4ELFA

Structure-activity relationship guides enantiomeric preference among potent inhibitors of b. anthracis dihydrofolate reductase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
166
structure length
166
Chain Sequence
MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-activity relationship for enantiomers of potent inhibitors of B. anthracis dihydrofolate reductase.
pubmed doi rcsb
molecule keywords Dihydrofolate reductase
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Bacillus anthracis
total genus 42
structure length 166
sequence length 166
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2012-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 4elfA00
3SAIA 2CD2A 4ELFA 3F91A 3KFYA 1RA9A 1PDBA 3FY8X 1DLRA 2D5NA 1LY3A 2GD9A 1S3YA 2HQPA 3FREX 3JSUA 3M09A 3SRWX 4M7UA 1BZFA 3LG4A 4ELGA 1JUVA 3UM6A 3KY8A 4M6KA 1DYJA 3OAFA 2BL9A 3JWCA 1YHOA 1DLSA 1LY4A 2O7PA 4Q0DA 3GHWA 4I13A 1RA2A 4M6JA 4ELBA 1AO8A 1RC4A 1S3UA 1DR1A 2INQA 4XECX 3TQ8A 2BLCA 3DL5A 3IROA 1RB3A 4NX6A 3ROAA 4KFJA 2W3AA 1RA3A 1M7AA 4P66A 4KNEA 3SRSX 1DYRA 1DRBA 5JA3A 1MVTA 3TQ9A 1IA4A 1DYHA 1RA8A 1BOZA 3JVXA 4Q67A 4FGGA 1RX4A 5CC9A 3K74A 3JWMA 5HQYA 3DAUA 2OIPA 4XT8A 2W9HA 1CZ3A 1SEJA 4NX7A 3IA4A 2L28A 3JWFA 1DDRA 2HXVA 5HSUA 3F0UX 4PSYA 1DG7A 4XT7A 1J3IA 1DHIA 3K2HA 2W3VA 3NTZA 3QL3A 3UM8A 2P4GA 3QFXA 2AZNA 3N0HA 4X5FA 1S3VA 3IRNA 5ECXA 1RE7A 4DPDA 4FGHA 3KJSA 4Q6AA 3SGYA 1DRFA 1DG5A 3SA2A 4IXED 1OHJA 3FQOA 3F0QX 2W9GA 2FZHA 3F0BX 4KEBA 2BLBA 3QLWA 3NXYA 5DFRA 1AI9A 5HT5A 3I8AX 4G8ZX 2H2QA 2C2TA 5ECCA 1U72A 4M7VA 5JG0X 3FQFA 4OSGA 4M6LA 1DIUA 1AOEA 3SA1A 3GHCA 7DFRA 4DPHA 3Q1HA 3ZPGA 3K47A 4I1NA 1RH3A 1DHFA 3F0VX 3FQCA 3FL8A 1RX2A 2OBCA 4H98A 1OHKA 3FL9A 1U71A 3SR5X 3KGYA 4LAEX 3QYOA 4LAHX 2DHFA 1HFRA 4HOGA 4HA9A 3NZAX 4XT6A 3GHVA 4KJLA 4ECKA 1RX7A 4Q0EA 4KD7A 3CSEA 3NXTA 1RX6A 1DR4A 4G3MA 3D80A 4DFRA 3I3RA 3VCOA 3CLBA 1KLKA 1QZFA 3S7AA 5HI6A 4KY8A 3EEMA 3QYLA 4P3QA 2HM9A 3EIGA 4HOFA 