4ELEA

Structure-activity relationship guides enantiomeric preference among potent inhibitors of b. anthracis dihydrofolate reductase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
166
structure length
166
Chain Sequence
MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-activity relationship for enantiomers of potent inhibitors of B. anthracis dihydrofolate reductase.
pubmed doi rcsb
molecule keywords Dihydrofolate reductase
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Bacillus anthracis
total genus 44
structure length 166
sequence length 166
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2012-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 4eleA00
5HPBA 1RX4A 1DG5A 1RC4A 4P3QA 4KFJA 4ELHA 3F91A 1TDRA 4IXGX 4DDRA 5HF2X 3F8YA 1SEJA 3DAUA 3FQVA 4Q67A 4X5IA 4KNEA 3NXVA 4KJKA 4I1NA 3SR5X 3NXXA 5HSUA 3TD8A 1RA8A 1RA9A 4NX6A 1HFQA 1IA4A 3NXOA 2QK8A 4KAKA 3JSUA 4XT6A 1RX1A 3FRDX 1JOMA 4EIGA 3SQYX 3F0QX 4XT4A 3EEKA 2W9SA 2FZJA 3NXTA 1DDRA 3S3VA 1DREA 3NRRA 3VCOA 1DYHA 4IXED 4KD7A 1DLRA 4ELFA 3UM8A 2ITHA 4LAGX 2LF1A 1BOZA 1LY4A 3S7AA 4XT7A 4LEKX 1DR4A 3NU0A 5HT4A 1DDSA 1YHOA 4G95A 3S9UA 4P3RA 3JTWA 4RGCA 3KY8A 4Q6AA 3DFRA 2HM9A 4Q0DA 3K2HA 3FS6A 4M6KA 3IA5A 4ELBA 5HSRA 1DHJA 4HOGA 2JYBA 3EELA 4KM0A 3KFYA 3IX9A 4M6JA 2B3ZA 3GI2A 1DLSA 4GH8A 3R33A 3KGYA 3JW5A 3FQ0A 3FQOA 1DYJA 3KJSA 1U72A 3TQAA 3FRBX 1AI9A 4PSSA 4ELGA 3QYOA 4PSYA 5CC9A 1VDRA 3ZPGA 4H97A 4X5GA 3F0SX 1MVTA 1J3KA 4QJZD 2D5NA 4OR7A 1RB2A 2W9GA 1DYIA 1RB3A 3DGAA 4ELEA 3UM5A 3D84X 3FY9X 4KY4A 1DYRA 1AOEA 3EEJA 3DL6A 3UM6A 3N0HA 1IA1A 3NZ9X 3FREX 3QLSA 3E0BA 2CIGA 4H95A 1RX7A 1AO8A 2L28A 3JWMA 4M2XA 2W3MA 3FQCA 3TQ9A 5HUIA 1S3WA 1M79A 5E8QA 3JWCA 3QLXA 2FZHA 4IXFX 3TQ8A 1JOLA 3HBBA 3DL5A 1RE7A 3FQZA 4Q0EA 1RX5A 2DHFA 4KL9A 4XECX 1PDBA 3CD2A 3DRCA 3GHCA 3JWKA 2ANOA 1RX8A 1HFPA 2W3VA 3SRRX 4XE6X 5U27A 2BLBA 3FYVX 1KMSA 4PSTA 1S3VA 5HVBA 3SRSX 1RX6A 3LG4A 2HXVA 1DR1A 1E26A 4KEBA 3SRQX 3QGTA 1OHJA 3NZCX 2BLCA 5JG0X 3QL0A 3F0VX 4FHBA 1DF7A 4TU5X 3QLYA 1JUVA 1DG8A 1RH3A 4KY8A 4EILA 5JA3A 3QLWA 3JW3A 1PD9A 4LAHX 4LAEX 1RF7A 5HI6A 7DFRA 4DPHA 3K74A 4QLGA 4DFRA 1DR5A 3TQBA 2O7PA 3QFXA 1ZDRA 3FL8A 1LUDA 3IA4A 3SA1A 4PTHA 3ZPCA 1M78A 3SRUX 4XT5A 1J3JA 2D0KA 4DPDA 3IRNA 4EIZA 3CSEA 3SA2A 1DRAA 3JVXA 3M08A 3QLRA 3CL9A 4KJJA 5CCCA 5HQZA 2AZNA 3NZAX 3GYFA 4M7VA 3FY8X 3RG9A 1IA3A 1BZFA 2W9TA 1CZ3A 3FYWX 3QL3A 3L3RA 3OAFA 1U71A 1DRHA 1MVSA 2OBCA 3CLBA 4H98A 5HQYA 3HJ3A 5ECCA 4CD2A 3I3RA 3ROAA 1J3IA 1D1GA 3QLZA 2W3WA 2FZIA 3FRFX 3DATA 5DXVA 1PD8A 8DFRA 2CD2A 2ANQA 4EJ1A 1DISA 1RX2A 1RX9A 3D80A 1DR2A 4H96A 5FDAA 2KGKA 4FGGA 3OCHA 3NZBX 1HFRA 