4EJYA

Structure of mbogg1 in complex with high affinity dna ligand
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
289
structure length
289
Chain Sequence
MKYNVEEKGTKVIVRGIADFNLKETFESGQCFRWNEEEDGSYTGVAYDRVVNVKLEGDTLIIDNTNLTDFYDIWFDYFDLGRDYGQIKESLSKDPVLKEAIKFGQGIRILRQDTWETLVSFIVSQNNRIPQIKKVIENLATSFGNPIEYKGKIYYTFPKPEELVMYDVETIAKTRCGFRAKYIFDAASKVFSGEINLLKLHEYSTSEIRDILMTINGVGPKVADCVILYSIGRYDTFPTDVWIKRIVEHLYLKREGTPVEIQLFAIDKFGDLSGFAQQYLFYYGREMGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of MBOgg1 in complex with two abasic DNA ligands
pubmed doi rcsb
molecule keywords 3-Methyladenine DNA glycosylase
molecule tags Hydrolase/dna
source organism Thermoanaerobacter tengcongensis
total genus 104
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.2.2.-:
pdb deposition date 2012-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4ejyA02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4ejyA03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4ejyA01
1MPGA 3I0XA 3KTUA 2NOIA 4B22A 1RRSA 1RRQA 2NOFA 3CW7A 3CWAA 4EA5A 2NOBA 5KN8A 1N3AA 1MUDA 4EA4A 4B23A 2YG9A 4E9GA 1VRLA 4EJZA 3OH6A 1KG4A 1PU7A 4EW0A 1XQOA 2NOLA 5DPKA 3OH9A 1KEAA 4AI4A 3CWUA 2XHIA 4B24A 4EJYA 4EW4A 2OFIA 3I0WA 1PU6A 1HU0A 4UOBA 5KN9A 1YQMA 2H56A 4E9HA 3CWSA 1XQPA 4YOQA 1ORNA 1LWWA 3F10A 4EVVA 1DIZA 4E9EA 3F0ZA 4YPHA 4UNFA 1LWVA 4OFAA 3G0QA 4PIIA 2OFKA 4OFHA 4B21A 1ORPA 1P59A 3CVTA 2NOZA 2JG6A 1M3QA 1KG3A 4OFEA 1EBMA 1KG5A 1M3HA 1WEFA 3KNTA 1YQKA 3IHOA 1MUNA 1PVSA 3FHFA 1YQLA 5AN4A 1MUYA 3FHGA 1YQRA 3CWTA 1NKUA 1XG7A 1PU8A 1P7MA 4E9FA 4AI5A 4AIAA 1N3CA 1N39A 2ABKA 3FSPA 1NGNA 3N5NX 4DK9A 1KG7A 3OGDA 1KQJA 2I5WA 1WEIA 2NOEA 1KG2A 3D4VA 2NOHA 1KG6A 1LMZA 2JHNA 1WEGA 3N0UA 4HSBA 5CHZA 2YG8A 4YPRA 1FN7A 3CVSA 1LWYA 2JHJA 3IH7A 3S6IA 1KO9A
chains in the Genus database with same CATH superfamily