3FQ0A 4PDJA 4PTHA 3QL0A 5FDAA 3F0XX 2CIGA 3JW5A 3SRRX 4G95A 3FRAX 1DHJA 3JW3A 1RB2A 3M08A 3DGAA 2ZZAA 4IXGX 1JOLA 2LF1A 5HVBA 1RD7A 2KGKA 3FRFX 3DL6A 3RO9A 1PD9A 1RA1A 3IRMA 1IA3A 1RX5A 4P68A 3TQAA 3F8ZA 2W3WA 1DR6A 1M79A 1S3WA 4QLGA 4EIZA 3NXXA 3FQZA 3DG8A 1DR2A 1HFPA 3FS6A 4LEKX 4EILA 3NXVA 5CCCA 1MVSA 4ELEA 3NZCX 4QLEA 1CD2A 3QLXA 3E0BA 4PSTA 1E26A 3QG2A 4KYAA 3DATA 4M2XA 3QGTA 4EIGA 5E8QA 1DR5A 3NZ6X 1VJ3A 8DFRA 3FY9X 3EELA 4QJZD 4PSSA 3TQBA 3OCHA 3QLZA 4X5IA 3CD2A 3NRRA 3F0SX 2DRCA 2G6VA 2JYBA 4OR7A 3SRQX 5HSRA 1RX8A 4P3RA 4X5HA 4KY4A 1IA1A 1J3JA 2ITHA 1RX1A 4KM0A 2W3MA 3NXRA 1RG7A 1DG8A 3SH2A 3GYFA 1RX9A 3QLYA 3TD8A 2FZIA 4FHBA 3IX9A 3HJ3A 4LAGX 3K45A 1VDRA 4X5JA 4ELHA 4KBNA 3SRUX 4KM2A 1KMSA 4QJCA 1DISA 3DFRA 3DRCA 3RG9A 3JWKA 4KLXA 4XT4A 3ZPCA 5HQZA 3CL9A 5DXVA 3IA5A 3F8YA 1RX3A 3FYVX 4GH8A 5HPBA 2FZJA 4QHVA 4H96A 2QK8A 1LUDA 3HBBA 1DR7A 5HF2X 4H97A 5U26A 4DDRA 2ANOA 3L3RA 1DRAA 4XT5A 5HT4A 4EJ1A 5HVEA 3GI2A 2D0KA 2C2SA 4KAKA 2BLAA 4IXFX 4XRBA 3SQYX 1DDSA 3S3VA 3NXOA 3FYWX 3EX8A 3FQVA 4QLFA 3QLSA 1TDRA 1D1GA 5HF0X 5EAJA 1JOMA 4RGCA 2W9SA 4X5GA 4PTJA 3JTWA 1KMVA 1DYIA 4HOEA 4CD2A 3UM5A 4KL9A 4HA7A 2ANQA 3EEJA 3NU0A 3NZ9X 1IA2A 2W3BA 5U27A 1M78A 1DR3A 4KJKA 3INVA 3R33A 3S9UA 3NZBX 4H95A 2B3ZA 4QI9A 5HUIA 3KJRA 3QLRA 1RF7A 1DF7A 3NZDA 1U70A 4KJJA 2W9TA 1DREA 1J3KA 6DFRA 1DAJA 2XW7A 4XE6X 1PD8A 3FRDX 4TU5X 1HFQA 1ZDRA 1DRHA 4DP3A 3EEKA 3D84X 3FRBX
chains in the Genus database with same CATH superfamily
3SAIA 2CD2A 4ELFA 3F91A 3KFYA 1RA9A 1PDBA 3FY8X 1DLRA 2D5NA 1LY3A 2GD9A 1S3YA 2HQPA 3FREX 3JSUA 3M09A 3SRWX 4M7UA 1BZFA 3LG4A 4ELGA 1JUVA 3UM6A 3KY8A 4M6KA 1DYJA 3OAFA 2BL9A 3JWCA 1YHOA 1DLSA 1LY4A 2O7PA 4Q0DA 3GHWA 4I13A 1RA2A 4M6JA 4ELBA 1AO8A 1RC4A 1S3UA 1DR1A 2INQA 4XECX 3TQ8A 2BLCA 3DL5A 3IROA 1RB3A 4NX6A 3ROAA 4KFJA 2W3AA 1RA3A 1M7AA 4P66A 4KNEA 3SRSX 1DYRA 1DRBA 5JA3A 1MVTA 3TQ9A 1IA4A 1DYHA 1RA8A 1BOZA 3JVXA 4Q67A 4FGGA 1RX4A 5CC9A 3K74A 3JWMA 5HQYA 3DAUA 2OIPA 