4EITA

Crystal structure of an enoyl-(acyl carrier protein) reductase from bartonella henselae
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
257
structure length
249
Chain Sequence
b'GLLYGKRGLILGLANNRSIAWGIAKTASSAGAELAFTYQGEAMKKRVEPLAEEVKGFVCGHCDVSDSASIDAVFNTIEKKWGKLDFLVHAIGFSDKEELSGRYVDISESNFMMTMNISVYSLTALTKRAEKLMSDGGSILTLTYYGAEKVVPNYNVMGVAKAALEASVKYLAVDLGPKHIRVNAISAGPIKTFRYILKWNEYNAPLRRTVTIEEVGDSALYLLSDLSRSVTGEVHHVDSGYNIIGMKAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Crystal structure of an enoyl-(acyl carrier protein) reductase from Bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Oxidoreductase
total genus 79
structure length 249
sequence length 257
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2012-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4eitA00
3MJCA 3VZRA 4D44A 4BNVA 5COQA 4DREA 3C1TA 4AJ2A 2JHFA 4ZRNA 5TJ9A 1C3VA 3UCFA 1QR6A 1I30A 2JKVA 1XGKA 3KYBA 1T2CA 1V0JA 4RDIA 1UZLA 2VUUA 1JN0A 5IDWA 2Q45A 2VHYA 2DBRA 1JVSA 3K73O 1N2SA 4QO8A 4WOKA 4BB5A 2EKQA 1NAIA 4D46A 1OZAA 4RO0A 2XXBA 1SOVA 4DPKA 4KQXA 2NLOA 3JQ7A 3AJRA 5TRTA 2Y93A 3ZU3A 4XIJA 5CEEA 4LN1A 3KXDA 1T26A 5HM8A 5B4TA 5LCXA 2FY8A 1U3UA 5TS3A 3OIGA 1ZJZA 2DT5A 2DVMA 1HE4A 4J49A 2R2GA 4UVEA 3JQFA 3ZNQA 3ON5A 3AOEC 1DOHA 4F45A 3ZWYA 1L7DA 4XWYA 2HRBA 1X0VA 3JQ9C 3KLMX 3U4HA 4XGIA 4BNNA 3GHHA 4ZVVA 5T8KC 3GVPA 2I6TA 1P9LA 1Q1NA 3IOYA 4BHTA 8ADHA 1FK8A 1SAYA 3S2EA 2PKQP 2ZTMA 1C0KA 3ZI0A 1WAMA 3UN1A 5DP1A 3VPFA 4L76A 1CDOA 1LX6A 2FPIA 2QYSA 3SXPA 5KJ6A 3R1IA 1U8XX 3ANMA 3RC9A 2FP4A 1KOLA 1PR3A 1KVTA 4TVOA 4AJPA 3ZWVA 1MUUA 3BHMA 3FNFA 1ZVMA 2EG9A 2Q2VA 2ZK7A 4JBIA 4BUCA 1E5LA 5G0UA 2B5WA 4WLNA 2X5KO 5CEJA 2RHCA 4GMFA 3QQPA 1JKIA 2FOIA 3LT0A 4BNKA 1Q7BA 1V6AA 1ZBQA 3VVCA 3FSRA 5JCXA 3A9WA 1PTJA 3MJ4A 1PEDA 4LVUA 1NM5A 2B4RO 1J5PA 1GU7A 2C07A 3JQAD 4P4GA 3RD5A 3DO5A 4TMFA 2H9IA 4P8RA 3O8QB 4MIYA 4BMVA 4OXYA 1QYVA 5BSHA 3TOXA 2Q1SA 3M1AA 2VTDA 3MJVA 2PGJA 2NU8A 3B1JA 3AFNA 4D0SA 4R5HA 1VE9A 3KYDB 4E0BA 3C3XA 4RZIA 4XR4A 4Z6KA 2OBNA 4RPGA 4S3MA 4F6LA 1DRWA 3AM4A 4TKLA 4LCJA 3U5TA 5IG2A 4XZ3A 2P9CA 3UUWA 4H16A 3W6ZA 1PJ2A 2Q4EA 2HO5A 4NFYA 4WLOA 3GVCA 1BMDA 2G76A 4E30A 3B1KA 2O3QA 5A1TA 3FBGA 2J5QA 3VH3A 1CYDA 2G17A 3GMDA 1IB6A 4TVBA 1ZSYA 1E7SA 2GLXA 4WLVA 2RH8A 3V1UA 3GFBA 5JE8A 2DLDA 2BELA 4GI2A 4WLEA 4DBVO 3T7EA 3IL2A 4KUEA 1U4OA 1MX3A 2X23A 4OL9A 3STHA 4CR7A 4PLCA 3LT1A 5JAMA 1NX6A 1KIFA 4AJIA 1VL0A 3RC7A 3FPLA 3DAPA 2DUWA 3VTZA 4DUPA 1C0IA 5CHEA 2FSVA 5AXBA 3EZLA 3RUCA 1E7QA 5T6BA 4IINA 2RIRA 3BYZA 2VZ9A 1P31A 5AOVA 3SJUA 4BV8A 2BGLA 4IDEA 2GYYA 4KP7A 3WLEA 3W4JA 1GZ6A 3FWZA 1B3RA 2GN4A 4ILKA 3AW9A 2YDYA 1DFGA 1PJ4A 1XLTA 3CZMA 4EBFA 2VHZA 2HSDA 1UAYA 4C7KA 3DXFA 1QYDA 4XEHA 4XYBA 3RSHA 1AXEA 3KYDA 5TLSA 1WMAA 2HK9A 4YT4A 1ID1A 5DF1A 1DRUA 4BNTA 1JU9A 4F46A 3OECA 3DONA 5KJFA 5AXAA 4E2ZA 4OXKA 5T57A 4J3FA 4WCFB 1SPXA 4MVJP 4CUKA 3RI3A 2ZJ0A 3AUUA 2EJWA 1NPDA 4BGUA 4J43A 1ADCA 2DBZA 1Z75A 1X13A 1HTBA 4J2HA 1A5ZA 2FRDA 1X0XA 3ZWNA 1R4NB 3B6ZA 3SLKA 1ENZA 1VL8A 3Q2IA 3ZW9A 3C24A 2JCXA 1DHRA 5L3ZA 1LNQA 2D4AA 1CERA 4IGFA 4K6FA 2HMWA 1GUZA 3GAZA 4BNHA 1Z7BA 3GN1A 3GOHA 3JQGA 1LI4A 4FGWA 1UXGA 4BNJA 2R00C 3KEQA 5TC4A 5G2OA 1UP7A 3JD2A 5CG1A 3C7CB 3PGJA 4Y6SA 5F1PA 2IE0A 1DC5A 3FWNA 2B0JA 2CY0A 2PV7A 2ZYDA 2TMGA 4U6QA 2A9FA 4J2OA 1CETA 2UV8A 3S2GA 3WGHA 1PQWA 2IEBA 4DBZA 4FOSA 2NSDA 2BFAA 4CQMD 4B4UA 1EK5A 3OFSA 3V1YA 3UF0A 2V65A 5LC1A 1KEUA 2VT3A 3RBXA 4O59O 4D0RA 1SNYA 3K92A 1FDVA 1U8FO 4F3YA 1NP3A 3ROPA 4BNXA 2EJVA 5JO9A 3WQQA 4M54A 3TZHA 3WFIA 2IXBA 4I9UA 4NK4A 1ZSNA 3SJ7A 3VVBA 4D45A 5U9CA 2G0TA 3ZZNA 2A92A 3KM0A 1VC2A 2NM0A 3I9MA 4LGVA 4B3JA 3IP1A 5KIAA 1O9BA 4WCFA 4OQYA 4QFCA 1B16A 1MGOA 2BFOA 4L73A 3D4PA 3E1KA 2VHVA 4UUPA 4BKOA 1VJTA 2HK8A 1GY8A 2VYNA 4CMHA 4H7PA 3ASUA 2AXQA 5JDIC 1PWZA 3CTMA 4NIMA 4Q39A 5L9AA 3DWFA 2XXJA 3GN2A 5DBGA 1R4NA 1E5QA 5KVSA 1K2WA 4PLYA 3LLVA 3ICCA 3H5NA 2JD0A 4BNWA 5IJZA 4K9DA 3PHJA 4PG4A 1PGNA 1IPFA 1ZIDA 4BQPA 1N5DA 3GNSA 3GPDG 3AI3A 5GZ6A 3Q11A 4I5DA 5CDUA 5EQDA 3TNLA 4GVLA 1Y9AA 3CUKA 1CQJA 4OKNA 5MDHA 1BGVA 1KY4A 2FHSA 4ALNA 1P33A 3OQBA 4FOOA 4LW8A 3EW7A 1G0OA 2ET6A 4CQLB 4I08A 4BIIA 3GZNB 3QWHA 3QVXA 5T67A 5FYDA 1FXSA 1UDAA 1LDEA 1Q7GA 2RHRA 3C1OA 3K96A 4CMCA 1PJLA 4BO8A 1W73A 1ISHA 1P1RA 3VH2A 1LUAA 3ST7A 3JQCA 1E3JA 1DHTA 5H82A 5TJHA 5ITWA 3PTZA 4FIZA 1DDOA 4CMGA 3RJ5A 3GA0A 4BNYA 4DPLA 2X5OA 3OJFA 4BO4A 5DBFA 4Z3KA 4IQGA 3DR3A 3EVTA 3H9GA 4BO2A 5ILOA 3I83A 3H3JA 3E18A 2E37A 1S6YA 1RM5A 4KQWA 4EW6A 4D3FA 2JL1A 2QW8A 4BKPA 1JKFA 1G0NA 1SB9A 2VHXA 2IZ0A 2QRJA 1EDZA 1XWFA 4WNIA 4XQGA 2WSBA 1PR9A 1IOLA 4CLHA 4J1TA 1OBFO 1N9GB 2AQIA 3PWKA 4PZDA 1BXGB 4W9NA 3WTBA 1YB1A 4XJSA 3L4BA 3IP3A 4GGOA 2H6EA 1PZEA 3WBFA 2GZ3A 2PFGA 3TZKA 4RJTA 4AJEA 4ND4A 5JW6A 1W0CA 3TRIA 4D3DA 1P74A 3O9ZA 2W4QA 3PEFA 4M86A 3JQFC 1ULSA 1R66A 2VQ3A 3VH4A 4BL5A 5JYDA 4RVHA 2IZ1A 4GLLA 2GRAA 4LSMA 4UVHA 1ISIA 5H81A 4CQLA 1Y8RB 1LC3A 3GZNA 4DL9A 3QP9A 1SMKA 1Z73A 4M1QA 4RF3A 1TVEA 3QA9A 2NVUA 2LDXA 3UVEA 3AOEA 3QRWA 4GX5A 3FR8A 1Z45A 2FN7A 1PZHA 3JQ9A 1RJWA 