3OS0A 3OSEA 3KTUA 2V9JA 3L2WA 1D3UA 4QG5A 3CWAA 5KN8A 3RPJA 4B23A 2YG9A 1E42A 4EJZA 2IV8A 3OH6A 1XQOA 1KYUA 5DPKA 2MZ8A 3OYFA 1M5Q1 4HJHA 3NNQA 2IV9A 5JMVD 3OYJA 3D7QA 2QREA 4EJYA 3LCNA 2QRCA 2OFIA 3I0WA 1YQMA 2H56A 3CWSA 4YOQA 5JN5A 3S3NA 4ROEB 3F0ZA 4YPHA 1QNCA 2G30A 2OFKA 3CVTA 2NVMA 2LAEA 1M3QA 1KG3A 1EBMA 1M3HA 2FKFA 3NA5A 4WZSD 4BE1A 1CDWA 1MUNA 1YQLA 2HZSA 3ENOC 3TE5A 2D0BA 1WJWA 1PCJX 4TPSA 1XG7A 4RODB 5EPCA 4AI5A 3KRMA 3OCIA 2R5XA 3FSPA 5FRMA 2NOEA 4E7LA 1KG6A 1LMZA 4EAKA 4IKFA 1JFIC 1YTBA 3C04A 2NWVA 1PZDA 2QLVA 1LWYA 2HL9A 3T4NA 3IH7A 3S6IA 2V92A 1KO9A 1MPGA 3OSMA 2YA3A 4B22A 2O3OA 1RRSA 4BACA 2Y8QA 4WXAA 5IYCP 3VN5A 4ROCB 1K2YX 4EA5A 2NOBA 1KYDA 4EA4A 1QNEA 1P5GX 3OYLA 2ZFDB 2D0AA 1KG4A 4PY5A 3DPTA 2NOLA 1QN7A 1KY6A 3OH9A 4AI4A 2DKDA 2QR1A 4D7QA 2W03A 3N89A 1EUVA 1J3MA 3S3MA 2D0CA 1V5SA 4B24A 1KYFA 3L2RA 4EW4A 2Z0FA 1PU6A 3OC3C 4UOBA 1NH2A 5IYDP 1ORNA 1LWWA 3F10A 4EVVA 3EIKA 1NVPA 4E9EA 4E7HA 3S3OA 4OFHA 2JG6A 2H5AX 3R2XC 4EAGA 1KG5A 1YQKA 1XSZA 3IHOA 4BJUA 2H4LX 5BMPA 2VJ0A 5F9CA 2PWWA 5AN4A 1QNBA 3FHGA 2YH5A 4ZTJA 1QN8A 1KFIA 1T6AA 1PU8A 1C4GA 1YTFA 4AIAA 1N39A 4DULA 1NGNA 1KG7A 1QN9A 1KQJA 4Q11A 1C47A 3D4VA 3ASMA 1QTPA 1Q9UA 5CHZA 1KY7A 2YG8A 3H1ZA 3PMGA 4YPRA 5BMNA 5FROA 1B9KA 3I0XA 4CFFA 4E7KA 3L2QA 2NOIA 2JPSA 1RRQA 1WQAA 2Y8LA 1MUDA 4EAJA 2EHBD 1VRLA 3OYKA 3L2VA 1U84A 4EW0A 1JDYA 4I8OA 1KEAA 3OYHA 5KL0A 3CWUA 4NZGA 2XHIA 3TDHA 1AISA 3DPUA 4WX8A 1HU0A 5KN9A 1XQPA 1QN3A 1DIZA 2HKPA 4UNFA 1P59A 1ORPA 1QN6A 1QN4A 4BE2A 1PCZA 4OFEA 3ENCA 1KFQA 2FUVA 2OOYA 3OSTA 1TBAB 4BDZA 1YQRA 3PDKA 4EAIA 1VKLA 1VTLE 1UL7A 1C9BB 4E9FA 1MP9A 1N3CA 1PCMX 4IL8A 2DKAA 2ABKA 4DK9A 3OGDA 2I5WA 1WEIA 2NOHA 1R4XA 1VTOA 4EALA 5FRNA 3VW4A 1UT7A 3OYNA 1FN7A 2W04A 2JHJA 3OYGA 1K35A 2JOIA 1TBPA 1TUOA 2NOFA 3CW7A 2QRDA 3EAYA 1N3AA 3OYDA 2HZMA 4E9GA 2OOXA 3ULXA 2V75A 1PU7A 3OYAA 4C7PA 5HSHA 3SNSA 3L2UA 1TGHA 1NGMA 2V8QA 3OS2A 2FGTA 4BDYA 2MJ7A 1QNAA 3UW2A 1P5DX 4E7JA 3OYMA 1VOLB 4E9HA 2FKMX 1QN5A 1W80A 1LWVA 4OFAA 4E7IA 2NOZA 3G0QA 4PIIA 3OYCA 4B21A 1QTSA 2DKCA 3OLPA 1VOKA 2F7LA 1WEFA 3KNTA 3OYBA 4ZTFA 2NLVA 3HS9A 1PVSA 3OY9A 3FHFA 4MRQA 3BKQX 2HL8A 2Z8UA 1MUYA 3I3WA 3CWTA 5IYBP 1NKUA 3OYEA 1RM1A 1P7MA 4D7RA 3OYIA 1LXTA 3N5NX 2JPIA 1KG2A 2JHNA 1WEGA 3N0UA 3RSMA 4HSBA 1UT4A 3HS8A 3CVSA 4B0AA 3OS1A 4BE0A