4XT8A 2W9HA 1CZ3A 1SEJA 4NX7A 3IA4A 2L28A 3JWFA 1DDRA 2HXVA 5HSUA 3F0UX 4PSYA 1DG7A 4XT7A 1J3IA 1DHIA 3K2HA 2W3VA 3NTZA 3QL3A 3UM8A 2P4GA 3QFXA 2AZNA 3N0HA 4X5FA 1S3VA 3IRNA 5ECXA 1RE7A 4DPDA 4FGHA 3KJSA 4Q6AA 3SGYA 1DRFA 1DG5A 3SA2A 4IXED 1OHJA 3FQOA 3F0QX 2W9GA 2FZHA 3F0BX 4KEBA 2BLBA 3QLWA 3NXYA 5DFRA 1AI9A 5HT5A 3I8AX 4G8ZX 2H2QA 2C2TA 5ECCA 1U72A 4M7VA 5JG0X 3FQFA 4OSGA 4M6LA 1DIUA 1AOEA 3SA1A 3GHCA 7DFRA 4DPHA 3Q1HA 3ZPGA 3K47A 4I1NA 1RH3A 1DHFA 3F0VX 3FQCA 3FL8A 1RX2A 2OBCA 4H98A 1OHKA 3FL9A 1U71A 3SR5X 3KGYA 4LAEX 3QYOA 4LAHX 2DHFA 1HFRA 4HOGA 4HA9A 3NZAX 4XT6A 3GHVA 4KJLA 4ECKA 1RX7A 4Q0EA 4KD7A 3CSEA 3NXTA 1RX6A 1DR4A 4G3MA 3D80A 4DFRA 3I3RA 3VCOA 3CLBA 1KLKA 1QZFA 3S7AA 5HI6A 4KY8A 3EEMA 3QYLA 4P3QA 2HM9A 3EIGA 4HOFA 3FQ0A 4PDJA 4PTHA 3QL0A 5FDAA 3F0XX 2CIGA 3JW5A 3SRRX 4G95A 3FRAX 1DHJA 3JW3A 1RB2A 3M08A 3DGAA 2ZZAA 4IXGX 1JOLA 2LF1A 5HVBA 1RD7A 2KGKA 3FRFX 3DL6A 3RO9A 1PD9A 1RA1A 3IRMA 1IA3A 1RX5A 4P68A 3TQAA 3F8ZA 2W3WA 1DR6A 1M79A 1S3WA 4QLGA 4EIZA 3NXXA 3FQZA 3DG8A 1DR2A 1HFPA 3FS6A 4LEKX 4EILA 3NXVA 5CCCA 1MVSA 4ELEA 3NZCX 4QLEA 1CD2A 3QLXA 3E0BA 4PSTA 1E26A 3QG2A 4KYAA 3DATA 4M2XA 3QGTA 4EIGA 5E8QA 1DR5A 3NZ6X 1VJ3A 8DFRA 3FY9X 3EELA 4QJZD 4PSSA 3TQBA 3OCHA 3QLZA 4X5IA 3CD2A 3NRRA 3F0SX 2DRCA 2G6VA 2JYBA 4OR7A 3SRQX 5HSRA 1RX8A 4P3RA 4X5HA 4KY4A 1IA1A 1J3JA 2ITHA 1RX1A 4KM0A 2W3MA 3NXRA 1RG7A 1DG8A 3SH2A 3GYFA 1RX9A 3QLYA 3TD8A 2FZIA 4FHBA 3IX9A 3HJ3A 4LAGX 3K45A 1VDRA 4X5JA 4ELHA 4KBNA 3SRUX 4KM2A 1KMSA 4QJCA 1DISA 3DFRA 3DRCA 3RG9A 3JWKA 4KLXA 4XT4A 3ZPCA 5HQZA 3CL9A 5DXVA 3IA5A 3F8YA 1RX3A 3FYVX 4GH8A 5HPBA 2FZJA 4QHVA 4H96A 2QK8A 1LUDA 3HBBA 1DR7A 5HF2X 4H97A 5U26A 4DDRA 2ANOA 3L3RA 1DRAA 4XT5A 5HT4A 4EJ1A 5HVEA 3GI2A 2D0KA 2C2SA 4KAKA 2BLAA 4IXFX 4XRBA 3SQYX 1DDSA 3S3VA 3NXOA 3FYWX 3EX8A 3FQVA 4QLFA 3QLSA 1TDRA 1D1GA 5HF0X 5EAJA 1JOMA 4RGCA 2W9SA 4X5GA 4PTJA 3JTWA 1KMVA 1DYIA 4HOEA 4CD2A 3UM5A 4KL9A 4HA7A 2ANQA 3EEJA 3NU0A 3NZ9X 1IA2A 2W3BA 5U27A 1M78A 1DR3A 4KJKA 3INVA 3R33A 3S9UA 3NZBX 4H95A 2B3ZA 4QI9A 5HUIA 3KJRA 3QLRA 1RF7A 1DF7A 3NZDA 1U70A 4KJJA 2W9TA 1DREA 1J3KA 6DFRA 1DAJA 2XW7A 4XE6X 1PD8A 3FRDX 4TU5X 1HFQA 1ZDRA 1DRHA 4DP3A 3EEKA 3D84X 3FRBX