2G6VA 5ECXA 4X5JA 4P68A 3F0UX 3F0XX 4XT8A 2W3BA 1DR3A 4DP3A 3IRMA 2W9HA 4OSGA 3EX8A 4M6LA 4KM2A 4X5FA 1KMVA 2INQA 4QI9A 4QLEA 5HF0X 3F0BX 3QG2A 1RX3A 4HOEA 2BLAA 3NXYA 3SH2A 3GHWA 1CD2A 1RD7A 3NZ6X 2W3AA 4I13A 3I8AX 3GHVA 5EAJA 1RA3A 1IA2A 4PDJA 2HQPA 3QYLA 3SGYA 1S3UA 1DIUA 3DG8A 6DFRA 3FQFA 3K47A 2XW7A 2P4GA 3INVA 3SRWX 3NTZA 4KLXA 4P66A 1DHFA 2C2TA 2C2SA 5DFRA 4X5HA 4KBNA 3EEMA 2H2QA 4M7UA 5U26A 5HT5A 4QHVA 3K45A 5HVEA 4KYAA 1DRBA 3Q1HA 4G3MA 4HA9A 1DR7A 2BL9A 4NX7A 1KLKA 1RG7A 3F8ZA 4KJLA 4ECKA 1S3YA 1DR6A 2OIPA 1U70A 3JWFA 4G8ZX 4PTJA 1VJ3A 4QJCA 1LY3A 4HOFA 3KJRA 3NXRA 1DG7A 1DAJA 1M7AA 2ZZAA 3FRAX 3NZDA 1DRFA 1QZFA 3EIGA 4XRBA 4QLFA 3FL9A 3M09A 1OHKA 4HA7A 3RO9A 2DRCA 4FGHA 1RA2A 2GD9A 1DHIA 1RA1A 3SAIA 3IROA
chains in the Genus database with same CATH superfamily
5HPBA 1RX4A 1DG5A 1RC4A 4P3QA 4KFJA 4ELHA 3F91A 1TDRA 4IXGX 4DDRA 5HF2X 3F8YA 1SEJA 3DAUA 3FQVA 4Q67A 4X5IA 4KNEA 3NXVA 4KJKA 4I1NA 3SR5X 3NXXA 5HSUA 3TD8A 1RA8A 1RA9A 4NX6A 1HFQA 1IA4A 3NXOA 2QK8A 4KAKA 3JSUA 4XT6A 1RX1A 3FRDX 1JOMA 4EIGA 3SQYX 3F0QX 4XT4A 3EEKA 2W9SA 2FZJA 3NXTA 1DDRA 3S3VA 1DREA 3NRRA 3VCOA 1DYHA 4IXED 4KD7A 1DLRA 4ELFA 3UM8A 2ITHA 4LAGX 2LF1A 1BOZA 1LY4A 3S7AA 4XT7A 4LEKX 1DR4A 3NU0A 5HT4A 1DDSA 1YHOA 4G95A 3S9UA 4P3RA 3JTWA 4RGCA 3KY8A 4Q6AA 3DFRA 2HM9A 4Q0DA 3K2HA 3FS6A 4M6KA 3IA5A 4ELBA 5HSRA 1DHJA 4HOGA 2JYBA 3EELA 4KM0A 3KFYA 3IX9A 4M6JA 2B3ZA 3GI2A 1DLSA 4GH8A 3R33A 3KGYA 3JW5A 3FQ0A 3FQOA 1DYJA 3KJSA 1U72A 3TQAA 3FRBX 1AI9A 4PSSA 4ELGA 3QYOA 4PSYA 5CC9A 1VDRA 3ZPGA 4H97A 4X5GA 3F0SX 1MVTA 1J3KA 4QJZD 2D5NA 4OR7A 1RB2A 2W9GA 1DYIA 1RB3A 3DGAA 4ELEA 3UM5A 3D84X 3FY9X 4KY4A 1DYRA 1AOEA 3EEJA 3DL6A 3UM6A 3N0HA 1IA1A 3NZ9X 3FREX 3QLSA 3E0BA 2CIGA 4H95A 1RX7A 1AO8A 2L28A 3JWMA 4M2XA 2W3MA 3FQCA 3TQ9A 5HUIA 1S3WA 1M79A 5E8QA 3JWCA 3QLXA 2FZHA 4IXFX 3TQ8A 1JOLA 3HBBA 3DL5A 1RE7A 3FQZA 4Q0EA 1RX5A 2DHFA 4KL9A 4XECX 1PDBA 3CD2A 3DRCA 3GHCA 3JWKA 2ANOA 1RX8A 1HFPA 2W3VA 3SRRX 4XE6X 5U27A 2BLBA 3FYVX 1KMSA 4PSTA 1S3VA 5HVBA 3SRSX 1RX6A 3LG4A 2HXVA 1DR1A 1E26A 4KEBA 3SRQX 3QGTA 1OHJA 3NZCX 2BLCA 5JG0X 3QL0A 3F0VX 4FHBA 1DF7A 4TU5X 3QLYA 1JUVA 1DG8A 1RH3A 4KY8A 4EILA 5JA3A 3QLWA 3JW3A 1PD9A 4LAHX 4LAEX 1RF7A 5HI6A 7DFRA 4DPHA 3K74A 4QLGA 4DFRA 1DR5A 3TQBA 2O7PA 3QFXA 1ZDRA 3FL8A 1LUDA 3IA4A 3SA1A 4PTHA 3ZPCA 1M78A 3SRUX 4XT5A 1J3JA 2D0KA 4DPDA 3IRNA 4EIZA 3CSEA 3SA2A 1DRAA 3JVXA 3M08A 3QLRA 3CL9A 4KJJA 5CCCA 5HQZA 2AZNA 3NZAX 3GYFA 4M7VA 3FY8X 3RG9A 1IA3A 1BZFA 2W9TA 1CZ3A 3FYWX 3QL3A 3L3RA 3OAFA 1U71A 1DRHA 1MVSA 2OBCA 3CLBA 4H98A 5HQYA 3HJ3A 5ECCA 4CD2A 3I3RA 3ROAA 1J3IA 1D1GA 3QLZA 2W3WA 2FZIA 3FRFX 3DATA 5DXVA 1PD8A 8DFRA 