chains in the Genus database with same CATH topology
1MPGA 3I0XA 3OSMA 2JOIA 3KTUA 2NOIA 1TBPA 4B22A 2O3OA 1RRSA 1RRQA 5IYCP 1D3UA 3VN5A 2NOFA 4ROCB 3CW7A 3CWAA 4EA5A 2NOBA 5KN8A 1N3AA 3RPJA 1MUDA 1KYDA 4EA4A 4B23A 2YG9A 2HZMA 1E42A 1QNEA 4E9GA 1VRLA 4EJZA 3ULXA 2IV8A 3OH6A 2D0AA 1KG4A 1PU7A 4EW0A 4PY5A 3DPTA 4I8OA 1XQOA 1KYUA 2NOLA 1QN7A 5DPKA 2MZ8A 1KY6A 3OH9A 1KEAA 4AI4A 3SNSA 1TGHA 1NGMA 3N89A 3CWUA 2IV9A 2FGTA 2MJ7A 1QNAA 2XHIA 2D0CA 1AISA 2G30A 4B24A 3DPUA 4EJYA 1KYFA 4EW4A 2OFIA 3I0WA 1PU6A 1VOLB 1HU0A 3OC3C 4UOBA 5KN9A 1YQMA 2H56A 4E9HA 3CWSA 1NH2A 1XQPA 5IYDP 1QN3A 4YOQA 1ORNA 1LWWA 1QN5A 3F10A 4EVVA 1W80A 1DIZA 3EIKA 4ROEB 1NVPA 4E9EA 3F0ZA 4YPHA 4UNFA 1QNCA 1LWVA 4OFAA 3G0QA 4PIIA 2OFKA 4OFHA 4B21A 1ORPA 1P59A 3CVTA 2NOZA 1QTSA 2JG6A 2LAEA 1QN6A 1QN4A 1M3QA 1PCZA 1KG3A 4OFEA 1EBMA 1KG5A 1M3HA 1VOKA 1WEFA 3KNTA 1YQKA 3IHOA 4WZSD 1CDWA 1MUNA 1PVSA 3HS9A 3FHFA 1YQLA 3OSTA 1TBAB 2VJ0A 2HZSA 5AN4A 1QNBA 2Z8UA 2D0BA 1MUYA 3FHGA 1YQRA 3CWTA 2YH5A 5IYBP 1NKUA 1QN8A 4TPSA 1XG7A 1VTLE 4RODB 1C9BB 1PU8A 1RM1A 1P7MA 4E9FA 1MP9A 4AI5A 4AIAA 1N3CA 1N39A 1YTFA 3KRMA 3OCIA 2ABKA 4DULA 3FSPA 1NGNA 3N5NX 4DK9A 1KG7A 1QN9A 3OGDA 1KQJA 2I5WA 4Q11A 1WEIA 2NOEA 1KG2A 3D4VA 2NOHA 1R4XA 3ASMA 1VTOA 1KG6A 1LMZA 2JHNA 1WEGA 3N0UA 1JFIC 1YTBA 1QTPA 4HSBA 1UT4A 5CHZA 1KY7A 2YG8A 3H1ZA 3HS8A 1UT7A 4YPRA 1PZDA 1FN7A 3CVSA 4B0AA 1LWYA 2JHJA 3IH7A 1B9KA 3S6IA 1KO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MPG A;  3I0X A;  3KTU A;  2NOI A;  4B22 A;  1RRS A;  1RRQ A;  2NOF A;  3CW7 A;  3CWA A;  4EA5 A;  2NOB A;  5KN8 A;  1N3A A;  1MUD A;  4EA4 A;  4B23 A;  2YG9 A;  4E9G A;  1VRL A;  4EJZ A;  3OH6 A;  1KG4 A;  1PU7 A;  4EW0 A;  1XQO A;  2NOL A;  5DPK A;  3OH9 A;  1KEA A;  4AI4 A;  3CWU A;  2XHI A;  4B24 A;  4EJY A;  4EW4 A;  2OFI A;  3I0W A;  1PU6 A;  1HU0 A;  4UOB A;  5KN9 A;  1YQM A;  2H56 A;  4E9H A;  3CWS A;  1XQP A;  4YOQ A;  1ORN A;  1LWW A;  3F10 A;  4EVV A;  1DIZ A;  4E9E A;  3F0Z A;  4YPH A;  4UNF A;  1LWV A;  4OFA A;  3G0Q A;  4PII A;  2OFK A;  4OFH A;  4B21 A;  1ORP A;  