4PG6A 1NQAO 3GFGA 1PU2A 1AGNA 2P5UA 1SEPA 4J7CA 3ONFA 4D3SA 3FR7A 1M6HA 3VPHA 4XD2A 2YHIB 3WX0A 4J1QA 2Q1WA 4AJNA 2E82A 2Y05A 4AJ1A 4E6PA 3DEYX 4N5MA 2EV9A 3CEAA 3QWAA 1C1DB 4YRBA 4M49A 2Q3EA 5COBA 3Q0EA 4ZA2A 5EL0A 1VKNA 2I76A 3OIDA 1B7GO 4CM3A 1DB3A 1E7RA 3KSDO 4HP8A 4OOFA 1DLIA 1H0KA 5KVCA 4OJNA 4KWHA 3RUIA 3F6YA 3F46A 3JTMA 3HADA 5I8ZA 1EMDA 4MIEA 4Z0PA 1LDMA 1N9GA 1SCUA 1QG6A 3RROA 4O6VA 1BXGA 1GUFA 4YT8A 1LQTA 2GR9A 4E2XA 4XDZA 1WNTA 2HRZA 5I9MA 4NBWA 4D43A 4W4TA 6ADHA 1U7TA 5IDYA 3ADPA 1TEHA 2Q49A 4BGIA 4NFSA 1DFIA 3QVSA 1LSUA 3NEPX 4GX0A 4JCOA 4IMPA 1IY8A 2EGHA 4RVDA 1NHGA 3L9WA 2DBQA 1Y8RA 3JQDA 3NTRA 5K9ZA 1IL0A 3QWBA 5I8WA 3G79A 1O5IA 3PDUA 3UXYA 1YOVB 4IDCA 4KWIA 1RM4A 3P5SA 1DRVA 1E6EA 3A14A 1JDJA 4BNLA 3JYLA 1PX0A 1MFZA 2YW9A 5F5NA 2VCYA 3F3SA 2OMEA 4YRDA 3NX4A 4BGVA 1JA9A 2HDHA 3ENKA 5C7OO 4FC6A 1DAOA 4H15A 2VWQA 3NDJA 3F1KA 5ICSA 4A26A 5MGBA 1H2HA 4HKTA 1X15A 4TZKA 1U9JA 2NV6A 3WGYA 4U8GA 1UXJA 3KYCB 3DZIA 2PH3A 4RPKA 3DZHA 1VSVA 1O89A 2BFMA 4UUOA 2UVDA 1UXKA 1C1DA 3W4IA 2O3JA 2I3AA 1GAEO 4ESOA 1I33A 3LQFA 3HZZA 1HDXA 1PJTA 3HUDA 5CFZA 2I65A 3OEYA 3INTA 3H4VA 2BGMA 1GTMA 3OM9A 2GZ2A 2HMUA 3EYWA 1G1AA 1DO8A 2VNAA 1XCBA 3DAGA 4E5YA 4HWKA 1MB4A 1QSGA 4ZD6A 3G49A 2Y66A 2PH5A 2ZCUA 1F0YA 1HETA 5BNFA 3CXRA 1WWKA 2OZPA 1ZK3A 3EZYA 4GSLA 1EDOA 5IXYA 3CMMA 1WDMA 4CMJA 3TFOA 1K3TA 2GO1A 1PJSA 2IODA 3KUXA 3RQSA 1O8CA 1YOVA 4PZCA 4Q3AA 4WOJA 1EQ2A 3JSAA 1FDTA 2P91A 2CDAA 5IZCA 1ENYA 3GT0A 4MPDA 1RM3A 3WGGA 2OL4A 4J1NA 4FFRA 3TSCA 4YAEA 1WLYA 1NTOA 1Z82A 2YDXA 5C7LO 5HRUA 3ASVA 4QEDA 4BMSA 2C2YA 3PP8A 5CPBA 2E48A 1C0LA 3QV1A 1XG5A 3KYCA 5L4NA 3SC6A 3O38A 5A5EA 2ZTLA 1P1IA 1O94A 5HTOA 1UZMA 2O4UX 2W2LA 5GZ3A 5THKA 3NJ4A 3AUAA 3LC7O 1JTVA 4Z9XA 1JAYA 1JWAB 3NYWA 3WNQA 4OQZA 3UHAA 3GEMA 4ZQEA 1VL6A 5B4VA 1E92A 3A1NA 2I9PA 1XR3A 4IDGA 3ZNPA 1NVMB 3RBZA 1YBAA 3WNVA 3KLPX 4ALMA 4CR6A 1ZK4A 3GGOA 1VM6A 1U2DA 4FSHA 1YXMA 3P2YA 5GZ1A 3N7UA 4WCFC 2J5RA 4E13A 1YQGA 3PYLA 3BTSA 4RVSA 3ORFA 5HS6A 1ONNA 4J90A 3MEQA 4NMHA 3U4IA 4OGWA 5DOZA 1PQUA 3AM5A 4II2A 1J0XO 2DPHA 4YR9A 1PJCA 4R9RA 3FTNA 4XIYA 1SZJG 3JQBA 4RLHA 4BKQA 3DC2A 3NGXA 4CR8A 1XQ6A 2I99A 1YL5A 3JD4A 2DFVA 5FFFA 3PGXA 4EUEA 1H9BA 1RKXA 4OYRA 4MINA 5EINA 3W8EA 1I8TA 5KJCA 3NT5A 5FI3A 3GDFA 3KTDA 2NQ8A 3MZ0A 3WOHA 1P44A 2HMTA 3OF2A 1KVUA 4GMGA 3CH6A 4N54A 2QZZA 1PS8A 1YKFA 2VNSA 4UEJA 2D5CA 2HQ1A 5L4LA 2GZ1A 3W4KA 5AYVA 1OAAA 1B8PA 1DIAA 4R1NA 3B1FA 1PJBA 3I9NA 2GASA 4J4BA 1NFRA 1NPYA 4L4RA 1CIVA 3O4RA 1BSVA 4H3VA 4N18A 2BH9A 3LZ6A 4Y6RA 3ZN2A 3GPIA 3H3FA 1K6JA 2AEJA 1OOEA 1MFPA 2P4QA 1MP0A 1NWCA 1K5HA 4ZRMA 1R0KA 5G0VA 3TJRA 3KO8A 4A7PA 4O1MA 1U7HA 3VC7A 1LDGA 4IM7A 5KVQA 2WYUA 5JC1A 4W99A 2EF1A 4R1SA 5EESA 3WICA 2J3KA 5C7IO 7ADHA 4XYGA 2VZ8A 1EUDA 5THQA 2C7VA 3QJ5A 4FN4A 3R3JA 3ZU4A 4IJUA 4E21A 3MOIA 1WDKA 1HE3A 1PIWA 1D1TA 2NU6A 4MKRA 4U6SA 4LVCA 4DVJA 1YBVA 1EZ4A 3TWOA 3AUSA 4W9NC 2Y1OA 2FPGA 2NVBA 3L4BC 3BTUA 3F5SA 4ZU3A 4U7WA 4BO3A 5I7VA 1E77A 9LDTA 2HUNA 4CLEA 1KERA 4PG8A 3GAFA 5G4KA 3PIIA 3JQ6A 3V2HA 3IUSA 1Y8QA 4GKVA 1GQQA 1SB8A 2JCYA 1BDMA 2YJZA 3AWDA 3GG9A 3VZPA 4B3HA 3F4BA 5JMWA 2DM6A 3JQ8B 1F06A 3H5RA 5EPOA 2HAEA 1YQXA 5JAQA 2H5LA 2QZ9A 3BHJA 3W8FA 1T24A 1HWYA 3PYMA 1ZW1A 1A9ZA 4A03A 2W98A 4JP2A 1T2FA 2ZTUA 3NAQA 4PG5A 4BO0A 3B70A 2CNBA 4BGEA 2ZCVA 3Q6IA 1KYQA 1T2EA 4CMIA 1I2BA 1ZFNA 3K8ZA 4CJXA 4DC1A 2NWQA 3NRCA 5HS4A 5IF3A 3K31A 1I3LA 4IJVA 5HA5A 1AN9A 3OQ1A 4UREA 3K2BA 4EJ0A 4GH5A 2GCGA 1DC4A 1OFGA 2O7SA 2YV1A 3AUTA 4BS9A 1EFLA 4C4OA 1CJCA 1O95A 2J8ZA 1ORRA 2CFCA 2PKRA 4AL4A 4AVYA 4J4TA 5KKCA 3VAZA 4WKGA 3BTVA 5DP2A 3FTPA 2VYVA 2GERA 3GGPA 2AG5A 3JYQA 2D59A 3QSGA 5DULA 2G1UA 1LLUA 3HFSA 5JLAA 1FMCA 4L4SA 4GWGA 3RUDA 1ZNQO 2OFPA 1I3NA 3O03A 3DOJA 1UXHA 4YTEA 1DFHA 2Z1NA 1K0UA 1ZEJA 1OC4A 5HWSA 2D3TA 4JGBA 5I9LA 4E4YA 1GQ2A 4UEOA 2VWGA 1I3KA 1SC6A 4NBRA 4ALIA 2Q46A 4YEDA 1Q0LA 3JQ8A 4RZHA 3RKUA 2C59A 3OEWA 1BRMA 1TT5B 3FNHA 4J7XA 4JJIA 4AJJA 5K6AC 4DIFA 2O4CA 3C8MA 2X0IA 1M75A 4BKUA 4ND2A 4PLPA 5DDIP 1DSSG 3FN4A 5A3JA 1CEQA 4WCDA 1Z6ZA 2Y0DA 3MWEB 1QLHA 3BMCA 4WECA 2B83A 4RPHA 1M2WA 3H9QA 1U3TA 1NYTA 1GZ4A 4JIGA 3JQGB 1XSEA 1H5QA 5IDXA 1ADFA 2NTVA 2YQ4A 3FBTA 3GRPA 4CPDA 3L77A 3BZUA 3WIDA 4OXNA 2Q50A 4XJTA 3K5PA 4RVGA 3NT2A 1DC3A 5ER6A 1WP4A 5L7WA 2AEFA 1LSOA 1B8UA 2X86A 2CVOA 3JV7A 2NU7A 3A4VA 1LLDA 3CMCO 3VKVA 5JSFA 5DT9A 3UH1A 1U28A 1EBUA 3INGA 4WGGA 5I7SA 5G4LA 1GQYA 2X58A 1ZK0A 2ZB7A 4J6FA 1GV1A 4R3WA 1YH3A 1XHLA 2DAPA 1QYCA 3FHLA 3C7DB 3E9NA 3KV3O 1PJQA 4QT0A 3S2FA 4JK3A 4RQTA 1GPDG 3U09A 3PIDA 4HNGA 3BXXA 4X54A 1L1FA 7MDHA 4IBOA 1LLQA 1UDCA 1RWBA 4PIVA 5IZCC 3LK7A 1TT5A 3EHEA 4C7JA 2OOSA 1NNUA 4P38A 4Y6PA 4CM1A 2WE7A 2X8LA 3QVOA 1P1JA 2BMAA 3WJAA 4BMNA 3EGOA 2YY7A 1PL7A 2Y68A 4A10A 5JYEA 3WTCA 2PLAA 4TSKA 3VDRA 2HCTA 3OP4A 3PJEA 1H6CA 4N5LA 2OUIA 3H2SA 4CUJA 4XQEA 2POQX 4CQMA 1GPJA 5DCUA 2O2SA 3U4CA 1LTHR 3LF2A 3R0IA 1UJMA 1Y9EA 2BKAA 4OHUA 4GWKA 4AG3A 2WYWA 4DA9A 3D3EA 5JAIA 1PL6A 3KB6A 4BVAA 4UVDA 1QLJA 4LRSB 1ZH8A 3PI7A 4HNHA 4IPTA 1NASA 4Q3DA 3WFJA 1E3IA 1ADBA 1QKIA 1WPQA 3TDKA 4DRYA 2BLLA 