2CD2A 2ANQA 4EJ1A 1DISA 1RX2A 1RX9A 3D80A 1DR2A 4H96A 5FDAA 2KGKA 4FGGA 3OCHA 3NZBX 1HFRA 2G6VA 5ECXA 4X5JA 4P68A 3F0UX 3F0XX 4XT8A 2W3BA 1DR3A 4DP3A 3IRMA 2W9HA 4OSGA 3EX8A 4M6LA 4KM2A 4X5FA 1KMVA 2INQA 4QI9A 4QLEA 5HF0X 3F0BX 3QG2A 1RX3A 4HOEA 2BLAA 3NXYA 3SH2A 3GHWA 1CD2A 1RD7A 3NZ6X 2W3AA 4I13A 3I8AX 3GHVA 5EAJA 1RA3A 1IA2A 4PDJA 2HQPA 3QYLA 3SGYA 1S3UA 1DIUA 3DG8A 6DFRA 3FQFA 3K47A 2XW7A 2P4GA 3INVA 3SRWX 3NTZA 4KLXA 4P66A 1DHFA 2C2TA 2C2SA 5DFRA 4X5HA 4KBNA 3EEMA 2H2QA 4M7UA 5U26A 5HT5A 4QHVA 3K45A 5HVEA 4KYAA 1DRBA 3Q1HA 4G3MA 4HA9A 1DR7A 2BL9A 4NX7A 1KLKA 1RG7A 3F8ZA 4KJLA 4ECKA 1S3YA 1DR6A 2OIPA 1U70A 3JWFA 4G8ZX 4PTJA 1VJ3A 4QJCA 1LY3A 4HOFA 3KJRA 3NXRA 1DG7A 1DAJA 1M7AA 2ZZAA 3FRAX 3NZDA 1DRFA 1QZFA 3EIGA 4XRBA 4QLFA 3FL9A 3M09A 1OHKA 4HA7A 3RO9A 2DRCA 4FGHA 1RA2A 2GD9A 1DHIA 1RA1A 3SAIA 3IROA
chains in the Genus database with same CATH topology
5HPBA 1RX4A 1DG5A 1RC4A 4P3QA 4KFJA 4ELHA 3F91A 1TDRA 4IXGX 4DDRA 5HF2X 3F8YA 1SEJA 3DAUA 3FQVA 4Q67A 4X5IA 4KNEA 3NXVA 4KJKA 4I1NA 3SR5X 3NXXA 5HSUA 3TD8A 1RA8A 1RA9A 4NX6A 1HFQA 1IA4A 3NXOA 2QK8A 4KAKA 3JSUA 4XT6A 1RX1A 3FRDX 1JOMA 4EIGA 3SQYX 3F0QX 4XT4A 3EEKA 2W9SA 2FZJA 3NXTA 1DDRA 3S3VA 1DREA 3NRRA 3VCOA 1DYHA 4IXED 4KD7A 1DLRA 4ELFA 3UM8A 2ITHA 4LAGX 2LF1A 1BOZA 1LY4A 3S7AA 4XT7A 4LEKX 1DR4A 3NU0A 5HT4A 1DDSA 1YHOA 4G95A 3S9UA 4P3RA 3JTWA 4RGCA 3KY8A 4Q6AA 3DFRA 2HM9A 4Q0DA 3K2HA 3FS6A 4M6KA 3IA5A 4ELBA 5HSRA 1DHJA 4HOGA 2JYBA 3EELA 4KM0A 3KFYA 3IX9A 4M6JA 2B3ZA 3GI2A 1DLSA 4GH8A 3R33A 3KGYA 3JW5A 3FQ0A 3FQOA 1DYJA 3KJSA 1U72A 3TQAA 3FRBX 1AI9A 4PSSA 4ELGA 3QYOA 4PSYA 5CC9A 1VDRA 3ZPGA 4H97A 4X5GA 3F0SX 1MVTA 1J3KA 4QJZD 2D5NA 4OR7A 1RB2A 2W9GA 1DYIA 1RB3A 3DGAA 4ELEA 3UM5A 3D84X 3FY9X 4KY4A 1DYRA 1AOEA 3EEJA 3DL6A 3UM6A 3N0HA 1IA1A 3NZ9X 3FREX 3QLSA 3E0BA 2CIGA 4H95A 1RX7A 1AO8A 2L28A 3JWMA 4M2XA 2W3MA 3FQCA 3TQ9A 5HUIA 1S3WA 1M79A 5E8QA 3JWCA 3QLXA 2FZHA 4IXFX 3TQ8A 1JOLA 3HBBA 3DL5A 1RE7A 3FQZA 4Q0EA 1RX5A 2DHFA 4KL9A 4XECX 1PDBA 3CD2A 3DRCA 3GHCA 3JWKA 2ANOA 1RX8A 1HFPA 2W3VA 3SRRX 4XE6X 5U27A 2BLBA 3FYVX 1KMSA 4PSTA 1S3VA 5HVBA 3SRSX 1RX6A 3LG4A 2HXVA 1DR1A 1E26A 4KEBA 3SRQX 3QGTA 1OHJA 3NZCX 2BLCA 5JG0X 3QL0A 3F0VX 4FHBA 1DF7A 4TU5X 3QLYA 1JUVA 1DG8A 1RH3A 4KY8A 4EILA 5JA3A 3QLWA 3JW3A 1PD9A 4LAHX 4LAEX 1RF7A 5HI6A 7DFRA 4DPHA 3K74A 4QLGA 4DFRA 1DR5A 3TQBA 2O7PA 3QFXA 1ZDRA 3FL8A 1LUDA 3IA4A 3SA1A 4PTHA 3ZPCA 1M78A 3SRUX 4XT5A 1J3JA 2D0KA 4DPDA 3IRNA 4EIZA 3CSEA 3SA2A 1DRAA 3JVXA 3M08A 3QLRA 3CL9A 4KJJA 5CCCA 5HQZA 2AZNA 3NZAX 3GYFA 4M7VA 3FY8X 3RG9A 1IA3A 1BZFA 2W9TA 1CZ3A 3FYWX 3QL3A 3L3RA 3OAFA 1U71A 1DRHA 1MVSA 2OBCA 3CLBA 4H98A 5HQYA 