1P59 A;  3CVT A;  2NOZ A;  2JG6 A;  1M3Q A;  1KG3 A;  4OFE A;  1EBM A;  1KG5 A;  1M3H A;  1WEF A;  3KNT A;  1YQK A;  3IHO A;  1MUN A;  1PVS A;  3FHF A;  1YQL A;  5AN4 A;  1MUY A;  3FHG A;  1YQR A;  3CWT A;  1NKU A;  1XG7 A;  1PU8 A;  1P7M A;  4E9F A;  4AI5 A;  4AIA A;  1N3C A;  1N39 A;  2ABK A;  3FSP A;  1NGN A;  3N5N X;  4DK9 A;  1KG7 A;  3OGD A;  1KQJ A;  2I5W A;  1WEI A;  2NOE A;  1KG2 A;  3D4V A;  2NOH A;  1KG6 A;  1LMZ A;  2JHN A;  1WEG A;  3N0U A;  4HSB A;  5CHZ A;  2YG8 A;  4YPR A;  1FN7 A;  3CVS A;  1LWY A;  2JHJ A;  3IH7 A;  3S6I A;  1KO9 A; 
#chains in the Genus database with same CATH topology
 3OS0 A;  3OSE A;  3KTU A;  2V9J A;  3L2W A;  1D3U A;  4QG5 A;  3CWA A;  5KN8 A;  3RPJ A;  4B23 A;  2YG9 A;  1E42 A;  4EJZ A;  2IV8 A;  3OH6 A;  1XQO A;  1KYU A;  5DPK A;  2MZ8 A;  3OYF A;  1M5Q 1;  4HJH A;  3NNQ A;  2IV9 A;  5JMV D;  3OYJ A;  3D7Q A;  2QRE A;  4EJY A;  3LCN A;  2QRC A;  2OFI A;  3I0W A;  1YQM A;  2H56 A;  3CWS A;  4YOQ A;  5JN5 A;  3S3N A;  4ROE B;  3F0Z A;  4YPH A;  1QNC A;  2G30 A;  2OFK A;  3CVT A;  2NVM A;  2LAE A;  1M3Q A;  1KG3 A;  1EBM A;  1M3H A;  2FKF A;  3NA5 A;  4WZS D;  4BE1 A;  1CDW A;  1MUN A;  1YQL A;  2HZS A;  3ENO C;  3TE5 A;  2D0B A;  1WJW A;  1PCJ X;  4TPS A;  1XG7 A;  4ROD B;  5EPC A;  4AI5 A;  3KRM A;  3OCI A;  2R5X A;  3FSP A;  5FRM A;  2NOE A;  4E7L A;  1KG6 A;  1LMZ A;  4EAK A;  4IKF A;  1JFI C;  1YTB A;  3C04 A;  2NWV A;  1PZD A;  2QLV A;  1LWY A;  2HL9 A;  3T4N A;  3IH7 A;  3S6I A;  2V92 A;  1KO9 A;  1MPG A;  3OSM A;  2YA3 A;  4B22 A;  2O3O A;  1RRS A;  4BAC A;  2Y8Q A;  4WXA A;  5IYC P;  3VN5 A;  4ROC B;  1K2Y X;  4EA5 A;  2NOB A;  1KYD A;  4EA4 A;  1QNE A;  1P5G X;  3OYL A;  2ZFD B;  2D0A A;  1KG4 A;  4PY5 A;  3DPT A;  2NOL A;  1QN7 A;  1KY6 A;  3OH9 A;  4AI4 A;  2DKD A;  2QR1 A;  4D7Q A;  2W03 A;  3N89 A;  1EUV A;  1J3M A;  3S3M A;  2D0C A;  1V5S A;  4B24 A;  1KYF A;  3L2R A;  4EW4 A;  2Z0F A;  1PU6 A;  3OC3 C;  4UOB A;  1NH2 A;  5IYD P;  1ORN A;  1LWW A;  3F10 A;  4EVV A;  3EIK A;  1NVP A;  4E9E A;  4E7H A;  3S3O A;  4OFH A;  2JG6 