chains in the Genus database with same CATH topology
3SAIA 2CD2A 4ELFA 3F91A 3KFYA 1RA9A 1PDBA 3FY8X 1DLRA 2D5NA 1LY3A 2GD9A 1S3YA 2HQPA 3FREX 3JSUA 3M09A 3SRWX 4M7UA 1BZFA 3LG4A 4ELGA 1JUVA 3UM6A 3KY8A 4M6KA 1DYJA 3OAFA 2BL9A 3JWCA 1YHOA 1DLSA 1LY4A 2O7PA 4Q0DA 3GHWA 4I13A 1RA2A 4M6JA 4ELBA 1AO8A 1RC4A 1S3UA 1DR1A 2INQA 4XECX 3TQ8A 2BLCA 3DL5A 3IROA 1RB3A 4NX6A 3ROAA 4KFJA 2W3AA 1RA3A 1M7AA 4P66A 4KNEA 3SRSX 1DYRA 1DRBA 5JA3A 1MVTA 3TQ9A 1IA4A 1DYHA 1RA8A 1BOZA 3JVXA 4Q67A 4FGGA 1RX4A 5CC9A 3K74A 3JWMA 5HQYA 3DAUA 2OIPA 4XT8A 2W9HA 1CZ3A 1SEJA 4NX7A 3IA4A 2L28A 3JWFA 1DDRA 2HXVA 5HSUA 3F0UX 4PSYA 1DG7A 4XT7A 1J3IA 1DHIA 3K2HA 2W3VA 3NTZA 3QL3A 3UM8A 2P4GA 3QFXA 2AZNA 3N0HA 4X5FA 1S3VA 3IRNA 5ECXA 1RE7A 4DPDA 4FGHA 3KJSA 4Q6AA 3SGYA 1DRFA 1DG5A 3SA2A 4IXED 1OHJA 3FQOA 3F0QX 2W9GA 2FZHA 3F0BX 4KEBA 2BLBA 3QLWA 3NXYA 5DFRA 1AI9A 5HT5A 3I8AX 4G8ZX 2H2QA 2C2TA 5ECCA 1U72A 4M7VA 5JG0X 3FQFA 4OSGA 4M6LA 1DIUA 1AOEA 3SA1A 3GHCA 7DFRA 4DPHA 3Q1HA 3ZPGA 3K47A 4I1NA 1RH3A 1DHFA 3F0VX 3FQCA 3FL8A 1RX2A 2OBCA 4H98A 1OHKA 3FL9A 1U71A 3SR5X 3KGYA 4LAEX 3QYOA 4LAHX 2DHFA 1HFRA 4HOGA 4HA9A 3NZAX 4XT6A 3GHVA 4KJLA 4ECKA 1RX7A 4Q0EA 4KD7A 3CSEA 3NXTA 1RX6A 1DR4A 4G3MA 3D80A 4DFRA 3I3RA 3VCOA 3CLBA 1KLKA 1QZFA 3S7AA 5HI6A 4KY8A 3EEMA 3QYLA 4P3QA 2HM9A 3EIGA 4HOFA 3FQ0A 4PDJA 4PTHA 3QL0A 5FDAA 3F0XX 2CIGA 3JW5A 3SRRX 4G95A 3FRAX 1DHJA 3JW3A 1RB2A 3M08A 3DGAA 2ZZAA 4IXGX 1JOLA 2LF1A 5HVBA 1RD7A 2KGKA 3FRFX 3DL6A 3RO9A 1PD9A 1RA1A 3IRMA 1IA3A 1RX5A 4P68A 3TQAA 3F8ZA 2W3WA 1DR6A 1M79A 1S3WA 4QLGA 4EIZA 3NXXA 3FQZA 3DG8A 1DR2A 1HFPA 3FS6A 4LEKX 4EILA 3NXVA 5CCCA 1MVSA 4ELEA 3NZCX 4QLEA 1CD2A 3QLXA 3E0BA 4PSTA 1E26A 3QG2A 4KYAA 3DATA 4M2XA 3QGTA 4EIGA 5E8QA 1DR5A 3NZ6X 1VJ3A 8DFRA 3FY9X 