1LC8 A;  1AJS A;  1ASC A;  3W1I A;  3WCN A;  2O0R A;  3A8U X;  3EIA A;  4JEV A;  4AO9 A;  1MLZ A;  2HOX A;  4ITX A;  4OT8 A;  2AY5 A;  5EIG B;  1RVY A;  3VK4 A;  3AEJ C;  4RJ0 A;  3WX9 A;  4PIW A;  5F8V A;  1WYU A;  1GEY A;  3F6T A;  2O7C A;  3TQX A;  3DYD A;  2DKB A;  5DJ1 A;  4ZAH A;  2R5E A;  2VGW A;  4UHM A;  3GJU A;  1SF2 A;  2W7J A;  1ASL A;  2CAN A;  2E7J A;  3AEL A;  2Q7W A;  3USF A;  4F5J A;  2W7K A;  2VMS A;  3ECD A;  3MC6 A;  3AEN A;  1AAM A;  2W7G A;  4BMK A;  4RKC A;  1MAQ A;  5LH9 A;  2OKK A;  2G7J A;  2PB0 A;  3LVK A;  1FG7 A;  2QMA A;  4Q31 A;  4KXK A;  1WYV A;  4GE4 A;  3LV2 A;  1LW5 A;  2FNU A;  4ZAS A;  3EI6 A;  4PFN A;  4E77 A;  3UWC A;  1KL1 A;  4BHD A;  4IY7 A;  1B5O A;  3GZD A;  1LK9 A;  3MBB A;  1T3I A;  1CS1 A;  1ZOB A;  4GE9 A;  1SZK A;  2W7E A;  5G0A A;  1O4S A;  2BIA A;  1I29 A;  2O1B A;  4ADC A;  1ASB A;  3FVS A;  4KYO A;  3IF2 A;  3FFH A;  4R5Z A;  1S06 A;  1W7L A;  1XI9 A;  1IX6 A;  5EFS A;  3E77 A;  5HDM A;  1CQ7 A;  1V72 A;  4JEX A;  4AO4 A;  2FKI A;  2AY1 A;  1YIY A;  4W1X A;  4XK1 A;  4F4E A;  1CQ6 A;  2VMV A;  1AY4 A;  2VMZ A;  1CZE A;  2DKJ A;  5EUD A;  4MSO A;  2OGE A;  2DGM A;  4Q76 A;  4RKD A;  4RIT A;  4EB7 A;  3KKI A;  2D65 A;  2R0T A;  3R9A A;  4ZWV A;  4MY5 A;  1CL2 A;  1D7V A;  3MAF A;  1H0C A;  1BJO B;  2VLF A;  2W7D A;  3H9X A;  1BKG A;  2X3L A;  3EZ1 A;  4M2M A;  5I92 A;  1JS3 A;  1AKA A;  5EIG A;  4ISY A;  1AHY A;  3VK3 A;  3PAA A;  2AY4 A;  5DJ9 A;  3K28 A;  4P3M A; 
#chains in the Genus database with same CATH homology
 2VGS A;  1B5P A;  3NX3 A;  3JWA A;  2D7Y A;  2VMY A;  4ITG A;  4ADB A;  4DBC A;  3JU7 A;  4N0W A;  3RI6 A;  4TMR A;  3N4R A;  1B4X A;  3NTJ A;  1DJU A;  1WYU B;  2ZSM A;  3PDB B;  3P6K A;  3VK2 A;  1DGD A;  3LVL B;  4Y0H A;  1LKC A;  2E54 A;  4LNM A;  3Q8N A;  1EG5 A;  4WXG A;  3BCB A;  2CY8 A;  4KAM A;  4TV7 A;  4W91 A;  3EI9 A;  3JW9 A;  1FG3 A;  5M46 A;  5FT4 A;  4F5K A;  3ZRQ A;  5C6U A;  3ASA A;  2ZP7 A;  4CXR A;  1ARS A;  1BT4 A;  3HT4 A;  3EI8 A;  5EUN A;  1N8P A;  4JF0 A;  1BS0 A;  1GBN A;  1LW4 A;  1G7W A;  4RAE A;  1MDZ A;  1RVU A;  5J8Q A;  3GZC A;  4JE5 D;  