A;  2H5A X;  3R2X C;  4EAG A;  1KG5 A;  1YQK A;  1XSZ A;  3IHO A;  4BJU A;  2H4L X;  5BMP A;  2VJ0 A;  5F9C A;  2PWW A;  5AN4 A;  1QNB A;  3FHG A;  2YH5 A;  4ZTJ A;  1QN8 A;  1KFI A;  1T6A A;  1PU8 A;  1C4G A;  1YTF A;  4AIA A;  1N39 A;  4DUL A;  1NGN A;  1KG7 A;  1QN9 A;  1KQJ A;  4Q11 A;  1C47 A;  3D4V A;  3ASM A;  1QTP A;  1Q9U A;  5CHZ A;  1KY7 A;  2YG8 A;  3H1Z A;  3PMG A;  4YPR A;  5BMN A;  5FRO A;  1B9K A;  3I0X A;  4CFF A;  4E7K A;  3L2Q A;  2NOI A;  2JPS A;  1RRQ A;  1WQA A;  2Y8L A;  1MUD A;  4EAJ A;  2EHB D;  1VRL A;  3OYK A;  3L2V A;  1U84 A;  4EW0 A;  1JDY A;  4I8O A;  1KEA A;  3OYH A;  5KL0 A;  3CWU A;  4NZG A;  2XHI A;  3TDH A;  1AIS A;  3DPU A;  4WX8 A;  1HU0 A;  5KN9 A;  1XQP A;  1QN3 A;  1DIZ A;  2HKP A;  4UNF A;  1P59 A;  1ORP A;  1QN6 A;  1QN4 A;  4BE2 A;  1PCZ A;  4OFE A;  3ENC A;  1KFQ A;  2FUV A;  2OOY A;  3OST A;  1TBA B;  4BDZ A;  1YQR A;  3PDK A;  4EAI A;  1VKL A;  1VTL E;  1UL7 A;  1C9B B;  4E9F A;  1MP9 A;  1N3C A;  1PCM X;  4IL8 A;  2DKA A;  2ABK A;  4DK9 A;  3OGD A;  2I5W A;  1WEI A;  2NOH A;  1R4X A;  1VTO A;  4EAL A;  5FRN A;  3VW4 A;  1UT7 A;  3OYN A;  1FN7 A;  2W04 A;  2JHJ A;  3OYG A;  1K35 A;  2JOI A;  1TBP A;  1TUO A;  2NOF A;  3CW7 A;  2QRD A;  3EAY A;  1N3A A;  3OYD A;  2HZM A;  4E9G A;  2OOX A;  3ULX A;  2V75 A;  1PU7 A;  3OYA A;  4C7P A;  5HSH A;  3SNS A;  3L2U A;  1TGH A;  1NGM A;  2V8Q A;  3OS2 A;  2FGT A;  4BDY A;  2MJ7 A;  1QNA A;  3UW2 A;  1P5D X;  4E7J A;  3OYM A;  1VOL B;  4E9H A;  2FKM X;  1QN5 A;  1W80 A;  1LWV A;  4OFA A;  4E7I A;  2NOZ A;  3G0Q A;  4PII A;  3OYC A;  4B21 A;  1QTS A;  2DKC A;  3OLP A;  1VOK A;  2F7L A;  1WEF A;  3KNT A;  3OYB A;  4ZTF A;  2NLV A;  3HS9 A;  1PVS A;  3OY9 A;  3FHF A;  4MRQ A;  3BKQ X;  2HL8 A;  2Z8U A;  1MUY A;  3I3W A;  3CWT A;  5IYB P;  1NKU A;  3OYE A;  1RM1 A;  1P7M A;  4D7R A;  3OYI A;  1LXT A;  3N5N X;  2JPI A;  1KG2 A;  2JHN A;  1WEG A;  3N0U A;  3RSM A;  4HSB A;  1UT4 A;  3HS8 A;  3CVS A;  4B0A A;  3OS1 A;  4BE0 A; 
#chains in the Genus database with same CATH homology