3HJ3A 5ECCA 4CD2A 3I3RA 3ROAA 1J3IA 1D1GA 3QLZA 2W3WA 2FZIA 3FRFX 3DATA 5DXVA 1PD8A 8DFRA 2CD2A 2ANQA 4EJ1A 1DISA 1RX2A 1RX9A 3D80A 1DR2A 4H96A 5FDAA 2KGKA 4FGGA 3OCHA 3NZBX 1HFRA 2G6VA 5ECXA 4X5JA 4P68A 3F0UX 3F0XX 4XT8A 2W3BA 1DR3A 4DP3A 3IRMA 2W9HA 4OSGA 3EX8A 4M6LA 4KM2A 4X5FA 1KMVA 2INQA 4QI9A 4QLEA 5HF0X 3F0BX 3QG2A 1RX3A 4HOEA 2BLAA 3NXYA 3SH2A 3GHWA 1CD2A 1RD7A 3NZ6X 2W3AA 4I13A 3I8AX 3GHVA 5EAJA 1RA3A 1IA2A 4PDJA 2HQPA 3QYLA 3SGYA 1S3UA 1DIUA 3DG8A 6DFRA 3FQFA 3K47A 2XW7A 2P4GA 3INVA 3SRWX 3NTZA 4KLXA 4P66A 1DHFA 2C2TA 2C2SA 5DFRA 4X5HA 4KBNA 3EEMA 2H2QA 4M7UA 5U26A 5HT5A 4QHVA 3K45A 5HVEA 4KYAA 1DRBA 3Q1HA 4G3MA 4HA9A 1DR7A 2BL9A 4NX7A 1KLKA 1RG7A 3F8ZA 4KJLA 4ECKA 1S3YA 1DR6A 2OIPA 1U70A 3JWFA 4G8ZX 4PTJA 1VJ3A 4QJCA 1LY3A 4HOFA 3KJRA 3NXRA 1DG7A 1DAJA 1M7AA 2ZZAA 3FRAX 3NZDA 1DRFA 1QZFA 3EIGA 4XRBA 4QLFA 3FL9A 3M09A 1OHKA 4HA7A 3RO9A 2DRCA 4FGHA 1RA2A 2GD9A 1DHIA 1RA1A 3SAIA 3IROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HPB A;  1RX4 A;  1DG5 A;  1RC4 A;  4P3Q A;  4KFJ A;  4ELH A;  3F91 A;  1TDR A;  4IXG X;  4DDR A;  5HF2 X;  3F8Y A;  1SEJ A;  3DAU A;  3FQV A;  4Q67 A;  4X5I A;  4KNE A;  3NXV A;  4KJK A;  4I1N A;  3SR5 X;  3NXX A;  5HSU A;  3TD8 A;  1RA8 A;  1RA9 A;  4NX6 A;  1HFQ A;  1IA4 A;  3NXO A;  2QK8 A;  4KAK A;  3JSU A;  4XT6 A;  1RX1 A;  3FRD X;  1JOM A;  4EIG A;  3SQY X;  3F0Q X;  4XT4 A;  3EEK A;  2W9S A;  2FZJ A;  3NXT A;  1DDR A;  3S3V A;  1DRE A;  3NRR A;  3VCO A;  1DYH A;  4IXE D;  4KD7 A;  1DLR A;  4ELF A;  3UM8 A;  2ITH A;  4LAG X;  2LF1 A;  1BOZ A;  1LY4 A;  3S7A A;  4XT7 A;  4LEK X;  1DR4 A;  3NU0 A;  5HT4 A;  1DDS A;  1YHO A;  4G95 A;  3S9U A;  4P3R A;  3JTW A;  4RGC A;  3KY8 A;  4Q6A A;  3DFR A;  2HM9 A;  4Q0D A;  3K2H A;  3FS6 A;  4M6K A;  3IA5 A;  4ELB A;  5HSR A;  1DHJ A;  4HOG A;  2JYB A;  3EEL A;  4KM0 A;  3KFY A;  3IX9 A;  4M6J A;  2B3Z A;  3GI2 A;  1DLS A;  4GH8 A;  3R33 A;  3KGY A;  3JW5 A;  3FQ0 A;  3FQO A;  1DYJ A;  3KJS A;  1U72 A;  3TQA A;  3FRB X;  1AI9 A;  4PSS A;  4ELG A;  3QYO A;  4PSY A;  5CC9 A;  1VDR A;  3ZPG A;  4H97 A;  4X5G A;  3F0S X;  1MVT A;  1J3K A;  4QJZ D;  2D5N A;  4OR7 A;  1RB2 A;  2W9G A;  1DYI A;  1RB3 A;  3DGA A;  4ELE A;  3UM5 A;  3D84 X;  3FY9 X;  4KY4 A;  1DYR A;  1AOE A;  3EEJ A;  3DL6 A;  3UM6 A;  3N0H A;  1IA1 A;  3NZ9 X;  3FRE X;  3QLS A;  3E0B A;  2CIG A;  4H95 A;  1RX7 A;  1AO8 A;  2L28 A;  3JWM A;  4M2X A;  2W3M A;  3FQC A;  3TQ9 A;  5HUI A;  1S3W A;  1M79 A;  5E8Q A;  3JWC A;  3QLX A;  2FZH A;  4IXF X;  3TQ8 A;  1JOL A;  3HBB A;  3DL5 A;  1RE7 A;  3FQZ A;  4Q0E A;  1RX5 A;  2DHF A;  4KL9 A;  4XEC X;  1PDB A;  3CD2 A;  3DRC