3NUGA 4RL6A 4YJFA 1XA0A 3D5QA 2C5EA 2WM3A 4KUGA 4M55A 3WJ7A 4NNJA 2UUOA 1BG6A 1NBOA 1KEPA 4NQZA 5A5FA 3DBRB 1T4BA 5AXCA 1KETA 1RM0A 3D3WA 4WPGA 4YAKA 1PS0A 4LSWA 3BMOB 1T2DA 1IHYA 2OGUA 2O3RA 3ABIA 3GMSA 3CE6A 4BNGA 5IZ4A 3JQBC 2AQ8A 2PZJA 4DQXA 1I36A 1MXHA 1XDWA 3WR5A 4B7XA 5JCJA 1C1XB 1LC0A 1NQTA 1E7WA 4R1TA 4JP3A 4IDFA 2SCUA 4IDAA 3QY9A 4WE3A 5C5IA 1N7GA 3PJGA 2V6GA 2YHUA 2BD0A 3RU7A 1YDEA 1GR0A 3OA2A 3DMTA 1UXIA 4DGSA 3ANNA 3K6JA 1NVGA 4RV9A 2PTGA 4ITUA 3TPCA 2X9NA 1YRLA 5L51A 1SOWA 5KJ1A 3GEDA 2NVUB 4TRNA 2NNLD 4ONEA 2VYND 3PJFA 4B8ZA 2G5CA 1E3SA 3FF4A 2DTDA 3DZKA 1NR1A 3HN7A 3NGLA 3GEGA 4L0QA 4AJKA 2DQ4A 3L6DA 4XGNA 1Y5MA 1HXHA 2AG8A 3KRTA 4A27A 4E32A 4PG7A 2EW2A 1XU9A 1BVRA 1LLCA 2EERA 3DBRA 4HV4A 3ZWAA 1Y5RA 3QW2A 3ZW8A 3DL2A 2YYYA 2EKLA 3QE3A 1JLLA 3GDOA 1GD1O 3BMOA 4P22A 2WDZA 3ZWBA 3OJ0A 1HZJA 3ZHZA 3H65A 4OH1A 3GRKA 4YJHA 3AM3A 2CD9A 1Q2XA 2ZYGA 2O3SA 4L4XA 5TNXA 1UH5A 4HADA 3ZNOA 5GMOA 1YONA 1C1XA 3WSWA 1Q0QA 3SBOA 3DFUA 4XB2A 1A9YA 3FI9A 5DCWA 5TF4A 3WQRA 4CM9A 3ZH2A 4YJGB 1YS4A 4ND3A 3WSVA 1QYXA 4ALLA 3EUWA 3N74A 1PGQA 4JLWA 4JXKA 4R1UA 1M67A 4IS2A 1YL7A 3ZV4A 4BNZA 1R4MB 4HBGA 3CKYA 1EE2A 2VT2A 3K30A 4EITA 4IIUA 5EJ2A 4FFNA 3QLJA 5A02A 4R16A 1GFSA 2QG4A 1K6XA 2WJPA 5BT9A 3ZHXA 5B1YA 2NACA 4I5GA 1HKUA 1P0FA 2O7QA 2AHRA 2AA3A 5G0TA 1Z7EA 4WEOA 3UCXA 2Q4BA 1DC6A 5JY6A 4EEXA 2ZB4A 3PHLA 1HLDA 1VI2A 2FZEA 1ZEMA 3ITKA 2CMDA 2YFHA 4A2CA 4CMKA 4E33A 1YE3A 2R6JA 4YRAA 1HZZA 3H8VA 2HMSA 4KDFA 2HKIA 3QIVA 2EP5A 1HEUA 1V3TA 2ZATA 4ZQBA 2O50A 4J7UA 1XQ1A 3EVNA 1E3LA 3K2EA 4DTIA 1HL3A 3ZV5A 3ETEA 4W7HA 3ETGA 2EHDA 3OSUA 4LMRA 1HYEA 2VRCA 4YQYA 1EVYA 3TZCA 4XA8A 3VPXA 5J23A 2DTEA 2QRLA 3I3OA 3WDSA 4E5MA 3MJEA 4YAJA 2H1SA 1DXYA 3TN7A 5KTKA 1ZXLA 4FFPA 4TRRA 4YJGA 5CAEA 1E6WA 6LDHA 2AE1A 4OM8A 2B35A 5A03A 1GYPA 1ZSVA 1BTOA 3CZRA 4ND1A 3DHNA 4UVGA 5DZSA 4NR0A 3ROQA 4CLOB 2GSDA 2QHXA 1C0PA 1B8VA 1NFFA 2IYOA 2AEMA 1R4MA 3HB4X 4J9UE 4B7UA 4OSPA 4URFA 2NTJA 5TQVA 1GYQA 4EGFA 4PRKA 3BAZA 1DLJA 3GZ4A 4J9VA 3RBVA 1H6AA 1YL6A 3OA0A 1SEVA 2GPTA 5K6AA 4PLZA 3DQPA 4OKIA 3OH8A 1ZXBA 3AOGA 3D1LA 4MP6A 3L07A 1FDSA 2P9GA 2ZQYA 3GNTA 4JJFA 1GCOA 1BWSA 4MVJA 2Z1MA 3GUYA 3RC1A 1HDGO 1E1KA 2AE2A 3NDRA 4UAGA 3IKTA 1KVRA 1LRKA 4MKXA 3E8XA 1X7GA 2CVQA 4TROA 1B14A 3RUAA 1FF9A 1U3WA 2G82A 4G2NA 1GYRA 1R15A 1DAPA 2WMDA 3DZBA 5EN4A 4CODB 4CM5A 1V3UA 4A73A 4W6ZA 1MLDA 3BHIA 4DLBA 2OXIA 4E2WA 3PJDA 3JCZA 4DYDA 4ND5A 1LJ8A 1ZUD1 3HWRA 4MDHA 3WGZA 5L7TA 4MO2A 1D1SA 4QTZA 4AFNA 4BOYA 1D4FA 3ZHYA 4CV1A 4PRLA 3NTQA 4NHEA 1EVIA 2CUKA 5F3RA 2DKNA 3LF1A 4E5NA 3HDQA 1OMOA 3NKLA 4FS3A 3OMLA 4CLOA 1CQIA 5I9NA 5AVOA 3D5TA 4MIOA 3L6EA 5BQFA 3UOGA 2YFQA 3DBHB 4EDFA 3V8BA 5B12A 5JAZA 2HLPA 3WG9A 3F47A 3OBBA 4B4VA 3WXBA 1VLLA 3IIEA 1FDWA 2PZLA 3GHYA 4FBGA 4GVXA 3ZWMA 3ONEA 1I01A 4I5EA 3W1VA 4CV0A 2YZ7A 3PQFA 3X2EA 2GN9A 4W7IA 2JFHA 3I4CA 1AE1A 2GUGA 3PZRA 5LDHA 4NBUA 1DBVO 4UVIA 3CPSA 3OJLA 2LDBA 3INRA 1NHWA 2Z5LA 3RVDA 4DWVA 4GQAA 3HDJA 3LLSA 4NBVA 1BXKA 4YT2A 3OJOA 4MVJE 1ISFA 1NFQA 4GX2A 3DDNA 3MJTA 3UAGA 4MP8A 1VSUA 5CP8A 4EI2A 3U9LA 4EYEA 5F1OA 5KVVA 3AY3A 2B4TO 2V6FA 3PVZA 4ALJA 3QVWA 2XF8A 4J91A 4JQCA 3DOCA 1WMBA 2C29D 4JBGA 2Y1DA 1KEWA 1KVSA 4PGFA 5JC8A 2QIOA 4TRMA 3HJAA 2GNAA 3AY6A 2NQTA 3WLFA 3LYLA 3CIFA 4Z3DA 4BB6A 3Q9NA 2VTEA 4DMLA 1JKJA 1T1RA 3TF5A 3AI2A 3AK4A 1QRRA 5L4SA 4ID9A 1PJ3A 2W2LD 2ZJ1A 3DBHA 3H5AA 3ICPA 2VUTA 1C14A 3RIHA 2PZMA 3AY7A 1W4ZA 4BO1A 3RCBA 1WDLA 3NJ8A 5KWEA 2Y1EA 2V6MA 1ZZEA 2Q2QA 1E1NA 2B5VA 1EFKA 3D4NA 5ER9A 3E03A 3ETDA 1VPDA 2JD2A 4Y9DA 4Y67A 5G4KB 2EP7A 1WW8A 1Y8QB 2O2YA 3I52A 3MTGA 4FC7A 1ZMOA 3HDYA 5JXWA 4ALKA 3DMTC 1NAHA 2J6IA 4IMRA 4IJKA 5DBIA 1O6ZA 4K28A 3ZV3A 4Q3NA 2Q99A 2VZ0A 3T7CA 1QXSA 1QV6A 3SLGA 2X1HA 2Y1CA 2OORA 3SEFA 5DNAA 1L7EA 2X9GA 2Y1FA 2BI7A 1OC2A 3NTOA 3ZDFA 5FEUA 2QRKA 3UKOA 1DIBA 1V35A 1J49A 3GY0A 4AJHA 4MP3A 3I6QA 3JD1A 3ZU2A 1P1KA 3DHYA 4LMPA 3I5MA 3IJRA 1A71A 4UUMA 4JBHA 4RLSA 4KTVE 4MJLA 4CMIB 3GUCA 2WE8A 3HSKA 5C37A 1T1SA 3OICA 1H94A 2O3UA 4G81A 2ZIZA 4CLXA 4ZN6A 3SVTA 4NPCA 4R4JA 2I67A 2GN6A 1U5CA 1ZCJA 3I6IA 3JQAB 3F4LA 2GD1O 3BA1A 3PHGA 3JD0A 5F21A 1MG0A 5EIOA 3VDQA 1P77A 4M87A 3H7AA 4Z0TA 5JPIA 3GG2A 4HUJA 5JDCA 5LDGA 4NZ9A 4E3ZA 3FNEA 5JS6A 2GDZA 4YDRA 1HLPA 1ISGA 4P4LA 1K89A 3ULKA 4D7AA 2HU2A 3DOOA 1N8KA 3GQVA 1I32A 1EVJA 2ZQZA 2NUAA 4R54A 3KOUA 2PKQO 1HRDA 3SX2A 5CPFA 1YB5A 4I9HA 5ICMA 4FW8A 1SO8A 3LSYA 4CUZA 1A72A 1HDYA 1UR5A 4DLAA 1JW9B 2OHXA 4QX6A 4NFHA 1HDCA 4PLVA 1PGPA 1S7CA 2DC1A 1D7OA 4YXFA 1UP6A 5JO0A 2OP0A 1NR7A 3IKVA 4GKBA 4FFMA 4LRTB 4GX1A 2JHGA 1PSDA 2FR1A 5L95A 1RYDA 3IMFA 3ZWCA 4TZTA 1B2LA 5T64A 5KCZA 4Q3CA 4CL8A 4HFRA 4CMBA 1Q0HA 2X9VA 3TOZA 4NBTA 2QX7A 3BMCB 4JROA 3OIFA 3ZCXA 2P68A 5B4UA 3I1JA 3WS7A 3PHHA 3MJSA 1A27A 4YJDA 1FJHA 4DQVA 2C20A 5AQ1A 2EKPA 3JQAA 1UDBA 3A28A 5L7YA 1WZIA 5CDYA 4L74A 3I9KA 3NT4A 3FD8A 3KSZO 2C2XA 1NVTA 1ULUA 1LBEA 1MC4A 1I0ZA 3GK3A 5A05A 1IULA 1MC5A 1R16A 2Y0EA 1E7YA 2WWRA 3D4OA 3CSDA 2O48X 1PS9A 2FZWA 2PGDA 3KZVA 1ARZA 1ZK2A 5DOVA 4RGBA 4R41A 4IGEA 4AJOA 1NQOA 3M6IA 3GLQA 3RFVA 1YQDA 1WZEA 