 1MPG A;  3I0X A;  3OSM A;  2JOI A;  3KTU A;  2NOI A;  1TBP A;  4B22 A;  2O3O A;  1RRS A;  1RRQ A;  5IYC P;  1D3U A;  3VN5 A;  2NOF A;  4ROC B;  3CW7 A;  3CWA A;  4EA5 A;  2NOB A;  5KN8 A;  1N3A A;  3RPJ A;  1MUD A;  1KYD A;  4EA4 A;  4B23 A;  2YG9 A;  2HZM A;  1E42 A;  1QNE A;  4E9G A;  1VRL A;  4EJZ A;  3ULX A;  2IV8 A;  3OH6 A;  2D0A A;  1KG4 A;  1PU7 A;  4EW0 A;  4PY5 A;  3DPT A;  4I8O A;  1XQO A;  1KYU A;  2NOL A;  1QN7 A;  5DPK A;  2MZ8 A;  1KY6 A;  3OH9 A;  1KEA A;  4AI4 A;  3SNS A;  1TGH A;  1NGM A;  3N89 A;  3CWU A;  2IV9 A;  2FGT A;  2MJ7 A;  1QNA A;  2XHI A;  2D0C A;  1AIS A;  2G30 A;  4B24 A;  3DPU A;  4EJY A;  1KYF A;  4EW4 A;  2OFI A;  3I0W A;  1PU6 A;  1VOL B;  1HU0 A;  3OC3 C;  4UOB A;  5KN9 A;  1YQM A;  2H56 A;  4E9H A;  3CWS A;  1NH2 A;  1XQP A;  5IYD P;  1QN3 A;  4YOQ A;  1ORN A;  1LWW A;  1QN5 A;  3F10 A;  4EVV A;  1W80 A;  1DIZ A;  3EIK A;  4ROE B;  1NVP A;  4E9E A;  3F0Z A;  4YPH A;  4UNF A;  1QNC A;  1LWV A;  4OFA A;  3G0Q A;  4PII A;  2OFK A;  4OFH A;  4B21 A;  1ORP A;  1P59 A;  3CVT A;  2NOZ A;  1QTS A;  2JG6 A;  2LAE A;  1QN6 A;  1QN4 A;  1M3Q A;  1PCZ A;  1KG3 A;  4OFE A;  1EBM A;  1KG5 A;  1M3H A;  1VOK A;  1WEF A;  3KNT A;  1YQK A;  3IHO A;  4WZS D;  1CDW A;  1MUN A;  1PVS A;  3HS9 A;  3FHF A;  1YQL A;  3OST A;  1TBA B;  2VJ0 A;  2HZS A;  5AN4 A;  1QNB A;  2Z8U A;  2D0B A;  1MUY A;  3FHG A;  1YQR A;  3CWT A;  2YH5 A;  5IYB P;  1NKU A;  1QN8 A;  4TPS A;  1XG7 A;  1VTL E;  4ROD B;  1C9B B;  1PU8 A;  1RM1 A;  1P7M A;  4E9F A;  1MP9 A;  4AI5 A;  4AIA A;  1N3C A;  1N39 A;  1YTF A;  3KRM A;  3OCI A;  2ABK A;  4DUL A;  3FSP A;  1NGN A;  3N5N X;  4DK9 A;  1KG7 A;  1QN9 A;  3OGD A;  1KQJ A;  2I5W A;  4Q11 A;  1WEI A;  2NOE A;  1KG2 A;  3D4V A;  2NOH A;  1R4X A;  3ASM A;  1VTO A;  1KG6 A;  1LMZ A;  2JHN A;  1WEG A;  3N0U A;  1JFI C;  1YTB A;  1QTP A;  4HSB A;  1UT4 A;  5CHZ A;  1KY7 A;  2YG8 A;  3H1Z A;  3HS8 A;  1UT7 A;  4YPR A;  1PZD A;  1FN7 A;  3CVS A;  4B0A A;  1LWY A;  2JHJ A;  3IH7 A;  1B9K A;  3S6I A;  1KO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...