A;  3GHC A;  3JWK A;  2ANO A;  1RX8 A;  1HFP A;  2W3V A;  3SRR X;  4XE6 X;  5U27 A;  2BLB A;  3FYV X;  1KMS A;  4PST A;  1S3V A;  5HVB A;  3SRS X;  1RX6 A;  3LG4 A;  2HXV A;  1DR1 A;  1E26 A;  4KEB A;  3SRQ X;  3QGT A;  1OHJ A;  3NZC X;  2BLC A;  5JG0 X;  3QL0 A;  3F0V X;  4FHB A;  1DF7 A;  4TU5 X;  3QLY A;  1JUV A;  1DG8 A;  1RH3 A;  4KY8 A;  4EIL A;  5JA3 A;  3QLW A;  3JW3 A;  1PD9 A;  4LAH X;  4LAE X;  1RF7 A;  5HI6 A;  7DFR A;  4DPH A;  3K74 A;  4QLG A;  4DFR A;  1DR5 A;  3TQB A;  2O7P A;  3QFX A;  1ZDR A;  3FL8 A;  1LUD A;  3IA4 A;  3SA1 A;  4PTH A;  3ZPC A;  1M78 A;  3SRU X;  4XT5 A;  1J3J A;  2D0K A;  4DPD A;  3IRN A;  4EIZ A;  3CSE A;  3SA2 A;  1DRA A;  3JVX A;  3M08 A;  3QLR A;  3CL9 A;  4KJJ A;  5CCC A;  5HQZ A;  2AZN A;  3NZA X;  3GYF A;  4M7V A;  3FY8 X;  3RG9 A;  1IA3 A;  1BZF A;  2W9T A;  1CZ3 A;  3FYW X;  3QL3 A;  3L3R A;  3OAF A;  1U71 A;  1DRH A;  1MVS A;  2OBC A;  3CLB A;  4H98 A;  5HQY A;  3HJ3 A;  5ECC A;  4CD2 A;  3I3R A;  3ROA A;  1J3I A;  1D1G A;  3QLZ A;  2W3W A;  2FZI A;  3FRF X;  3DAT A;  5DXV A;  1PD8 A;  8DFR A;  2CD2 A;  2ANQ A;  4EJ1 A;  1DIS A;  1RX2 A;  1RX9 A;  3D80 A;  1DR2 A;  4H96 A;  5FDA A;  2KGK A;  4FGG A;  3OCH A;  3NZB X;  1HFR A;  2G6V A;  5ECX A;  4X5J A;  4P68 A;  3F0U X;  3F0X X;  4XT8 A;  2W3B A;  1DR3 A;  4DP3 A;  3IRM A;  2W9H A;  4OSG A;  3EX8 A;  4M6L A;  4KM2 A;  4X5F A;  1KMV A;  2INQ A;  4QI9 A;  4QLE A;  5HF0 X;  3F0B X;  3QG2 A;  1RX3 A;  4HOE A;  2BLA A;  3NXY A;  3SH2 A;  3GHW A;  1CD2 A;  1RD7 A;  3NZ6 X;  2W3A A;  4I13 A;  3I8A X;  3GHV A;  5EAJ A;  1RA3 A;  1IA2 A;  4PDJ A;  2HQP A;  3QYL A;  3SGY A;  1S3U A;  1DIU A;  3DG8 A;  6DFR A;  3FQF A;  3K47 A;  2XW7 A;  2P4G A;  3INV A;  3SRW X;  3NTZ A;  4KLX A;  4P66 A;  1DHF A;  2C2T A;  2C2S A;  5DFR A;  4X5H A;  4KBN A;  3EEM A;  2H2Q A;  4M7U A;  5U26 A;  5HT5 A;  4QHV A;  3K45 A;  5HVE A;  4KYA A;  1DRB A;  3Q1H A;  4G3M A;  4HA9 A;  1DR7 A;  2BL9 A;  4NX7 A;  1KLK A;  1RG7 A;  3F8Z A;  4KJL A;  4ECK A;  1S3Y A;  1DR6 A;  2OIP A;  1U70 A;  3JWF A;  4G8Z X;  4PTJ A;  1VJ3 A;  4QJC A;  1LY3 A;  4HOF A;  3KJR A;  3NXR A;  1DG7 A;  1DAJ A;  1M7A A;  2ZZA A;  3FRA X;  3NZD A;  1DRF A;  1QZF A;  3EIG A;  4XRB A;  4QLF A;  3FL9 A;  3M09 A;  1OHK A;  4HA7 A;  3RO9 A;  2DRC A;  4FGH A;  1RA2 A;  2GD9 A;  1DHI A;  1RA1 A;  3SAI A;  3IRO A; 
#chains in the Genus database with same CATH topology