4IQ8A 3AFMA 3ZWXA 4NJOA 4CMEA 1A4IA 2X0JA 1PGOA 3WIEA 1N1EA 4EUFA 4N5NA 3PQDA 5JBIA 4YT5A 1JAXA 5CDTA 5H83A 2X22A 1HSZA 1ONOA 1E0DA 3D0OA 3H9JA 2JCVA 3MCVA 4RF4A 5G0SA 1YVEI 1XEAA 2PZKA 4PLTA 3JYPA 3RUHA 3I23A 3GVIA 1PQPA 1F8GA 2PD3A 3ENNA 2FSSA 3IJPA 3IDSA 3TL3A 4HFJA 2VOJA 3HHPA 2EEZA 1EK6A 4NI5A 2XPCA 1HF3A 1T25A 4QQRA 4RCVA 3E82A 3G17A 1IE3A 2CF6A 1YO6A 4Y98A 1QV7A 8LDHA 5BNIA 1KEVA 1QYWA 4FJ0A 1B0AA 2C54A 2IEDA 3GC6A 3PFWO 5BSGA 1E1LA 2VYVD 1GL3A 4R3NA 1ONPA 1B26A 1BDBA 1G6KA 2PK3A 4RQUA 3FRJA 1AXGA 1DIRA 2DUUA 2IRWA 3LDHA 4E5KA 2PNFA 1IYZA 1U3VA 3DBVO 4K1LA 1EE9A 1N92A 1VJ1A 5L53A 4ZICA 4CQMB 2DBVO 2CDBA 2ZB3A 2NU9A 4JX8A 4XCVA 4ZJUA 1IZ9A 4R69A 2I66A 3E6AA 3PLRA 3PFFA 1EBFA 2C0CA 1TT7A 2YV2A 2CF5A 3L6OO 3TQHA 3KHUA 4E2YA 3IC5A 3LT4A 2W90A 5L40A 1HDZA 4EEZA 4D42A 4R01A 1BHSA 1NQ5A 4I8XA 3KEOA 5TX7A 4IXTA 5L45A 1AHIA 2VWPA 2E49A 1NXQA 1K6IA 1YDWA 2ZB8A 1TI7A 3EK2A 3IQDB 4YJFB 3RFXA 3ZGYA 5BNTA 4I5FA 4FCCA 3DAFA 1H6BA 4CV2A 3Q2KA 1UAGA 4NU6A 4MVJG 1U5AA 4R9SA 1SBYA 2ZTVA 3M1LA 4U0KA 1HE2A 3D3WB 3KSUA 2BGKA 1HSOA 5JFOA 4FB5A 3Q3CA 4XYMA 4PLWA 2VRBA 2NTNA 4QUKA 1X7DA 4XKJA 3E48A 2AW5A 3O8QA 3H9EO 1ISMA 4YPOA 2JAHA 1YJ8A 5A9SB 4FJ1A 4OO3A 4CL3A 4YA6A 3PDJA 4L9RA 1LA2A 4TWRA 3WGQA 1J4AA 3WWZA 1LSSA 1P0CA 3V1TC 3M2TA 1GADO 4NG5A 4U5QA 2IXAA 1XU7A 4JN6B 4ROSA 5T5QA 2B37A 4EZBA 4Z9FA 3ROMA 2ILTA 4YAGA 1FDUA 1VKOA 2HMVA 3O26A 3TZ6A 1BW9B 4YWJA 5CEFA 3IS3A 5F5LA 2P4HX 4PFJA 1GCUA 1WVGA 1F12A 1NWHA 2CDCA 2EXXA 3EDMA 3KETA 1I10A 1ML3A 1ZK1A 2A35A 2X7HA 1VRWA 3C7AA 3QHAA 3S1LA 3G1TA 4L75A 1R0SA 3H6KA 3VPSA 4GGPA 3VOSA 5ADHA 4BO7A 1V9LA 3GR6A 2EWMA 4QFDA 4DIBA 2HK7A 3UFXA 4B8WA 4NK5A 3PPIA 4GL4A 4PLFA 4F6CA 3U49A 3DHEA 2PA3A 2Q1UA 1X14A 1PGJA 3E9MA 1U1IA 4PZEA 2RBEA 1ENOA 4O0LA 1YB4A 3GF4A 1LEHA 3ZWOA 3B20A 4XX0A 1HYGA 1CRWG 5EQFA 5KNLA 2X5JO 5TIIA 5A06A 1P1HA 2Q1TA 1H2BA 4YJHB 2CZCA 3TZQA 5A9SA 1E6UA 2I3GA 1BXZA 2Y99A 1TXGA 2FWMX 4YYZA 4BNUA 4CM6A 2CVZA 4WASA 3WYCA 2V7PA 3M2PA 1RPNA 3PYXA 3VKUA 5A9TA 4MVJF 1B3BA 3JD3A 3ZV6A 4E12A 1KC3A 3DB2A 5TT1A 4Z0HO 1I2CA 4CM4B 3Q1LA 3I4FA 1BW9A 1R0LA 4MKZA 2W2KB 3ZU5A 1LDBA 4FDAA 2WEKA 2IDZA 3WWYA 2VOEA 2XAAA 3W8DA 3RWBA 1ZJYA 4XRRA 2PY6A 4PVDA 1QMGA 1P45A 1EQUA 2O3TA 3BIOA 5G0WA 3SC4A 2W8ZA 4IIVA 3HE3A 4DIOA 3KVOA 2DU8A 3D64A 3G1UA 4M89A 1YGYA 4HY3A 3ANLA 3ADOA 4NU5A 4CLRB 2JFFA 4INAA 4YAIA 3H2ZA 2J3HA 5JCJD 3EMKA 1AHHA 2B69A 3BTOA 1PWXA 1YJQA 1R37A 2ZKLA 2D5AA 3MWDB 4BKRA 5CDSA 4WEQA 1F17A 1T2AA 5FI5A 5TGDA 4B79A 5U1PA 1H93A 5A9RA 5JDCC 4KTTE 5CDGA 4PVCA 2F00A 3I9OA 1CF2O 3COSA 3P7MA 4YVFA 1ISJA 2RCYA 2EGGA 4I9NA 1PZGA 3JYOA 3PHIA 4RORA 4K26A 1GUYA 3ZWPA 1OI7A 4MOWA 1PZFA 4Q3EA 4JNKA 3LT2A 3ZHBA 5FF9A 5JY1A 5ENDA 1X7HA 1P3DA 3DTTA 5JMPA 4FJ2A 3RFTA 5FWNA 9LDBA 1H6DA 2Z95A 5DCYA 3E5MA 2OO5A 1VJ0A 1W8DA 1F8FA 3VH1A 1X1TA 1XIVA 5U4QA 3F5QA 4CM4A 2WD7B 4UEKA 4ZQGA 3V2UA 4BNFA 3T4XA 2W2KA 4J4HA 4MVJH 4IZIA 5IXSA 4GLOA 3RKRA 5IN4A 1F14A 5KKAA 3GH3A 1UZNA 1UP4A 1TB4A 4BO6A 4G65A 1MV8A 1KS9A 2JAPA 4OIMA 1HYHA 4DQUA 2BRUA 3G3EA 2V6BA 4O5OA 3NV9A 4WUVA 2ZYAA 3HFGA 4CLRA 1I5RA 3TFQA 4XRGA 3HDHA 5A3VA 2VUSA 1TA4A 3AU9A 4J1SA 4ZGWA 1DIGA 2BFPA 3L4SO 4KDEA 4CM9D 2HJRA 4RVUA 5TSDA 3U62A 4XGKA 3GDGA 3UCEA 1R6DA 1W6UA 4P4NA 5ITVA 1P1FA 2PD6A 5IAAA 1DJQA 1I24A 3Q9UA 1E3EA 2DFDA 4RF2A 4FFLA 1E7MA 5T8KA 1IHXA 4CMEC 1XYGA 1O0SA 2YUTA 1T4DA 3EAGA 4YB8A 5EERA 5EMHA 2AQHA 2TMDA 3WGOA 4XYEA 1I3MA 2FPPA 1KVQA 4A5OA 5IDQA 2BI8A 4D41A 2D1YA 1V8BA 2RAFA 1JWBB 2UYYA 2AMFA 1QP8A 5KJEA 3F1LA 3T4EA 3VHRA 4DYVA 3EC7A 3QWFA 3W6UA 2B4QA 1ZKMA 1LDNA 3G0OA 3WYEA 1IZ0A 3WB9A 3PZBA 2IYPA 4WNCA 2WD7A 4NJMB 4W82A 3U0BA 4YCAA 4EJ6A 2WYVA 3X2FA 2YQ5A 4FFOA 1IPEA 5ENVA 4FD3A 4IZHA 2C7GA 4TKMA 3PLNA 4B7CA 1DJNA 3OHSX 5C3MA 1LSJA 4KMSA 2JD1A 1LQUA 3N58A 5F1KA 3FNGA 2EIHA 2BHLA 3CINA 3H9UA 4IQ0A 4IUYA 3WYBA 1JVBA 3RU9A 4EUHA 3K9QO 1DIHA 3S8MA 4CM8B 2VRCD 3R3SA 2D8AA 1ZO8A 3KBOA 4EJMA 1Y7TA 4AICA 3R6DA 3PK0A 4QO7A 3RC2A 2J3JA 2WD8A 2HJSA 3GVHA 4M8SA 1Y1PA 2FR0A 3PWZA 4CV3A 1LDYA 5I7EA 2BF7A 2PGLA 3P2OA 2E4AA 3VZQA 3ITDA 4MVJI 3OETA 4XQ9A 4NDNE 1ENPA 1YWGO 5TT0A 2X4GA 1WXDA 4ZQFA 4B4WA 3C85A 5KOIA 4CMAA 4J0FA 4JJGA 1D8AA 1EVZA 3DBLB 5CG2A 1A4UA 3AU8A 3L9XA 3P19A 1LRJA 2C5AA 2O23A 1ADGA 4PCVA 2GN8A 2QQ5A 4IDBA 5JNLA 4GAEA 4GPD1 4FGSA 5COAA 3S2IA 3ZNNA 3LU1A 2OP1A 2YHIA 4GBJA 4WLFA 3WQSB 1M76A 2AQKA 4U0JA 4B3IA 3HG7A 5BSFA 4RPLA 3V5NA 3U3XA 4BO9A 4XYLA 3PRJA 4FPXA 3DFZA 4N7RA 2UDPA 3WGTA 1XKQA 2DPGA 4KZPA 1D3AA 3VTFA 4MVJD 2IZZA 3BMNB 1YBMA 4NJMA 3DMYA 2J5KA 4R51A 3WGIA 4J16A 2GGSA 4BQRA 3QWIA 2H63A 1KY5A 3WBBA 4L8VA 1EUCA 1GV0A 3BMQB 5DN9A 4BNIA 4CM7A 1MA0A 3LVFO 2EW8A 3RAJA 4Q3BA 1E3WB 4QECA 1HDOA 4D79A 2D2IA 1QORA 4BV9A 3DTYA 4R68A 4CM8A 2WTBA 4WLUA 3VZSA 1GDHA 2DTXA 4HFNA 2I5PO 1X1EA 4RPJA 4YBZA 1KBZA 1A7KA 3QVTA 5HBRA 3TL2A 4TQGA 4HX5A 3VPGA 3I9LA 5A04A 4R5MA 1A7AA 1TLTA 1E1MA 1N1GA 3PWSA 1UUFA 3FCOA 5AXDA 5BR7A 2QYTA 4I1IA 4E5PA 2JFGA 3RUEA 3GNQA 3JYNA 3DBLA 3UW3A 4LCEA 3IUPA 2A94A 4LK3A 3V2GA 1HT0A 3ZWWA 2X0RA 2X0NA 1Y6JA 1KC1A 1B15A 1DPGA 4NH4A 4ZQHA 1HE5A 5K0ZA 4YACA 4XB1A 