3EELA 4QJZD 4PSSA 3TQBA 3OCHA 3QLZA 4X5IA 3CD2A 3NRRA 3F0SX 2DRCA 2G6VA 2JYBA 4OR7A 3SRQX 5HSRA 1RX8A 4P3RA 4X5HA 4KY4A 1IA1A 1J3JA 2ITHA 1RX1A 4KM0A 2W3MA 3NXRA 1RG7A 1DG8A 3SH2A 3GYFA 1RX9A 3QLYA 3TD8A 2FZIA 4FHBA 3IX9A 3HJ3A 4LAGX 3K45A 1VDRA 4X5JA 4ELHA 4KBNA 3SRUX 4KM2A 1KMSA 4QJCA 1DISA 3DFRA 3DRCA 3RG9A 3JWKA 4KLXA 4XT4A 3ZPCA 5HQZA 3CL9A 5DXVA 3IA5A 3F8YA 1RX3A 3FYVX 4GH8A 5HPBA 2FZJA 4QHVA 4H96A 2QK8A 1LUDA 3HBBA 1DR7A 5HF2X 4H97A 5U26A 4DDRA 2ANOA 3L3RA 1DRAA 4XT5A 5HT4A 4EJ1A 5HVEA 3GI2A 2D0KA 2C2SA 4KAKA 2BLAA 4IXFX 4XRBA 3SQYX 1DDSA 3S3VA 3NXOA 3FYWX 3EX8A 3FQVA 4QLFA 3QLSA 1TDRA 1D1GA 5HF0X 5EAJA 1JOMA 4RGCA 2W9SA 4X5GA 4PTJA 3JTWA 1KMVA 1DYIA 4HOEA 4CD2A 3UM5A 4KL9A 4HA7A 2ANQA 3EEJA 3NU0A 3NZ9X 1IA2A 2W3BA 5U27A 1M78A 1DR3A 4KJKA 3INVA 3R33A 3S9UA 3NZBX 4H95A 2B3ZA 4QI9A 5HUIA 3KJRA 3QLRA 1RF7A 1DF7A 3NZDA 1U70A 4KJJA 2W9TA 1DREA 1J3KA 6DFRA 1DAJA 2XW7A 4XE6X 1PD8A 3FRDX 4TU5X 1HFQA 1ZDRA 1DRHA 4DP3A 3EEKA 3D84X 3FRBX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SAI A;  2CD2 A;  4ELF A;  3F91 A;  3KFY A;  1RA9 A;  1PDB A;  3FY8 X;  1DLR A;  2D5N A;  1LY3 A;  2GD9 A;  1S3Y A;  2HQP A;  3FRE X;  3JSU A;  3M09 A;  3SRW X;  4M7U A;  1BZF A;  3LG4 A;  4ELG A;  1JUV A;  3UM6 A;  3KY8 A;  4M6K A;  1DYJ A;  3OAF A;  2BL9 A;  3JWC A;  1YHO A;  1DLS A;  1LY4 A;  2O7P A;  4Q0D A;  3GHW A;  4I13 A;  1RA2 A;  4M6J A;  4ELB A;  1AO8 A;  1RC4 A;  1S3U A;  1DR1 A;  2INQ A;  4XEC X;  3TQ8 A;  2BLC A;  3DL5 A;  3IRO A;  1RB3 A;  4NX6 A;  3ROA A;  4KFJ A;  2W3A A;  1RA3 A;  1M7A A;  4P66 A;  4KNE A;  3SRS X;  1DYR A;  1DRB A;  5JA3 A;  1MVT A;  3TQ9 A;  1IA4 A;  1DYH A;  1RA8 A;  1BOZ A;  3JVX A;  4Q67 A;  4FGG A;  1RX4 A;  5CC9 A;  3K74 A;  3JWM A;  5HQY A;  3DAU A;  2OIP A;  4XT8 A;  2W9H A;  1CZ3 A;  1SEJ A;  4NX7 A;  3IA4 A;  2L28 A;  3JWF A;  1DDR A;  2HXV A;  5HSU A;  3F0U X;  4PSY A;  1DG7 A;  4XT7 A;  1J3I A;  1DHI A;  3K2H A;  2W3V A;  3NTZ A;  3QL3 A;  3UM8 