 5HPB A;  1RX4 A;  1DG5 A;  1RC4 A;  4P3Q A;  4KFJ A;  4ELH A;  3F91 A;  1TDR A;  4IXG X;  4DDR A;  5HF2 X;  3F8Y A;  1SEJ A;  3DAU A;  3FQV A;  4Q67 A;  4X5I A;  4KNE A;  3NXV A;  4KJK A;  4I1N A;  3SR5 X;  3NXX A;  5HSU A;  3TD8 A;  1RA8 A;  1RA9 A;  4NX6 A;  1HFQ A;  1IA4 A;  3NXO A;  2QK8 A;  4KAK A;  3JSU A;  4XT6 A;  1RX1 A;  3FRD X;  1JOM A;  4EIG A;  3SQY X;  3F0Q X;  4XT4 A;  3EEK A;  2W9S A;  2FZJ A;  3NXT A;  1DDR A;  3S3V A;  1DRE A;  3NRR A;  3VCO A;  1DYH A;  4IXE D;  4KD7 A;  1DLR A;  4ELF A;  3UM8 A;  2ITH A;  4LAG X;  2LF1 A;  1BOZ A;  1LY4 A;  3S7A A;  4XT7 A;  4LEK X;  1DR4 A;  3NU0 A;  5HT4 A;  1DDS A;  1YHO A;  4G95 A;  3S9U A;  4P3R A;  3JTW A;  4RGC A;  3KY8 A;  4Q6A A;  3DFR A;  2HM9 A;  4Q0D A;  3K2H A;  3FS6 A;  4M6K A;  3IA5 A;  4ELB A;  5HSR A;  1DHJ A;  4HOG A;  2JYB A;  3EEL A;  4KM0 A;  3KFY A;  3IX9 A;  4M6J A;  2B3Z A;  3GI2 A;  1DLS A;  4GH8 A;  3R33 A;  3KGY A;  3JW5 A;  3FQ0 A;  3FQO A;  1DYJ A;  3KJS A;  1U72 A;  3TQA A;  3FRB X;  1AI9 A;  4PSS A;  4ELG A;  3QYO A;  4PSY A;  5CC9 A;  1VDR A;  3ZPG A;  4H97 A;  4X5G A;  3F0S X;  1MVT A;  1J3K A;  4QJZ D;  2D5N A;  4OR7 A;  1RB2 A;  2W9G A;  1DYI A;  1RB3 A;  3DGA A;  4ELE A;  3UM5 A;  3D84 X;  3FY9 X;  4KY4 A;  1DYR A;  1AOE A;  3EEJ A;  3DL6 A;  3UM6 A;  3N0H A;  1IA1 A;  3NZ9 X;  3FRE X;  3QLS A;  3E0B A;  2CIG A;  4H95 A;  1RX7 A;  1AO8 A;  2L28 A;  3JWM A;  4M2X A;  2W3M A;  3FQC A;  3TQ9 A;  5HUI A;  1S3W A;  1M79 A;  5E8Q A;  3JWC A;  3QLX A;  2FZH A;  4IXF X;  3TQ8 A;  1JOL A;  3HBB A;  3DL5 A;  1RE7 A;  3FQZ A;  4Q0E A;  1RX5 A;  2DHF A;  4KL9 A;  4XEC X;  1PDB A;  3CD2 A;  3DRC A;  3GHC A;  3JWK A;  2ANO A;  1RX8 A;  1HFP A;  2W3V A;  3SRR X;  4XE6 X;  5U27 A;  2BLB A;  3FYV X;  1KMS A;  4PST A;  1S3V A;  5HVB A;  3SRS X;  1RX6 A;  3LG4 A;  2HXV A;  1DR1 A;  1E26 A;  4KEB A;  3SRQ X;  3QGT A;  1OHJ A;  3NZC X;  2BLC A;  5JG0 X;  3QL0 A;  3F0V X;  4FHB A;  1DF7 A;  4TU5 X;  3QLY A;  1JUV A;  1DG8 A;  1RH3 A;  4KY8 A;  4EIL A;  5JA3 A;  3QLW A;  3JW3 A;  1PD9 A;  4LAH X;  4LAE X;  1RF7 A;  5HI6 A;  7DFR A;  4DPH A;  3K74 A;  4QLG A;  4DFR A;  1DR5 A;  3TQB A;  2O7P A;  3QFX A;  1ZDR A;  3FL8 A;  1LUD A;  3IA4 A;  3SA1 A;  4PTH A;  3ZPC A;  1M78 A;  3SRU X;  4XT5 A;  1J3J A;  2D0K A;  4DPD A;  3IRN A;  4EIZ A;  3CSE A;  3SA2 A;  1DRA A;  3JVX A;  3M08 A;  3QLR A;  3CL9 A;  4KJJ A;  5CCC A;  5HQZ A;  2AZN A;  3NZA X;  3GYF A;  4M7V A;  3FY8 X;  3RG9 A;  1IA3 A;  1BZF A;  2W9T A;  1CZ3 A;  3FYW X;  3QL3 A;  3L3R A;  3OAF A;  1U71 A;  1DRH A;  1MVS A;  2OBC A;  3CLB A;  4H98 A;  5HQY A;  3HJ3 A;  5ECC A;  4CD2 A;  3I3R A;  3ROA A;  1J3I A;  1D1G A;  3QLZ A;  2W3W A;  2FZI A;  3FRF X;  3DAT A;  5DXV A;  1PD8 A;  8DFR A;  2CD2 A;  2ANQ A;  4EJ1 A;  1DIS A;  1RX2 A;  1RX9 A;  3D80 A;  1DR2 A;  4H96 A;  5FDA A;  2KGK A;  4FGG A;  