1AHG A;  3VP6 A;  3HBX A;  3WY7 A;  4XJL A;  3LY1 A;  4AOA A;  5G2Q A;  3D6K A;  4F5H A;  1D7R A;  1YNU A;  4F5L A;  1O62 A;  1AJR A;  2VMX A;  4K2I A;  5FT8 A;  2BWN A;  1I48 A;  1ARH A;  1I43 A;  1G4V A;  4ZDL A;  3AEO A;  4IW7 A;  3FQA A;  1W7M A;  3QPG A;  1ELQ A;  4LNJ A;  1J32 A;  2C0R A;  3EIB A;  2GSA A;  3B1E A;  3PD6 B;  4AZJ A;  1B8G A;  4OCA A;  3F0H A;  2D66 A;  5E3K A;  3TFU A;  2HUU A;  4FFC A;  3CQ6 A;  1CZC A;  1WYT B;  2WKA A;  1Z7D A;  1DJE A;  2AAT A;  3BC8 A;  2GB3 A;  3UE8 A;  2VGT A;  3DC1 A;  1AAW A;  4IX8 A;  1O69 A;  3WZF A;  3W1J A;  1GC2 A;  1BJW A;  2BWP A;  2A1V A;  2DGK A;  1RV4 A;  1C4K A;  1GEW A;  1MLY A;  1JG8 A;  4OTL A;  1RV3 A;  4ZSY A;  2JGT A;  1IBJ A;  2QB2 A;  4U2H A;  3FRK A;  4UQV A;  1ZOD A;  4ZWM A;  3E2Z B;  3FQ7 A;  2OKJ A;  1AHF A;  3BV0 A;  4OYT A;  2VMN A;  1G7X A;  1N31 A;  4LNL A;  4ZSW A;  2FQ6 A;  2TPL A;  1C7G A;  3HLM A;  4MGR A;  2OGA A;  1M6S A;  4GDY A;  3G8M A;  5G2P A;  2VMW A;  3AOV A;  3PDB A;  4AH3 A;  2NMP A;  2W8J A;  3BCA A;  2YKX A;  1MDX A;  3N75 A;  3BWN A;  1AIA A;  2HP2 A;  3K40 A;  3N0L A;  2CIN A;  3DU4 A;  1CL1 A;  1B9H A;  4JF1 A;  2WK8 A;  3DOD A;  4XJO A;  1Y4I A;  1MGV A;  4WLH A;  4WD2 A;  4A0F A;  2EH6 A;  1IAX A;  2YCT A;  1V2D A;  3AEJ A;  2R5C B;  1ZC9 A;  3FZ7 A;  4M2K A;  1C0N A;  2BI2 A;  2D64 A;  2VIB A;  4EB5 A;  3ZZK A;  4RM1 A;  1P3W A;  2RFV A;  1M0O A;  1GC3 A;  1VJO A;  1YAA A;  2VMP A;  3ZRP A;  2V1P A;  4FL0 A;  4A0R A;  3IHJ A;  3DXV A;  3BS8 A;  2X5F A;  3ATH A;  4F5M A;  2VMT A;  2BYJ A;  3H7F A;  3K7Y A;  4U1T A;  4H51 A;  3FTB A;  4WYE A;  5M4D A;  1MDO A;  4A6T A;  2C81 A;  1ECX A;  2Z67 A;  2D61 A;  3PD6 A;  3OP7 A;  3NYU A;  3E9K A;  3NYT A;  3M5U A;  2YRR A;  2Z61 A;  3B46 A;  1WYT A;  1SFF A;  3KE3 A;  3LVJ A;  2BI9 A;  3KGX A;  3WGB A;  1QIS A;  3AEP A;  3GSB A;  1SZU A;  1AMS A;  4IXO A;  2Z20 A;  3E2F A;  4RIZ A;  1M0N A;  3UAK A;  1ASA A;  2DOU A;  2VMO A;  5EUE A;  4J8L A;  1TOG A;  1H1C A;  1X29 A;  3F9T A;  1AHE A;  2JJG A;  2Z1Z A;  3L8A A;  4R5F A;  3B8X A;  2W8U A;  3LG0 A;  3QM2 A;  3B1D A;  3E2Z A;  5FT6 A;  1UU2 A;  3NUI