A;  2P4G A;  3QFX A;  2AZN A;  3N0H A;  4X5F A;  1S3V A;  3IRN A;  5ECX A;  1RE7 A;  4DPD A;  4FGH A;  3KJS A;  4Q6A A;  3SGY A;  1DRF A;  1DG5 A;  3SA2 A;  4IXE D;  1OHJ A;  3FQO A;  3F0Q X;  2W9G A;  2FZH A;  3F0B X;  4KEB A;  2BLB A;  3QLW A;  3NXY A;  5DFR A;  1AI9 A;  5HT5 A;  3I8A X;  4G8Z X;  2H2Q A;  2C2T A;  5ECC A;  1U72 A;  4M7V A;  5JG0 X;  3FQF A;  4OSG A;  4M6L A;  1DIU A;  1AOE A;  3SA1 A;  3GHC A;  7DFR A;  4DPH A;  3Q1H A;  3ZPG A;  3K47 A;  4I1N A;  1RH3 A;  1DHF A;  3F0V X;  3FQC A;  3FL8 A;  1RX2 A;  2OBC A;  4H98 A;  1OHK A;  3FL9 A;  1U71 A;  3SR5 X;  3KGY A;  4LAE X;  3QYO A;  4LAH X;  2DHF A;  1HFR A;  4HOG A;  4HA9 A;  3NZA X;  4XT6 A;  3GHV A;  4KJL A;  4ECK A;  1RX7 A;  4Q0E A;  4KD7 A;  3CSE A;  3NXT A;  1RX6 A;  1DR4 A;  4G3M A;  3D80 A;  4DFR A;  3I3R A;  3VCO A;  3CLB A;  1KLK A;  1QZF A;  3S7A A;  5HI6 A;  4KY8 A;  3EEM A;  3QYL A;  4P3Q A;  2HM9 A;  3EIG A;  4HOF A;  3FQ0 A;  4PDJ A;  4PTH A;  3QL0 A;  5FDA A;  3F0X X;  2CIG A;  3JW5 A;  3SRR X;  4G95 A;  3FRA X;  1DHJ A;  3JW3 A;  1RB2 A;  3M08 A;  3DGA A;  2ZZA A;  4IXG X;  1JOL A;  2LF1 A;  5HVB A;  1RD7 A;  2KGK A;  3FRF X;  3DL6 A;  3RO9 A;  1PD9 A;  1RA1 A;  3IRM A;  1IA3 A;  1RX5 A;  4P68 A;  3TQA A;  3F8Z A;  2W3W A;  1DR6 A;  1M79 A;  1S3W A;  4QLG A;  4EIZ A;  3NXX A;  3FQZ A;  3DG8 A;  1DR2 A;  1HFP A;  3FS6 A;  4LEK X;  4EIL A;  3NXV A;  5CCC A;  1MVS A;  4ELE A;  3NZC X;  4QLE A;  1CD2 A;  3QLX A;  3E0B A;  4PST A;  1E26 A;  3QG2 A;  4KYA A;  3DAT A;  4M2X A;  3QGT A;  4EIG A;  5E8Q A;  1DR5 A;  3NZ6 X;  1VJ3 A;  8DFR A;  3FY9 X;  3EEL A;  4QJZ D;  4PSS A;  3TQB A;  3OCH A;  3QLZ A;  4X5I A;  3CD2 A;  3NRR A;  3F0S X;  2DRC A;  2G6V A;  2JYB A;  4OR7 A;  3SRQ X;  5HSR A;  1RX8 A;  4P3R A;  4X5H A;  4KY4 A;  1IA1 A;  1J3J A;  2ITH A;  1RX1 A;  4KM0 A;  2W3M A;  3NXR A;  1RG7 A;  1DG8 A;  3SH2 A;  3GYF A;  1RX9 A;  3QLY A;  3TD8 A;  2FZI A;  4FHB A;  3IX9 A;  3HJ3 A;  4LAG