3OCH A;  3NZB X;  1HFR A;  2G6V A;  5ECX A;  4X5J A;  4P68 A;  3F0U X;  3F0X X;  4XT8 A;  2W3B A;  1DR3 A;  4DP3 A;  3IRM A;  2W9H A;  4OSG A;  3EX8 A;  4M6L A;  4KM2 A;  4X5F A;  1KMV A;  2INQ A;  4QI9 A;  4QLE A;  5HF0 X;  3F0B X;  3QG2 A;  1RX3 A;  4HOE A;  2BLA A;  3NXY A;  3SH2 A;  3GHW A;  1CD2 A;  1RD7 A;  3NZ6 X;  2W3A A;  4I13 A;  3I8A X;  3GHV A;  5EAJ A;  1RA3 A;  1IA2 A;  4PDJ A;  2HQP A;  3QYL A;  3SGY A;  1S3U A;  1DIU A;  3DG8 A;  6DFR A;  3FQF A;  3K47 A;  2XW7 A;  2P4G A;  3INV A;  3SRW X;  3NTZ A;  4KLX A;  4P66 A;  1DHF A;  2C2T A;  2C2S A;  5DFR A;  4X5H A;  4KBN A;  3EEM A;  2H2Q A;  4M7U A;  5U26 A;  5HT5 A;  4QHV A;  3K45 A;  5HVE A;  4KYA A;  1DRB A;  3Q1H A;  4G3M A;  4HA9 A;  1DR7 A;  2BL9 A;  4NX7 A;  1KLK A;  1RG7 A;  3F8Z A;  4KJL A;  4ECK A;  1S3Y A;  1DR6 A;  2OIP A;  1U70 A;  3JWF A;  4G8Z X;  4PTJ A;  1VJ3 A;  4QJC A;  1LY3 A;  4HOF A;  3KJR A;  3NXR A;  1DG7 A;  1DAJ A;  1M7A A;  2ZZA A;  3FRA X;  3NZD A;  1DRF A;  1QZF A;  3EIG A;  4XRB A;  4QLF A;  3FL9 A;  3M09 A;  1OHK A;  4HA7 A;  3RO9 A;  2DRC A;  4FGH A;  1RA2 A;  2GD9 A;  1DHI A;  1RA1 A;  3SAI A;  3IRO A; 
#chains in the Genus database with same CATH homology
 5HPB A;  1RX4 A;  1DG5 A;  1RC4 A;  4P3Q A;  4KFJ A;  4ELH A;  3F91 A;  1TDR A;  4IXG X;  4DDR A;  5HF2 X;  3F8Y A;  1SEJ A;  3DAU A;  3FQV A;  4Q67 A;  4X5I A;  4KNE A;  3NXV A;  4KJK A;  4I1N A;  3SR5 X;  3NXX A;  5HSU A;  3TD8 A;  1RA8 A;  1RA9 A;  4NX6 A;  1HFQ A;  1IA4 A;  3NXO A;  2QK8 A;  4KAK A;  3JSU A;  4XT6 A;  1RX1 A;  3FRD X;  1JOM A;  4EIG A;  3SQY X;  3F0Q X;  4XT4 A;  3EEK A;  2W9S A;  2FZJ A;  3NXT A;  1DDR A;  3S3V A;  1DRE A;  3NRR A;  3VCO A;  1DYH A;  4IXE D;  4KD7 A;  1DLR A;  4ELF A;  3UM8 A;  2ITH A;  4LAG X;  2LF1 A;  1BOZ A;  1LY4 A;  3S7A A;  4XT7 A;  4LEK X;  1DR4 A;  3NU0 A;  5HT4 A;  1DDS A;  1YHO A;  4G95 A;  3S9U A;  4P3R A;  3JTW A;  4RGC A;  3KY8 A;  4Q6A A;  3DFR A;  2HM9 A;  4Q0D A;  3K2H A;  3FS6 A;  4M6K A;  3IA5 A;  4ELB A;  5HSR A;  1DHJ A;  4HOG A;  2JYB A;  3EEL A;  4KM0 A;  3KFY A;  3IX9 A;  4M6J A;  2B3Z A;  3GI2 A;  1DLS A;  4GH8 A;  3R33 A;  3KGY A;  3JW5 A;  3FQ0 A;  3FQO A;  1DYJ A;  3KJS A;  1U72 A;  3TQA A;  3FRB X;  1AI9 A;  4PSS A;  4ELG A;  3QYO A;  4PSY A;  5CC9 A;  1VDR A;  3ZPG A;  4H97 A;  4X5G A;  3F0S X;  1MVT A;  1J3K A;  4QJZ D;  2D5N A;  4OR7 A;  1RB2 A;  2W9G A;  1DYI A;  1RB3 A;  3DGA A;  4ELE A;  3UM5 A;  3D84 X;  3FY9 X;  4KY4 A;  1DYR A;  1AOE A;  3EEJ A;  3DL6 A;  3UM6 A;  3N0H A;  1IA1 A;  3NZ9 X;  3FRE X;  3QLS A;  3E0B A;  2CIG A;  4H95 A;  1RX7 A;  1AO8 A;  2L28 A;  3JWM A;  4M2X A;  