A;  1AX4 A;  1ARI A;  1S09 A;  1BJN A;  1D2F A;  4WXB A;  4H63 Q;  1GC0 A;  1CJ0 A;  4GE7 A;  4LW2 A;  4XJP A;  2VMU A;  3ELE A;  1AKC A;  3NU7 A;  3FFR A;  4F5G A;  1IAY A;  3DR7 A;  1AMQ A;  3BN1 A;  1KKJ A;  3FCR A;  5EAV A;  3AEM C;  1ASG A;  4MQP A;  2QA3 A;  1TAS A;  3BCX A;  1PFF A;  1WST A;  3WKS A;  3N4X A;  2ZSL A;  4M2J A;  2VGU A;  1YJZ A;  3CQ4 A;  3DZZ A;  4RJY A;  2VGZ A;  5G4I A;  2F8J A;  4EMY A;  1ASF A;  4W5K A;  2R5C A;  5DX5 A;  3TCM A;  4ATP A;  1IVR A;  2JJF A;  1ASD A;  2BI5 A;  5M4B A;  1YJY A;  1BQD A;  2QBT A;  2EZ1 A;  1SPA A;  3JWB A;  3HDO A;  1E5E A;  3NRA A;  5G4J A;  1V2F A;  1CQ8 A;  2VGV A;  3ACZ A;  4J5U A;  3N4S A;  2W8W A;  2EGY A;  1AIB A;  2CH1 A;  4I8A A;  2OAT A;  1VEF A;  4B98 A;  2AY6 A;  2KFP A;  1GDE A;  1N2T A;  2ZY4 A;  1EQB A;  1LC5 A;  3CAI A;  3EI5 A;  1QJ3 A;  1M4N A;  1QGN A;  2VI9 A;  2Z1Y A;  4IYO B;  4TN4 A;  4W1V A;  4ZDO A;  1TAR A;  2YRI A;  4OBU A;  4F5F A;  4IXS A;  1AMA A;  4UHN A;  4Y0I A;  3L44 A;  1AY5 A;  2WK9 A;  3N7N A;  1YOO A;  4DGT A;  5KTB A;  2VMQ A;  2W8T A;  5DB5 A;  4K2B A;  2Z9X A;  2QSR A;  1JS6 A;  3WGC A;  3LVM A;  4ADD A;  1S0A A;  1BQA A;  3ZRR A;  2W7I A;  1BJ4 A;  1OHV A;  5D95 A;  1QIT A;  1PMO A;  3NUB A;  4JEW A;  2E7U A;  2HP1 A;  3FQ8 A;  3DXW A;  3H14 A;  3KGW A;  4WB0 B;  4ADE A;  1S08 A;  2W7M A;  1J04 A;  2YOB A;  1W23 A;  1X28 A;  3WCO A;  4BQ0 A;  5BJ4 A;  2ZUK A;  3PIU A;  2PB2 A;  5E5I A;  3I16 A;  2V0Y A;  2GMS A;  1X2A A;  2HUF A;  3G7Q A;  3RBF A;  4UOY A;  5BJ3 A;  4WLJ A;  1KL2 A;  3ASB A;  5EAA A;  1W7N A;  1LS3 A;  1QJ5 A;  3EUC A;  4XEW A;  1JF9 A;  1DKA A;  2W8V A;  3R4T A;  4UHO A;  3ELP A;  1C7O A;  1I41 A;  2GMU A;  1IX7 A;  4A00 A;  3VOM A;  1SZS A;  3NNK A;  3QN6 A;  4LC3 A;  4MKK A;  4WYF A;  2EO5 A;  3RCH B;  3ISL A;  4K2M A;  1GEX A;  3T32 A;  2VYC A;  1KMJ A;  1C9C A;  1EJI A;  3MKJ A;  4Y0D A;  2FN6 A;  4BA4 A;  2CB1 A;  1ASE A;  1TAT A;  2QLR A;  3FKD A;  1U08 A;  4GEB A;  5E4Z A;  5TF5 A;  3AV7 A;  4AZK A;  5M49 A;  3MC6 C;  2Z9W A;  1G4X A;  1DGE A;  2AEV A;  3GET A;  2CH2 A;  4PVF A;  1AY8 A;  3PPL A;  4Q6R A;  4GSA A;  