The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
59
|
sequence length |
231
|
structure length |
231
|
Chain Sequence |
KTNGRNAQIKDTFNQTLKLYPTKNLDDFYDKEGFRDQEFKKGDKGTWIVNSEMVIEPKGKDMETRGMVLYINRNTRTTKGYYFISEMTDDSNGRPKDDEKRYPVKMEHNKIIPTKPLPNDKLKKEIENFKFFVQYGNFKDINDYKDGDISYNPNVPSYSAKYQLNNDDYNVQQLRKRYDIPTKQAPKLLLKGDGDLKGSSVGSRSLEFTFVENKEENIYFTDSVQYTPSED
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Unknown function
|
| molecule keywords |
Uncharacterized protein SAOUHSC_02783
|
| publication title |
1.9 Angstrom resolution crystal structure of Se-methionine hypothetical protein SAOUHSC_02783 from Staphylococcus aureus
rcsb |
| source organism |
Staphylococcus aureus subsp. aureus
|
| total genus |
59
|
| structure length |
231
|
| sequence length |
231
|
| ec nomenclature | |
| pdb deposition date | 2012-03-30 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF04507 | DUF576 | Csa1 family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Clam | outer membrane lipoprotein receptor (LolB), chain A | outer membrane lipoprotein receptor (LolB), chain A |
#chains in the Genus database with same CATH superfamily 4EG9 A; 4EGD A; #chains in the Genus database with same CATH topology 3WJU A; 1IWM A; 3BMZ A; 3WJV A; 4EGD A; 3BK5 A; 3MH8 A; 3BUU A; 2BYO A; 1IWN A; 4ZRA A; 2V42 A; 1UA8 A; 2ZPC A; 4MXT A; 2W7Q A; 4Z48 A; 3MH9 A; 3M4W A; 2ZPD A; 4EG9 A; 2V43 A; 2ZF3 A; 3MHA A; 2ZF4 A; 3WJT A; 2P4B A; 1IWL A; 4QA8 A; 3KSN A; 4KI3 A; 2YZY A; #chains in the Genus database with same CATH homology 2ZF4 A; 3MH9 A; 4QA8 A; 3BMZ A; 2BYO A; 4EGD A; 4EG9 A; 4ZRA A; 3MH8 A; 2ZF3 A; 3MHA A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