2W3M A;  3FQC A;  3TQ9 A;  5HUI A;  1S3W A;  1M79 A;  5E8Q A;  3JWC A;  3QLX A;  2FZH A;  4IXF X;  3TQ8 A;  1JOL A;  3HBB A;  3DL5 A;  1RE7 A;  3FQZ A;  4Q0E A;  1RX5 A;  2DHF A;  4KL9 A;  4XEC X;  1PDB A;  3CD2 A;  3DRC A;  3GHC A;  3JWK A;  2ANO A;  1RX8 A;  1HFP A;  2W3V A;  3SRR X;  4XE6 X;  5U27 A;  2BLB A;  3FYV X;  1KMS A;  4PST A;  1S3V A;  5HVB A;  3SRS X;  1RX6 A;  3LG4 A;  2HXV A;  1DR1 A;  1E26 A;  4KEB A;  3SRQ X;  3QGT A;  1OHJ A;  3NZC X;  2BLC A;  5JG0 X;  3QL0 A;  3F0V X;  4FHB A;  1DF7 A;  4TU5 X;  3QLY A;  1JUV A;  1DG8 A;  1RH3 A;  4KY8 A;  4EIL A;  5JA3 A;  3QLW A;  3JW3 A;  1PD9 A;  4LAH X;  4LAE X;  1RF7 A;  5HI6 A;  7DFR A;  4DPH A;  3K74 A;  4QLG A;  4DFR A;  1DR5 A;  3TQB A;  2O7P A;  3QFX A;  1ZDR A;  3FL8 A;  1LUD A;  3IA4 A;  3SA1 A;  4PTH A;  3ZPC A;  1M78 A;  3SRU X;  4XT5 A;  1J3J A;  2D0K A;  4DPD A;  3IRN A;  4EIZ A;  3CSE A;  3SA2 A;  1DRA A;  3JVX A;  3M08 A;  3QLR A;  3CL9 A;  4KJJ A;  5CCC A;  5HQZ A;  2AZN A;  3NZA X;  3GYF A;  4M7V A;  3FY8 X;  3RG9 A;  1IA3 A;  1BZF A;  2W9T A;  1CZ3 A;  3FYW X;  3QL3 A;  3L3R A;  3OAF A;  1U71 A;  1DRH A;  1MVS A;  2OBC A;  3CLB A;  4H98 A;  5HQY A;  3HJ3 A;  5ECC A;  4CD2 A;  3I3R A;  3ROA A;  1J3I A;  1D1G A;  3QLZ A;  2W3W A;  2FZI A;  3FRF X;  3DAT A;  5DXV A;  1PD8 A;  8DFR A;  2CD2 A;  2ANQ A;  4EJ1 A;  1DIS A;  1RX2 A;  1RX9 A;  3D80 A;  1DR2 A;  4H96 A;  5FDA A;  2KGK A;  4FGG A;  3OCH A;  3NZB X;  1HFR A;  2G6V A;  5ECX A;  4X5J A;  4P68 A;  3F0U X;  3F0X X;  4XT8 A;  2W3B A;  1DR3 A;  4DP3 A;  3IRM A;  2W9H A;  4OSG A;  3EX8 A;  4M6L A;  4KM2 A;  4X5F A;  1KMV A;  2INQ A;  4QI9 A;  4QLE A;  5HF0 X;  3F0B X;  3QG2 A;  1RX3 A;  4HOE A;  2BLA A;  3NXY A;  3SH2 A;  3GHW A;  1CD2 A;  1RD7 A;  3NZ6 X;  2W3A A;  4I13 A;  3I8A X;  3GHV A;  5EAJ A;  1RA3 A;  1IA2 A;  4PDJ A;  2HQP A;  3QYL A;  3SGY A;  1S3U A;  1DIU A;  3DG8 A;  6DFR A;  3FQF A;  3K47 A;  2XW7 A;  2P4G A;  3INV A;  3SRW X;  3NTZ A;  4KLX A;  4P66 A;  1DHF A;  2C2T A;  2C2S A;  5DFR A;  4X5H A;  4KBN A;  3EEM A;  2H2Q A;  4M7U A;  5U26 A;  5HT5 A;  4QHV A;  3K45 A;  5HVE A;  4KYA A;  1DRB A;  3Q1H A;  4G3M A;  4HA9 A;  1DR7 A;  2BL9 A;  4NX7 A;  1KLK A;  1RG7 A;  3F8Z A;  4KJL A;  4ECK A;  1S3Y A;  1DR6 A;  2OIP A;  1U70 A;  3JWF A;  4G8Z X;  4PTJ A;  1VJ3 A;  4QJC A;  1LY3 A;  4HOF A;  3KJR A;  3NXR A;  1DG7 A;  1DAJ A;  1M7A A;  2ZZA A;  3FRA X;  3NZD A;  1DRF A;  1QZF A;  3EIG A;  4XRB A;  4QLF A;  3FL9 A;  3M09 A;  1OHK A;  4HA7 A;  3RO9 A;  2DRC A;  4FGH A;  1RA2 A;  2GD9 A;  1DHI A;  1RA1 A;  3SAI A;  3IRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...