3ONDA 1I2ZA 3OQ6A 4FR5A 4Y8VA 4RVFA 2P2SA 2F1KA 3S55A 3UGKA 3DZJA 2PWZA 5I7FA 2R00A 3FPCA 3HN2A 2UUPA 3GVXA 2VHWA 2X6TA 3PXXA 1Y81A 1U2GA 1JQBA 2E6UX 1NPTO 3BMNA 3WMWA 1Z74A 4DLLA 3RJ9A 1GEGA 4OSOA 1GZ3A 3GGGA 3I9JA 2PD4A 1GEEA 4J0EA 3D7LA 3BMQA 2YV3A 1Q7CA 4G5HA 4OMUA 4OOEA 4UUNA 1N7HA 3A06A 5ES3A 1DEHA 4Z9YA 1E3WA 2VWHA 2OBYA 2UAGA 4BO5A 1LRLA 1M6WA 4FQ8A 3IAHA 3RASA 4RF5A 2FR8A 3OJEA 4IS3A 4DXHA 4GSKA 2VN8A 2J3IA 2B36A 1J6UA 1IUKA 4A0SA 3DZFA 1BVUA 2PR2A 4Q9NA 3PQEA 2FMUA 3ROKA 3AI1A 2P9EA 4RDHA 2D0IA 2Y0CA 1EEHA 3L0DA 3F9IA 4TRJA 4PLHA 3DZGA 1H9AA 4HFMA 1HDRA 1CWUA 4PN3A 1XELA 3HNPA 3WMXA 3E9QA 2NVWA 4O63O 5JDIA 4KUHA 1RYEA 5A4DA 3LC2O 3EY4A 4DMMA 4KOAA 2P5YA 2Y1GA 3JQ7B 3MTJA 4OAQA 3MOGA 1V3VA 1MXFA 4HXYA 4K6CA 4ZHSA 3HQ4O 4IY1A 4QSMA 2RH4A 4II3A 4IXWA 4XR9A 4UULA 5ILGA 3C1AA 4BNMA 3JQEA 1ZMTA 1AUPA 4XQCA 5GY7A 3E5RA 4PLGA 2NADA 4DC0A 3RUFA 4XDYA 2C82A 2GF2A 4WK6A 4S1VA 5IN5A 3LC1O 1U4SA 1R12A 4AJ4A 4WJZA 2Q2WA 4IDDA 4MVJM 3UICA 4DPMA 2Y67A 4E31A 3U4DA 4AJLA 4YQZA 1M66A 2JJYA 1MG5A 4IJWA 5BSEA 2A4KA 1EUZA 5B37A 3HB5X 2CSUA 4LISA 4B4OA 3NDIA 5IFLA 1LXCA 2XOXA 4CLDA 1PL8A 4QXMA 1LU9A
chains in the Genus database with same CATH superfamily
4K2AA 3VZRA 2BFBA 2VQSA 4D44A 4DBLE 5K3EA 1Z5WA 4DR7B 4V0SA 3QXCA 5COQA 2Q6OA 1R7RA 3D8SA 4D0NA 4AJ2A 2JHFA 1Q7RA 2ZUTA 2G1PA 5FB3A 4DJEC 4YRIA 1EAYA 1C3VA 3AQ4A 5TJ9A 4H1WA 1XGKA 3QHPA 1GZ7A 4ARSA 3THWB 5ALFA 2WFMA 1MX9A 3EVAA 1T1EA 1M0EA 5SZJA 3AZPA 3TRKA 2FSFA 3T0FA 2NSYA 3SR3A 1R50A 2A88A 5K99A 4GW3A 1RXUA 2LW7A 3K73O 1MA3A 1N2SA 3CR7A 3Q7IA 4GMHA 4BLVA 5L8VA 2ZG6A 1FPMA 1XZQA 1S4QA 4I8IA 4MEAA 4DNQA 1XTKA 3VHXB 1SOVA 3W2GA 1XT6A 4KQXA 4KN9S 1PV1A 4DPKA 3BWVA 3A9VA 4CL2A 2ONYA 3NP9A 1PT8A 3NEJA 3OKFA 4ZVNA 5JRDS 1JDSA 1Z4IA 2V5UA 5CEEA 1YTLA 1XL1A 3KXDA 2EDCA 4RLFA 3VR4H 2XZPA 1OV6A 5H8WA 1VI6A 1JEYB 2YVAA 3GLVA 2GS9A 4GWLA 1N3BA 3UJ3X 4ZOLB 4BLRA 3ZVLA 1PUIA 1QUEA 1SUSA 2NT4A 2R2GA 2QLLA 5BYBA 2GESA 1XDBA 2R86A 4PTZA 5T4HA 2GZHA 2C2ZA 1YZLA 1H1DA 1VB5A 1L7DA 3AOEC 4L3VA 2ODAA 1JPUA 2HRBA 3ANSA 4L5CA 4LPKA 1X0VA 3JQ9C 4QYIB 5F2KA 4ZWNA 4WBSA 3ZPXA 1PJ8A 4D4KA 2QZ4A 1KXZA 4F2GA 1H8ED 4FYMA 5T8KC 5CH3A 2Q5QA 4NYMQ 1P9LA 1Q1NA 1MEEA 3TSZA 4BHTA 1T8YA 2NO0A 4X1YA 1TZ2A 5AESA 3FLAA 5TVGA 1CDOA 2QYSA 1OI3A 5KQSA 4N82A 1U2SA 4ODIA 1XDSA 2MYPA 3GLHB 3IMGA 2C3YA 3DMHA 4GYKA 4IV5A 4MV9A 4TVOA 4AJPA 1PF7E 4G4IA 3ZWVA 3NHLA 1EE1A 1D0SA 3E61A 1CS0B 1O5OA 1S3FA 3WLIA 1ZD5A 1E5LA 1GIAA 2X0FA 1NUSA 1PFKA 5CEJA 2RHCA 5K8VA 1CC1S 4GMFA 1DJOA 2FPKA 2QM0A 1NLUA 3FG9A 3KKOA 3ZXYA 4BNKA 1Q7BA 4U8HA 2JJ1A 2WTMA 1ZBQA 1G5HA 2CGEA 3N8GA 1QK4A 2LR0A 2R97A 3A9WA 1MVLA 4X7RA 1GU7A 2A5FA 3Q7RA 3JQAD 3T7KA 4JASB 2O57A 3HHEA 3RD5A 4ZHQF 3RVOA 3QA3E 1L8XA 1N9ZA 3DO5A 4O2BB 4GE0A 1Y0BA 3CR3C 4P8RA 2UXCB 4MIYA 4OXYA 2YFKA 5E0OA 1CUUA 3TOXA 4L5BA 4FZ3A 5B3LA 3MJVA 4JI4B 1XDDA 2RGXA 2D0OB 4LGCA 3ILYA 1VE9A 3KYDB 4RZIA 4XR4A 1BJRE 4Z6KA 2IEAA 2ZRLA 3HBNA 1LTQA 4A0RA 1DWPA 1PBNA 1SVLA 2ZGVA 2W48A 1LW7A 4OHOA 4U7TB 3KQSA 1WL8A 3DFFA 5MN6A 1L1RA 2Q4EA 3D6HA 3Q8LA 4WLOA 1M34A 1BMDA 2QAGB 4HGOA 2NXNA 4NZNA 4F8YA 5KZMB 5EXXA 2Q41A 1D4AA 3IUQA 1GGJA 3DAOA 4JUFA 3LW8A 4WGFA 5ALYA 4AS3A 2P0EA 1LWOA 3ZVNA 1H0SA 1CYDA 2G17A 2WYOA 3GMDA 3I01A 4G4GA 4TVBA 3VH3A 4WKBA 3WZ2A 4B09A 3T1VA 3I5AA 2ENWA 4YCNA 1TJ4A 2I2CA 3GFBA 3NM6B 1JSXA 3KFVA 1NQWA 1O2DA 5E6UB 3S0JA 3WRYA 4DBVO 4BJ6A 2VEOA 4S0ZA 4MR7A 1P1BA 5C2JB 4FNMA 1N4AA 2M2IA 3ZTTA 4B2IA 4U63A 1JE1A 3C45A 4PWZA 3H2HA 4TLDA 1NX6A 2H1OA 3IEPA 3R5SA 4MW7A 1CQPA 4M0MA 4QICA 4UBMA 2BUBA 3FPLA 4YR7A 3U9TA 3RBAA 2FSVA 2C1EA 3TQFA 3SVZA 1CUFA 4AP6A 4B6QA 1WETA 3Q3HA 2H48A 1UJ6A 4B75A 4IINA 1Z6AA 2Q21A 3SJUA 1P31A 3OZ7A 4I6EA 4BV8A 3IPLA 2GYYA 1B93A 4IIBA 2PUBA 1RJ9A 5LMCA 1FNMA 1GSAA 1GZ6A 1VLZA 1GPNA 1PJAA 1PN3A 2Q8NA 1B3RA 1E1DA 2GN4A 1VPTA 3LUGA 4HTAA 1M1YA 2VDJA 1R6UA 2P1RA 2VF5X 2VVTA 1VG1A 5TPZA 3TI7A 5B6JA 1PJ4A 1ZX1A 2WU1A 1XLTA 4JXXA 1EGVB 3UYLA 4WAUA 2ORWA 3BN3A 1XXHE 5HJ2A 5TLSA 2WT8A 3VR4D 5D87A 1WMAA 5LB4A 3LUAA 1Y3CE 4RS4A 4JLJA 5FR1A 5BV1A 5DF1A 2QMQA 1E6CA 1VE5A 1JU9A 3EWNA 4WKCA 5ICFA 2JA2A 2J9YB 2WKWA 1TMGE 1UINA 5BOSB 1FTNA 3DONA 1XK7A 5KJFA 1GT6A 4F96A 3LCRA 1DKRA 3C6YA 4E2ZA 2V9PA 4J3FA 3V3KA 2D5IA 1E18A 5JQGA 1JWLA 2ZJ0A 2DEUA 2INGX 2EJWA 4BGUA 2WKRA 1ADCA 4NAVA 5IKXA 1PD0A 1HTBA 1ISPA 4FLFA 3IO5A 2GAAA 3BBLA 1YMVA 3F2VA 4MUGA 1B8OA 3F6CA 3WA7A 2ZBDA 5U4XA 1QVZA 1TW3A 3B6ZA 1KSJA 1KYTA 1VL8A 3G8YA 4G5OA 5KWIA 2YNMA 1ADJA 4DNPA 3IYLW 2VPWA 1W88B 1ODJA 3JRWA 3N6RA 2D4HA 2CNNA 2NZ2A 1UBHS 3OZFA 4FGLA 4IGFA 5E7JA 5K3FA 5KX5A 2BJWA 2ZI6A 3QTTA 4BNHA 3GOHA 5KYYB 5CXUA 3HYTA 2VJCA 2C5LA 2W7TA 4BNJA 4EVSA 3KEQA 1YB6A 5G2OA 4KHPB 2A0UA 1Z29A 4TYYA 1Z4OA 2GTHA 2XOEA 4K86A 1DC5A 3OTHA 4LYAA 1S8NA 5BSVA 2IYAA 4ICIA 2ZYDA 1OYVA 2H5JA 2X15A 3O3MB 4K9SA 4ND7A 4U6QA 3H6GA 3WKCA 2AOVA 3CY6A 4UAJA 1JDVA 1X6VA 4OHXA 1I7NA 3PQ3A 1FZTA 3TQTA 1FDIA 2MTBA 3LE8A 1G19A 2CLEB 3WGHA 4DBZA 5HKOA 4WA8A 2D7DA 1TTHA 4B4UA 3OFSA 1Y1LA 3I42A 1WV0A 1EUYA 3RBXA 1CDZA 1CY2A 4FHFA 3K92A 5L6MB 2OQRA 1R0BA 3KX2A 4QBIA 1FVOA 1RLIA 1YA8A 1C7JA 