2HUI A;  3RQ1 A;  3W1H A;  4B9B A;  3AOW A;  2EYQ A;  4XJM A;  2QB3 A;  1ASN A;  2YCN A;  4EU1 A;  3LWS A;  1D7S A;  4IYO A;  4DQ6 A;  2C44 A;  1TOJ A;  2EZ2 A;  2ZJG A;  7AAT A;  1KKP A;  2W7L A;  2BI1 A;  3GZD C;  1Z3Z A;  4F5I A;  4RLG A;  3TAT A;  4W1W A;  5HHY A;  1MAP A;  2ORD A;  2CJH A;  1YIZ A;  4L0O A;  2Z9V A;  1OAT A;  1SVV A;  3AAT A;  3PJ0 A;  3PDX A;  2ZY3 A;  2ZY2 A;  2W7F A;  1TOE A;  3FZ6 A;  4WBT A;  2D5Y A;  3DRD A;  4XAU A;  4WB0 A;  3CBF A;  1IX8 A;  4K05 A;  4A0H A;  4WYD A;  1PMM A;  1TOI A;  3QI6 A;  2Z9U A;  2CFB A;  1LC7 A;  2D63 A;  3RBL A;  2HOY A;  2AY3 A;  1OHY A;  3A9X A;  3MEB A;  3CQ5 A;  3NYS A;  1WKG A;  3FDB A;  4HF8 A;  2GQN A;  3MAU A;  3NDN A;  3JZL A;  3FDD A;  2YKV A;  2DR1 A;  5AX8 A;  2ZY5 A;  1W3U A;  4ZDP A;  1OHW A;  3P1T A;  2CTZ A;  1TPL A;  3PGY A;  3HL2 A;  1GCK A;  3QHX A;  2R2N A;  3GBX A;  4ATQ A;  1ASM A;  4NOG A;  2CJG A;  3COG A;  1TOK A;  5LHA A;  2ZYJ A;  4A6R A;  1AHX A;  3EZS A;  1B9I A;  2AY2 A;  2G6W A;  3BB8 A;  4EFF A;  3RCH A;  1PG8 A;  5G09 A;  8AAT A;  1DJ9 A;  1UU0 A;  1DFO A;  2ZC0 A;  4E3Q A;  4OMA A;  2JIS A;  4A72 A;  1QZ9 A;  1IUG A;  2EPJ A;  3EI7 A;  1O61 A;  2XBN A;  3A9Z A;  4MKJ A;  4W8I A;  2FYF A;  5JAY A;  4MQR A;  1XEY A;  2BHX A;  4IXZ A;  1DTY A;  1BW0 A;  3E2Y A;  4JE5 A;  3E6G A;  4CXQ A;  2WB6 A;  3ZZJ A;  2CJD A;  2VLH A;  5EQC A;  3HMU A;  3WKR A;  3VAX A;  2DGL A;  2YHK A;  5F9S A;  3AEM A;  3JTX A;  1ORD A;  5HXX A;  1OXO A;  2BIE A;  1AJS B;  4QGR A;  2FM1 A;  4A6U A;  3II0 A;  1ARG A;  3QGU A;  4XQ2 A;  2XH1 A;  4PFF A;  3BWO A;  2VI8 A;  4A0G A;  3HQT A;  1E5F A;  1ELU A;  2JJH A;  1GC4 A;  1M32 A;  1S07 A;  2PO3 A;  2JG2 A;  2X8U A;  4OC9 A;  2YCP A;  1QIR A;  2C7T A;  4P7Y A;  3G0T A;  4BA5 A;  4E1O A;  1M0P A;  2YKU A;  1AKB A;  1M7Y A;  3TFT A;  3AEN B;  4MQQ A;  3FVU A;  4CBR A;  3PA9 A;  4WYG A;  2BIG A;  3MAD A;  4ZM3 A;  1AIC A;  4OBV A;  3QBO A;  3NU8 A;  1WYV B;  3OKS A;  1UKJ A;  5K8B A;  5FT5 A;  1D7U A;  3RUY A;  4HVK A;  4ZLV A;  4WYA A;  3FSL A;  2CST A;  3DR4 A;  2AEU A;  1UU1 A;  1V2E A;  2D7Z A;  1GD9 A;  3FVX A;  4GRX A;  