1ZCAA 2VDWB 3ROPA 5CXQA 3WQQA 2WJWA 5A0TA 2QU8A 5EE1A 2L2QA 4I9UA 5GV8A 1ZSNA 4AIRA 3OIUA 1WJGA 4BFLA 1A96A 5U9CA 3F8SA 2YMPA 3BRWA 3KSRA 3V1MA 3HJGA 1NSFA 4PV7A 3E05A 3IPXA 1ZL0A 4XXHA 5KIAA 1DBRA 2KI5A 4LXTA 4OQYA 5CBPA 3MIZA 4DCNA 3ZKWA 5E9JA 4CF6A 3PKIA 3M49A 4ZT6A 1VJTA 1SKYB 1Y7LA 1MPXA 2WVJA 3HEMA 4LTMA 4OHBA 4QD3A 1J8VA 1XTPA 3ASUA 2KMLA 1LK7A 4ZV4A 3CJTA 4PR3A 3UO8B 3ZBPA 3FYHA 4Q39A 5L9AA 1OD6A 4G0XA 2GFIA 1W36B 4KVZA 4G0YA 1HC7A 1TM5E 4G26A 1F3LA 1TZBA 2M1XA 3ICCA 5HMLA 5IJZA 1QTIA 3PHJA 2XTNA 1U8CB 2JLYA 5M2QA 3L84A 1KR2A 1IIBA 2KM1A 1TO1E 5AVZA 2ECOA 3SZRA 1TQDA 1KYVA 5GZ6A 3UGQA 2I8AA 1N2IA 1DUSA 1LV7A 2Q7XA 5CDUA 5EQDA 3PVCA 1NULA 3HYNA 1UFKA 4AMYA 4ALNA 1SVUA 2PIDA 1CR0A 4LW8A 3EW7A 3S1AB 3AKDA 1FU4A 1NNLA 1NUUA 2AJTA 2JB9A 1Y6ZA 4LY0A 4D56A 2OWEA 1CJMA 2OXCA 2Y0PA 4I08A 2HGZA 2V5VA 3GZNB 3OD5A 4G5SA 4RXTA 4XVRA 1UMBA 3ME5A 2ZI3A 2C8VA 4IIFA 4OQQA 2D2XA 2GFQA 4X95A 2RHRA 3UC9A 3DXYA 3VSEA 4MYUA 3I2HA 1ISHA 5AKXA 2RHGB 2OV8A 1F2TB 1DG9A 1QFYA 4MV4A 1SHTX 3E9CA 2UZAA 4QDTA 4MQ4A 3F74A 1DDOA 3IIKA 4RH3A 5GJWC 4FZJA 4AMVA 2GBGA 4JBYA 1VCIA 1DX4A 5JSZB 1YCFA 2WTNA 4JR0A 5J4KA 4LZZA 4QODA 4JU8A 1TTQB 3DR3A 1GCGA 5ALLA 2ECPA 3I83A 3DTVA 1ZGJA 4KLNA 2C9OA 5A2QA 1I13A 3STVA 5FLKA 1XEXA 4PAMA 4IVPA 2IY7A 3E18A 5SY6A 1X42A 3UG7A 6PFKA 3WAJA 1F38A 1LBSA 1RM5A 1S6YA 3FPKA 2IHBA 1VIMA 1QV9A 4G5FA 4XWOA 1YA6A 1T34A 3OOYA 1JR3A 1G0NA 1M9NA 2VHXA 3VU1A 5EJ5A 3OEHD 1XWFA 5BN4B 4PAGA 4YS6A 1PR9A 3ZY6A 1YJAA 4FVTA 1KQ3A 4JENA 4OGKA 2B9VA 1OBFO 2H1HA 3JATA 2VJDA 4TYMA 2BY4A 2NUPB 4D9KA 2CV0A 1DCMA 1WD5A 1BXGB 4BGDA 4JH0A 1E4EA 1HR0B 1Z6GA 1JLSA 3F67A 1I6KA 3L4BA 4Q4HA 3TO5A 1A77A 1QIMA 1PZEA 2C8JA 2H6EA 2ODWA 2GZ3A 2PFGA 5BQ3A 1S2MA 1P2UA 4QDOA 2AZ4A 3WHKA 5ELLA 3NS7A 1FFEA 1I7PA 2AFIA 3IVCA 5HBGA 2W4QA 3MHTA 4BCBA 3NHUA 3ABOB 3FKSD 2FEAA 4GHWA 5ALOA 4B4KA 3VH4A 2HA0A 3A6PC 4RVHA 2IZ1A 2XGOA 2GRAA 5AHXA 5H81A 3P32A 3V2IA 4O8ZA 2FMXA 2AR7A 4DL9A 1GVNB 1TA9A 4IYRA 5KC9A 3FFBA 1EG7A 5J4VA 1KI3A 2V1XA 3UVEA 4WHMA 3QRWA 1R0ZA 1FNSA 1SHZA 4WN3A 2IYYA 1Z45A 2G9QA 4HXFB 2FN7A 5F76A 2J7PD 3K05A 4YRGA 4N9WA 1XZDA 2G8LA 5EGSA 5KAPA 5BQXA 2CSXA 1NQAO 2X6RA 2P5UA 2BW0A 4I6JA 2B8TA 3ZGOA 2D74A 4OK6A 3KL4A 2JAUA 2QVZX 3FR7A 1FYXA 2VEDA 1M6HA 5HKKA 1IVSA 2HWYA 3O3OB 1J25A 1XZJA 4G85A 1Y9ZA 4W8GA 3UXMA 2JJMA 1B41A 3PNBA 1V5IA 2Y05A 4E6PA 4MW6A 2WAOA 4F4DA 3Q2OA 3FHTA 1BZYA 1XALA 4FYXA 4YRBA 1HNZB 2Q3EA 1E2QA 3BFJA 3Q0EA 4O2AB 2QN2A 2EKBA 1Q17A 5D2CA 3OIDA 5FTLA 1B7GO 1ICEA 3U17A 1DG1G 4Q3KA 7YASA 5KVCA 5FA6A 3SE0A 3FCUB 3N53A 5DTRA 5GIPE 1SXJA 3RUIA 3REQB 2R9VA 3F46A 2HMYB 1CY8A 3HADA 1GTZA 4OJMX 5I5GA 1G18A 3MWKA 5E1MA 3TW8A 1LDMA 1N9GA 3LTNC 4GRDA 1QG6A 1L6RA 2XEXA 4LXUA 3G8AA 4M7OA 4AKEA 2ZVJA 1MC8A 5IABA 1ACJA 1WNTA 1KIAA 2HF9A 2Y0BA 5I9MA 2I80A 3Q98A 1G4UR 1ZESA 1EP9A 3GUUA 4YMSA 5A4MS 3A1DA 2JKYA 1L6IA 1K92A 6ADHA 1FYDA 2QSJA 3WL3A 2VT7A 4NFSA 1DFIA 1F2UB 4GX0A 4LHSA 2QQFA 2V7WA 2EGHA 3RHTA 3WLJA 3L9WA 3BWCA 2DBQA 3A6EA 3CT6A 3JQDA 3RTGA 1KJIA 1TVCA 5I8WA 3G79A 1O5IA 3UXYA 2AMJA 5AM3A 3RYTC 1RM4A 1E2DA 2C00A 2R5NA 3AILA 5FAKA 3F3MA 3RSQA 3CGGA 4O4HA 4AQDA 2BGTA 3RIYA 4BQSA 5EHQA 1X38A 3PNKA 5B2ZA 4CNBA 4EYSA 2WR8A 2A0WA 5AD1A 1MFZA 3Q3VA 5F5NA 1Z2PX 2XECA 3NETA 4U3JB 1TPYA 2C0QA 4OQ4A 3RARA 4BGVA 3UMYA 2AJDA 1OSNA 1S4MA 1ZJ4A 2BBSA 2DPMA 3CA8A 3HL0A 4IRXA 4FC6A 1SXIA 2WDPA 2YINC 3F1KA 2ZUSA 2VK2A 4KV7A 4QJIA 1OFHA 1UMCA 4OA8A 2HJ9A 3NI2A 5MHTA 3TECE 1DC7A 3PT9A 3J7AC 2JRLA 3DZIA 3Q8KA 4D6YA 4RPKA 2BCGY 1VSVA 2OB1A 3KJEA 4QPJC 5F23A 1C1DA 1Q3KA 4H6PA 3WL8A 1YBHA 3RS8A 5AK3A 4B9AA 4BVBA 4BVHA 1I33A 4HATA 2EZ4A 2W43A 3LQFA 4TV8A 2B2NA 1PZXA 1M8FA 1PJTA 3LM8A 4A8PA 2Y1KA 1ZKDA 4P34A 2FCRA 1ZIPA 1TYEB 3MF4A 3OM9A 4XGQA 5K45A 1WZUA 4I5IA 2GZ2A 5EE0A 3MTEA 5EHZA 3EYWA 1A8HA 1EKXA 1A9XA 1P2VA 1SD5A 2OAGA 3DAGA 2BTQB 4JQSA 1BQEA 1TPZA 4RQAA 1R3DA 1SA0A 1SU7A 3HJBA 5CDFA 4DYHA 4MRVA 4DA4A 4XUGB 5E8RA 2WWWA 4HXEB 2FXVA 4OLFA 4OEHA 4XUEA 1XMXA 3RF6A 3LA6A 3TBKA 4EY7A 1G5IA 2G1KA 2WIDA 3OSZA 5BNFA 1GA1A 3RIXA 3CXRA 5J47A 6REQA 2VQEB 1ZK3A 3NVAA 3P0EA 4GXRA 4GSLA 4YMUA 4BLSA 3CMMA 3HKDA 1K3TA 4JA0A 1VXRA 3RQSA 2W6MA 3TNDA 3LHFA 5CFRA 1F48A 1UKVY 4Q3AA 3QGMA 1EQ2A 1XAGA 1QPGA 4NPAA 5TQ0A 4ZYWA 5JBQA 4ZCPA 5HTKA 4B3FX 1M2NA 5FTNA 1PLJA 3BWDD 3AERA 2SECE 4YYEA 3ZE0B 5CIQA 4EGCB 2HF8A 5IDVA 4ZRDA 3WGGA 1KJQA 1OE0A 3A8TA 3KQQA 3E4DA 4ZEVA 3QVUA 3ZWKA 2BFDB 1XLUA 4Y2YA 1TTTA 3WIUA 3TSCA 4MV0A 3QKUA 1RVDA 2IP2A 2FQQA 4QAQA 3ZCVA 2ZYTX 3VNAA 1WLYA 2QF7A 3QLUA 1ECGA 1Z82A 4IP0A 3E0XA 1MJGM 4NJEB 5HRUA 3DLCA 3VSDA 3M9WA 2PXAA 4BMSA 4E03A 1J09A 2E48A 1T5OA 3JU3A 4L9WA 1E8MA 5CPBA 3QV1A 1XG5A 5CM2Z 1USIA 3EQ2A 3O38A 4PX2A 1JYEA 2ZTLA 5I9TA 3RNLA 5B6IA 2O2HA 5DXAA 1JH9A 5DYYA 4W5RA 2XCUA 4TX1A 4W63A 1G9TA 1TVKA 4RTPA 5GZ3A 2DE0X 3NJ4A 3AUAA 4JLUA 3TAHA 3DLBA 1JWAB 3D59A 5LZ5A 2VIIA 1SUIA 4OQZA 3ZUGA 1CXZA 1TYCA 4LJ7A 3UHAA 1VL6A 1KK0A 2G70A 3JASA 3DVLA 4MDFA 2JAQA 3B2EA 2V3WA 2R0QC 1P81A 2CCJA 1ORIA 4L5JA 4QBGB 4EVRA 1N2CA 3A1NA 2V9CA 3UJCA 1CNMA 2QX9A 3ZNPA 2HA3A 1QPZA 1QGAA 3SS8A 1C9YA 3UWDA 1AJEA 1MJNA 4RA6A 4LF9B 3GGOA 4BB0A 4RXUA 3BE5A 1GKKA 1U2DA 1YXMA 4FSHA 4V0KA 3T5TA 2FZKA 3VU9A 2YS7A 4J0GA 4M0FA 4LJAA 2F2TA 1OBVA 1SUCA 3AO0B 4JLSA 3BTSA 4JLVA 3ORFA 3ADCA 2BCJQ 2QVLA 5HS6A 1ONNA 1EUDB 2AN4A 4J90A 3QUBA 2P11A 4QRDA 3MEQA 3TRFA 1HMPA 4X6XA 1K8XB 5JEEA 3GRRA 3QUAA 2D1FA 3L6UA 4UD6A 4YHHB 4QTYA 3RADC 2GYWA 5DOZA 3AM5A 3CCBA 1J0XO 1W2HA 2B82A 2P4SA 2XQFA 1VLQA 3P0HA 4R9RA 3WDMA 3ZEIA 4B2YA 4KWEA 1YOBA 3RYCB 3NIBA 5AKZA 4AY4A 2O7RA 1VMDA 2I55A 2IX9A 3R20A 2I99A 4I55F 4DZRA 1MW8X 2Z9DA 3II6X 1WCIB 1H9BA 2Z57A 3SIPA 1RKXA 3SJZA 4XVUA 1CE8B 1P0PA 5FI3A 1DGQA 4IV8A 3MZ0A 1P44A 2HMTA 2OGTA 4GMGA 4N54A 1W34A 4IIXA 1PS8A 2Q5HA 4FMCB 5IJWA 4UEJA 2HDNB 3JWPA 2HQ1A 5F3DA 1YFZA 3ND8A 4OMDA 5EY5B 5LA6A 4MAAA 3W79A 3T5DA 5BUZA 1OXBB 3H8WA 1DIAA 3MJFA 1PJBA 3ZCTA 1GUAA 2QV0A 4J4BA 1E62A 4OI1A 3GA5A 2NQ2C 4HSEA 4L4RA 4NAHA 3TLZA 1QDUA 3IULA 2VJMB 1J8FA 3F6PA 3QEMA 4H4EA 2BN4A 2XY4A 4D6PA 2W6ID 5J2TB 3NQ41 3LZ6A 2AG1A 2WMOB 4WCVA 1CUAA 2B20A 3X1DA 3WNDA 3Q7QA 2J0EA 1OOEA 1WXEA 1MFPA 3G0BA 3N2EA 5HFNA 4AMUA 2RAVA 2IDKA 1A2QA 1EG2A 1WOMA 4HH0A 4AQYB 1R0KA 2FP4B 3FGZA 3RM3A 2D7CA 3AEQB 1L4KA 3KO8A 2GA9A 5G0VA 3WISA 3QZUA 1LDGA 5P21A 3D0KA 4IM7A 1WP9A 4X44A 1EDDA 2E3JA 4S04A 1XKLA 3QE0A 2XCLA 2DXIA 3MMZA 3E0QA 4UXHA 5JMTA 1YK1A 5JWRA 1VSQA 1NSYA 3M7IA 1X2EA 2GZDA 4LX8A 2B8NA 2DPYA 3IEUA 3K6RA 4QPNA 5THQA 2O5CA 5EIHA 3ZU4A 2WAYA 2FQXA 2IUYA 4IJUA 5KWJA 1F1JA 5D1NA 1Y9JA 2P75A 1BS2A 1J22A 1WDKA 2R68A 2W8BB 4GPAA 4MKRA 2IUUA 4EP1A 1ICIA 3MGCA 3TWOA 4Z9BA 3K0EA 2NO1A 3AVPA 1RQ2A 3EQ8A 3BTUA 1XD2B 1T3LA 2AOUB 1EXVA 4AY2A 1GSIA 2WUDA 3RVSA 3FVTA 1E77A 1WF3A 2NU8B 5EJ8A 5I7VA 2HUNA 1HM5A 3ZBUA 1YCGA 3GAFA 4RESA 3MN1A 3PIIA 3S2SA 1EP2B 2RHDA 4HRVA 2C61A 1Y8QA 3SX4A 2CHGA 3A3YA 2ZT5A 4FMDB 2JCYA 1YS1X 1BDMA 4YRRA 2F3SA 3KJQA 2PLRA 4LFAB 5BUSA 2PX4A 1F6BA 3F4BA 2PRZA 2ZSIA 4EHAA 1CIPA 4C88A 4MGEA 1JAZA 4OJQA 2PQ6A 3G59A 2XEDA 5HR5A 3H5RA 5J63A 3M4YA 4EZEA 2WTAA 2UKDA 4C3UA 3HBJA 2QZ9A 3C6XA 4RKRA 1YKGA 1C80A 1XLWA 3PYMA 4LUCA 4EW3A 1S1CA 2W98A 2WV9A 1IZ8A 5BSRA 4PG5A 3B70A 2CNBA 4KBGA 4B3MB 1AA9A 3Q6IA 4HMOA 1H0RA 5EKXA 3GLSA 5IK2D 1ZFNA 4DCJA 3WIOA 3NBZC 3O90A 4YRZA 2WFLA 1GSOA 3OIWA 1KNXA 3NRCA 3M6WA 4M38A 5ALNA 1PFWA 4J94A 4S1TA 5REQA 2W6PA 5HA5A 2XNJA 2YV1A 2BM8A 1E32A 1VKZA 5KSOA 2NXJA 3THYB 3BWBA 4TMTA 3GFFA 1M2VA 1TCBA 2GCOA 1P5FA 2GO7A 2QAIA 4UZSA 2CBXA 1IUPA 1A76A 1IY1A 1ORRA 1K9VF 2BGUA 2HOQA 2IHTA 2J8ZA 2NNWB 2PKRA 4A0QA 4AL4A 4TUYF 5I47A 1WUJS 3ZGXA 3NPAA 4EUKA 1X1QA 3FZGA 1YS2X 4BATA 2ZJAA 4CETA 1ZZGA 4TTTS 2VYVA 3C4VA 1N2GA 2D59A 2ROQA 3VO2A 5DULA 4R6WA 4LMBA 4NECA 5T4EA 1SIUA 2XVXA 5DGHA 4EKDA 4UC0A 3RUDA 1A2KC 2EYQA 3DD1A 2OYRA 1ZNQO 1BN7A 2RG1A 3IBGA 3O03A 2AKEA 2B0CA 1BX0A 2HT1A 2QENA 4RDCA 4PICA 2P9QA 1OC4A 5HWSA 4CDRA 1JHMA 5K4AA 5AW5A 4JGBA 2ZJFA 4KAFA 3AESB 3AWIA 1UFVA 2HPZA 5I9LA 5J4YA 4KJXA 1GQ2A 3D3NA 3UUGA 2XVAA 3M6MD 4NBRA 5J1SB 4YEDA 1ZIOA 3JQ8A 5GONA 2PAAA 1X9GA 2C59A 2OO3A 3OEWA 3W0LB 1N2XA 4IKEA 1Z39A 4J7XA 4L8FA 3ECAA 4EO7A 2E4XA 2O4CA 2MYUA 4QUEA 1A9PA 1M75A 3IAXA 5F7OA 1E6LA 4DMHA 1FP4B 3I8XA 1T36B 1U1GA 3DNFA 3IAFA 1Z5GA 2C4UA 5K1ZA 2O1XA 4P9NA 3WXMA 4WECA 1FA9A 2FUNB 2P3LA 5C1PA 3WLRA 1M2WA 3TL6A 3WKAA 2DHEA 5KB3A 4NS4A 4P7FA 3SP1A 1FW6A 1ZCFA 2WPNA 4PGHA 3HCWA 4PN3A 5K0TA 2H7YA 4RHTA 2FWJA 3JQGB 1VCNA 2I1WA 3EFOB 3LHDA 3AYXB 1H5QA 3LUBA 1EHCA 1M2EA 3GRUA 5LKRA 3TIVA 3UBTA 2CYCA 1QJ4A 1T43A 2OZEA 5LZ2A 3W5IA 1UKYA 3CB2A 4S05A 3NEAA 3ZDRA 2VK4A 3K5PA 2ZIWB 1KPGA 3NT2A 1K6MA 3EPRA 4XAQA 4EHIA 2VFAA 4MVYA 4TWBA 5JSHA 3F6EX 3MRXA 2I2FA 5L7WA 2AEFA 3LDFA 5IWAB 2R84A 2CVOA 1IM8A 3KXIA 1S8OA 2XRMA 2CXOA 4OQDA 3TKAA 3OZTA 2PO5A 1DMRA 1LLDA 4GPZA 4QT4A 1SBTA 4MPJA 5FULA 4PRZA 2M98A 4U5QA 1U28A 1L7XA 1ND5A 1Q6YA 3EPLA 1GQYA 3C5CA 4KJZA 5D3MB 5CDHA 1BIFA 1Z2EA 1ZK0A 3K0SA 2DKOA 2MSKA 3E9NA 1UK9A 2CL6X 2YXDA 4DABA 2HLNA 4F5EA 3CVWA 5LQDA 1XTIA 2WJGA 4MIKA 2ECFA 1GTVA 5E9WA 3PIDA 2AF4C 3AL3A 3USCS 3O83A 3CH5A 3M4XA 4LFBB 2FW9A 1QUFA 4LE0A 3BCRA 3RGGA 4TL6A 2XKBA 3ZX5A 2XLCA 1CQWA 1GRNA 2VP9A 1XFDA 2JFOA 3L8DA 3QVOA 3OE7A 3WJAA 4KAJA 3UK7A 3HKEB 1XA4A 2KE5A 3EGOA 3ICWA 3EGDB 2ZR8A 4RTSA 4HLUA 5CW2A 1M34E 3MWEA 4A10A 4AUEA 4ER6A 5JYEA 4NE7A 2FOLA 3OCXA 4TSKA 3VDRA 4KXLA 3TIXB 2AWNA 1D2RA 3T5BA 2OUIA 4IOJA 2VRNA 3CEPB 3TOVA 3ZH9B 1O94C 3BRQA 3EZNA 3FTCA 1GPJA 2HXGA 5DCUA 2O2SA 4QNRA 2AH5A 3IUYA 4RIIA 1VCMA 3OPYB 3RABA 1EFRD 1UJMA 2PT7A 4AZ3A 1EVQA 1U9IA 4GWKA 3BERA 3DV0A 2WYWA 4KAXA 2WV7A 4C7MA 4LC9A 4EA7A 2DCUA 3ACBA 3JPWA 4O4IA 4Z1OA 3T9AA 2BFCA 4BVAA 2HA7A 2FMKA 4EW1A 1QLJA 4B0OA 2PZBA 5GJCA 3BWMA 1ZH8A 3B1ZA 2EBWA 3F98A 2WIAA 4TKZA 5HW0A 1QG2A 4Q3DA 1E3IA 1ADBA 3WMGA 1KAOA 1QC5B 2FMFA 1J2UA 2IXEA 4N4AA 4Y2PA 4YJFA 3LWZA 1NVVQ 1RZ3A 3NW9A 3OU7A 4BTEA 3VBEA 2YOFA 2AWOA 4NNJA 1WXGA 3E5NA 3L18A 1BG6A 1CJTC 2ID9A 3LOQA 4BKMA 1FSZA 3QELA 3T3NA 2BFFB 4QGFA 4QUAA 1DP4A 2HQSA 2ZBEA 3D81A 1M2OA 5BYAA 1W7AA 1HYBA 3NXKA 1V41E 3M9XA 4LSWA 1QIHA 5JCOC 3DC7A 1OAOC 2HWWA 3TSOA 4B6SA 1T2DA 2Z56A 5HF8A 3WRWA 4CIBA 3JVUA 3ASZA 2B5OA 1A9TA 3IEKA 3OOSA 3JQBC 4N0DA 2CHQA 2IEZA 