4O6Z A;  1ART A;  2BWO A;  1YJS A;  3WLX A;  4JEZ A;  9AAT A;  2AY8 A;  3HVY A;  4WYC A;  1FC4 A;  1VP4 A;  3N5M A;  2OQX A;  4E3R A;  2BI3 A;  2BKW A;  2AY7 A;  1M0Q A;  2X5D A;  4WP0 A;  3B1C A;  3FZ8 A;  2BYL A;  3I4J A;  2E7I A;  2JJE A;  2FNI A;  1BJO A;  3A9Y A;  2HOZ A;  1KMK A;  4WXF A;  1WKH A;  2HZP A;  4CVQ A;  3A2B A;  2YKY A;  3GR9 A;  3I5T A;  4ZM4 A;  4LW4 A;  2VIA A;  5D5S A;  1IJI A;  1C7N A;  2WK7 A;  4JEY A;  2AY9 A;  4N0B A;  4Q75 A;  1X0M A;  3BWN C;  1AMR A;  3MAF B;  2HOR A;  3FD0 A;  3GWP A;  5IWQ A;  4R8D A;  1OXP A;  2W7H A;  2VMR A;  4CBS A;  4R2N A;  1LC8 A;  1AJS A;  1ASC A;  3W1I A;  3WCN A;  2O0R A;  3A8U X;  3EIA A;  4JEV A;  4AO9 A;  1MLZ A;  2HOX A;  4ITX A;  4OT8 A;  2AY5 A;  5EIG B;  1RVY A;  3VK4 A;  3AEJ C;  4RJ0 A;  3WX9 A;  4PIW A;  5F8V A;  1WYU A;  1GEY A;  3F6T A;  2O7C A;  3TQX A;  3DYD A;  2DKB A;  5DJ1 A;  4ZAH A;  2R5E A;  2VGW A;  4UHM A;  3GJU A;  1SF2 A;  2W7J A;  1ASL A;  2CAN A;  2E7J A;  3AEL A;  2Q7W A;  3USF A;  4F5J A;  2W7K A;  2VMS A;  3ECD A;  3MC6 A;  3AEN A;  1AAM A;  2W7G A;  4BMK A;  4RKC A;  1MAQ A;  5LH9 A;  2OKK A;  2G7J A;  2PB0 A;  3LVK A;  1FG7 A;  2QMA A;  4Q31 A;  4KXK A;  1WYV A;  4GE4 A;  3LV2 A;  1LW5 A;  2FNU A;  4ZAS A;  3EI6 A;  4PFN A;  4E77 A;  3UWC A;  1KL1 A;  4BHD A;  4IY7 A;  1B5O A;  3GZD A;  1LK9 A;  3MBB A;  1T3I A;  1CS1 A;  1ZOB A;  4GE9 A;  1SZK A;  2W7E A;  5G0A A;  1O4S A;  2BIA A;  1I29 A;  2O1B A;  4ADC A;  1ASB A;  3FVS A;  4KYO A;  3IF2 A;  3FFH A;  4R5Z A;  1S06 A;  1W7L A;  1XI9 A;  1IX6 A;  5EFS A;  3E77 A;  5HDM A;  1CQ7 A;  1V72 A;  4JEX A;  4AO4 A;  2FKI A;  2AY1 A;  1YIY A;  4W1X A;  4XK1 A;  4F4E A;  1CQ6 A;  2VMV A;  1AY4 A;  2VMZ A;  1CZE A;  2DKJ A;  5EUD A;  4MSO A;  2OGE A;  2DGM A;  4Q76 A;  4RKD A;  4RIT A;  4EB7 A;  3KKI A;  2D65 A;  2R0T A;  3R9A A;  4ZWV A;  4MY5 A;  1CL2 A;  1D7V A;  3MAF A;  1H0C A;  1BJO B;  2VLF A;  2W7D A;  3H9X A;  1BKG A;  2X3L A;  3EZ1 A;  4M2M A;  5I92 A;  1JS3 A;  1AKA A;  5EIG A;  4ISY A;  1AHY A;  3VK3 A;  3PAA A;  2AY4 A;  5DJ9 A;  3K28 A;  4P3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...