3BVPA 3W5CA 1OXMA 4O4HF 4QXAA 4LMAA 1I36A 2JJ8A 4K6HA 2GN2A 4RMJA 4B7XA 2WICA 3KC2A 5JCJA 1ZCBA 5AP9A 4ZTUB 4KXWA 2IHVA 5ARDA 3RJZA 4H1UA 2BCEA 1E7WA 5HMMA 4XJVA 2OAP1 3KJZA 2OR3A 1OZHA 4EPWA 3KSMA 1P0IA 3PD7A 3QE4A 2WNIA 5IH3A 4FLEA 4RENA 4WE3A 3W5HA 1N7GA 2ZVDA 1IRXA 2JJ2A 3M33A 3PJGA 5BRNA 2BD0A 1E66A 5KKNB 2A9VA 5IT4A 3IX7A 2N1MA 1BVHA 1RJEA 1QF7A 5JAPA 1SOMA 1ZQ1A 2X8AA 3ANNA 4IFIA 1TK2A 2Z6VA 4N41A 4AECA 3GJXC 3L1KA 4PCLA 1SOWA 1SC9A 2QTRA 3QTBA 4TV8F 2O5VA 4E46A 3GU3A 3T94A 2VYND 3PJFA 3S99A 1H22A 1IEVA 4MKIA 2CLLB 3FSGD 4Q5IA 3NONA 4KK4A 1UPCA 3HN7A 3U9SA 1M6VB 1U1DA 3Q8WA 5EP4A 4EY8A 3I1FA 5F33A 4BLPA 2DQ4A 3EJWA 4MGIR 3PTLA 5H02A 3GCZA 1ECCA 4E32A 1JIQA 1JFFA 2XE7A 4IFEA 1G38A 4LJRA 1NI5A 3H3XA 5DTMA 1H2EA 1MIOA 1XZGA 3HPRA 4Y6LA 4M9QA 1Y5RA 2E85A 3ZW8A 3DL2A 2OQ2A 4TWJA 5EA2A 3QE3A 3DYIA 3AB8A 1GD1O 3I8OA 4LHYA 1H2YA 2WDZA 4L5YA 3OJ0A 4MGZR 1HZJA 4OQPA 1TM7E 4DIDA 1TD1A 4N7JA 2QT0A 2REQA 3R2JA 1LF0A 3V1LA 4EQ6B 1J70A 4CQJA 3MWFA 1UOEA 4CEIA 2ISCA 2ZR7A 1OHHD 1RIFA 2QR2A 3WSWA 1Q0QA 3SBOA 3HNOA 2KPOA 3EIWA 1A9YA 3HA3A 2FMHA 4GLJA 4NC9A 4CM9A 1OFIA 2V3VA 2PZ8A 2X4DA 2BE7A 1A8PA 1D2AA 4YJGB 1BS9A 1YS4A 2YYZA 4ND3A 4XIGS 1JG4A 1G60A 1AK1A 1QYXA 5LB2A 1T9CA 3DDWA 4MWCA 3EUWA 5BR1A 2V4UA 4TYQA 2X8JB 2I8LA 1CY1A 4A36A 2HSGA 5DLDA 1K7SN 1KHHA 1M67A 2CLFB 1NVDA 1YL7A 3HRKA 4FX5A 3MSCA 4JJKA 1R4MB 2OGZA 2PV0A 5F51A 4N47A 4AF7A 2BFWA 1GQRA 1R2QA 1ZM7A 2DPXA 2ZRHA 3PCRB 2JCGA 3DNPA 5DSZA 1I7QB 1YTUA 1LPSA 3FAZA 2H4YA 1KOFA 1L7VC 2VT2A 1USGA 3SXUA 4NYMR 3RK0A 1W59A 2V58A 4FOLA 1TU4A 4CVNA 1JHAA 2OHFA 2WJPA 2OCDA 1K6XA 4W5HA 5BT9A 4EBBA 2GHRA 5B1YA 5FORA 4PHCA 1DQSA 4H0CA 1K7YA 3PC2A 3VNQA 4PPNA 3DE5X 1XRLA 2ATCA 5IEJA 3ZZ0A 3I1IA 4DV1B 5EYPA 1XYYA 5IC6A 3UMBA 4P7GA 3C1UA 1Z7EA 2QIPA 5G0TA 1IXZA 1T4GA 2V9ZA 1W36D 1DC6A 2I71A 3KPYA 2JEOA 1T29A 2ZB4A 3PHLA 4EEXA 5FEMA 4HNVA 1GZHB 2DFKB 3HMQA 4UU7A 1IXKA 1FCJA 4M1ZA 5BWNA 5HIAA 3RSFA 3CTPA 5EFZA 4A2CA 4CMKA 1AKQA 1PLKA 1HZZA 1U98A 1XK6A 4KDRA 4KDFA 1VIAA 2O0JA 5TARA 1SBQA 5BVGB 3I3SR 3PJRA 1K5GA 2EP5A 1HEUA 1TTPB 1WU8A 1AQJA 2ZATA 1SXQA 3R75A 3W5VA 1W1UA 1TLFA 3LH5A 2C58A 1K5DA 4MS4B 7REQB 3EN0A 4ZCLA 2GB4A 3IKJA 1SZCA 2QTBA 1XRRA 3ZV5A 3ETEA 3QPBA 3SYNA 4FZ5A 4LXHA 4YPFA 1IC6A 2OHIA 2VXYA 3KSAC 2YJ4A 5FL7D 5J23A 1EVYA 2ZBQA 4WFJA 2ZJBA 2QRLA 4MAFA 4EPXA 2BEUA 3A36A 1YR2A 1U3FA 3IOMA 3PUHA 4ZO7A 1SG9A 3TN7A 4D8VA 1I51A 3CLRD 5TMPA 4U1RA 4HVTA 2RBGA 5CU7A 4YXWA 2AE1A 4A0FA 6LDHA 3VC3A 1UBFA 5F12A 1OXTA 1ZSVA 3CZRA 1NMYA 2CVPA 1EFVA 3DHNA 3ZDFA 1C0PA 1B8VA 4R9UC 1Z12A 2AEMA 4XASA 3HB4X 3UXHA 3QBJA 4L95C 5EKUA 3TGLA 4AQ7A 1U0HC 5B58T 5LA6F 3OZIA 1G3IA 4PRKA 1OTHA 3KK0A 3CW2A 4JI6B 4TM7A 5T41A 1N2HA 3KT3A 4PPYA 1XZHA 1E6KA 2LXNA 3RBVA 4YV0A 4OLBA 4OYHA 4XUCA 2GPTA 6CHYA 5K6AA 5HF6A 3KQYA 1ZUHA 3FNIA 3KOZA 4EHLA 4YGXB 2H54A 2EBFX 1TC2A 5ALUA 1FDSA 1X80A 1FJGB 1EXNA 3IQZA 1QIGA 3GPCA 3IIMA 3LOPA 3GI1A 5AJWA 5F3WB 4BCCA 4ZK2A 2ZJOA 4F84A 3ZDQA 3IKTA 3SZMA 1LRKA 4MKXA 5JSYA 1Y48E 2V54A 2DB3A 2HBYA 4TROA 2ZRMA 2PYZA 3LS2A 2G82A 2YN0A 3UWKA 1R15A 2F4NA 3WV4A 1C7RA 4CODB 5TV2A 3RVJA 1V3UA 4EG8A 4W6ZA 1D2MA 3T5MA 1SULA 1MLDA 3N28A 3BSYA 3QMPA 4XUDA 2OXIA 3B1YA 1N5LA 2I54A 5ERYA 4DLBA 5AM5A 3PJDA 4YRCA 1RCUA 4Q7MB 2GF9A 1YR3A 2GEDA 2JFYA 3M5WA 4FDTA 1LJ8A 3OVMA 1ODTC 4KIJA 1J0EA 5L7TA 2W6ZA 1D1SA 4EO4A 3CNEA 4CV1A 5M7EA 4UHJA 2QOEA 1PQ4A 3AP3A 2DERA 3IEIA 3TNJA 5JD4A 2A78A 5CITA 1DUIA 1SXJE 3NKLA 4FS3A 2OTCA 3EIFA 2QTCA 3T12A 1CW2B 1D1QA 4Z2AA 1I4TD 3RC3A 3G9QA 3TSWA 1CB0A 3V4VB 3GLIB 3PXAA 3TMAA 2EGUA 1JKJB 2PSSA 2QSYA 4G0WA 5AVOA 3COPA 4HWSA 2XCSB 2P27A 4NDZA 4D9BA 5AI6A 2IV3A 3UOGA 3LGXA 5IFKA 3LQYA 3S81A 1R0XA 3CUEF 3V8BA 2HRRA 5EPEA 2VATA 1MRSA 4G8JA 5FADA 3B6MA 3Q0TA 3U40A 1G5QA 3W5UA 2PZLA 4FS8A 4BE4A 5F9HA 3CHYA 4C2AA 3R4CA 5EHNA 1NX9A 4MWOA 1P39A 1SRRA 3LRPA 4ES6A 3PQFA 1M2FA 3HCPA 3IVMA 1ULHA 1Y4UA 4M83A 2VXCA 2FFBA 4POAA 4Y9SA 1IN8A 4JUDX 2GUGA 3PZRA 2FGJA 4NBUA 2J9GA 2J9XB 3CPSA 3EQ6A 4LCBA 3IDOA 4COKA 5CIYA 4QPPA 4XWWA 4NCHA 2A86A 3SEZA 3STTA 3O8OB 4RTJA 3D7MA 3LLSA 5BN5B 1YZFA 2QGNA 3QOFA 2RJ3A 1VJCA 2ARKA 3KZXA 3MJTA 4KDCA 1AG9A 1VSUA 4MP8A 1Q57A 3CSUA 4GE3A 1KR5A 4G07A 3QLVC 4R9NA 3V3TA 3U9LA 4GS5A 5KVVA 3K35A 4DIEA 5A0VA 1TZKA 3L6RA 4IMJB 3PVZA 2VNHA 4ALJA 1KEKA 3BJEA 1ZD2P 1ZOOA 2HUPA 4P08A 4EAQA 2Z2XA 5EIAA 2C29D 2PWAA 2Y1DA 5GOTA 4ZCRA 1CU1A 1KVSA 2RKWA 2ZOSA 4X91A 4X64B 2YXLA 1YR8A 3IPRA 3PE3A 5JJIA 2RK4A 3AY6A 1UBKS 2QYHA 1FQJA 4N5HX 4ZVQA 3BFVA 3TEMA 3SN6A 1U7WA 4EKGA 3EIHA 4B0PA 1T0HB 4RTKA 3LFHA 4L27A 3VTAA 2VDUE 1XZKA 2GZRA 4UDXX 3HBLA 4XPIA 4KIUA 5GONF 3ZWYA 1A5SB 1NMXA 3KOXA 5CDFE 3ELYA 1QRRA 4WL0A 1O94D 4ID9A 4EA8A 4F6RB 4JUBA 2XRZA 2CDNA 4AF8A 1XL0A 2QTFA 1ILWA 2XMSA 3U26A 3AEKA 1EGQA 4JQZA 3U19A 3ZJTA 4E09A 2V6MA 5B7QA 1QAQA 1USVA 2LTAA 2JIZD 3UEOA 4DV0B 1OB2A 3E03A 4YAFA 4CNQA 4UM9B 3NZEA 1RLJA 1JFVA 4BYMA 2EJCA 3G2JA 3EXEA 4TTPA 4N48A 4FC7A 3ONNA 3KVVA 3ELBA 4ALKA 1UJ5A 1NAHA 2D7JA 1AKUA 4IMRA 5DBIA 3RO7A 3SQXA 2JBAA 1VBFA 2C95A 4HLNA 2Q99A 4K28A 1N5RA 2Z8YM 1QV6A 3BG5A 4MS1A 1GPH1 4TN1A 4UUQA 5FOVA