X;  3K45 A;  1VDR A;  4X5J A;  4ELH A;  4KBN A;  3SRU X;  4KM2 A;  1KMS A;  4QJC A;  1DIS A;  3DFR A;  3DRC A;  3RG9 A;  3JWK A;  4KLX A;  4XT4 A;  3ZPC A;  5HQZ A;  3CL9 A;  5DXV A;  3IA5 A;  3F8Y A;  1RX3 A;  3FYV X;  4GH8 A;  5HPB A;  2FZJ A;  4QHV A;  4H96 A;  2QK8 A;  1LUD A;  3HBB A;  1DR7 A;  5HF2 X;  4H97 A;  5U26 A;  4DDR A;  2ANO A;  3L3R A;  1DRA A;  4XT5 A;  5HT4 A;  4EJ1 A;  5HVE A;  3GI2 A;  2D0K A;  2C2S A;  4KAK A;  2BLA A;  4IXF X;  4XRB A;  3SQY X;  1DDS A;  3S3V A;  3NXO A;  3FYW X;  3EX8 A;  3FQV A;  4QLF A;  3QLS A;  1TDR A;  1D1G A;  5HF0 X;  5EAJ A;  1JOM A;  4RGC A;  2W9S A;  4X5G A;  4PTJ A;  3JTW A;  1KMV A;  1DYI A;  4HOE A;  4CD2 A;  3UM5 A;  4KL9 A;  4HA7 A;  2ANQ A;  3EEJ A;  3NU0 A;  3NZ9 X;  1IA2 A;  2W3B A;  5U27 A;  1M78 A;  1DR3 A;  4KJK A;  3INV A;  3R33 A;  3S9U A;  3NZB X;  4H95 A;  2B3Z A;  4QI9 A;  5HUI A;  3KJR A;  3QLR A;  1RF7 A;  1DF7 A;  3NZD A;  1U70 A;  4KJJ A;  2W9T A;  1DRE A;  1J3K A;  6DFR A;  1DAJ A;  2XW7 A;  4XE6 X;  1PD8 A;  3FRD X;  4TU5 X;  1HFQ A;  1ZDR A;  1DRH A;  4DP3 A;  3EEK A;  3D84 X;  3FRB X; 
#chains in the Genus database with same CATH topology
 3SAI A;  2CD2 A;  4ELF A;  3F91 A;  3KFY A;  1RA9 A;  1PDB A;  3FY8 X;  1DLR A;  2D5N A;  1LY3 A;  2GD9 A;  1S3Y A;  2HQP A;  3FRE X;  3JSU A;  3M09 A;  3SRW X;  4M7U A;  1BZF A;  3LG4 A;  4ELG A;  1JUV A;  3UM6 A;  3KY8 A;  4M6K A;  1DYJ A;  3OAF A;  2BL9 A;  3JWC A;  1YHO A;  1DLS A;  1LY4 A;  2O7P A;  4Q0D A;  3GHW A;  4I13 A;  1RA2 A;  4M6J A;  4ELB A;  1AO8 A;  1RC4 A;  1S3U A;  1DR1 A;  2INQ A;  4XEC X;  3TQ8 A;  2BLC A;  3DL5 A;  3IRO A;  1RB3 A;  4NX6 A;  3ROA A;  4KFJ A;  2W3A A;  1RA3 A;  1M7A A;  4P66 A;  4KNE A;  3SRS X;  1DYR A;  1DRB A;  5JA3 A;  1MVT A;  3TQ9 A;  1IA4 A;  1DYH A;  1RA8 A;  1BOZ A;  3JVX A;  4Q67 A;  4FGG A;  1RX4 A;  5CC9 A;  3K74 A;  3JWM A;  5HQY A;  3DAU A;  2OIP A;  4XT8 A;  2W9H A;  1CZ3 A;  1SEJ A;  4NX7 A;  3IA4 A;  2L28 A;  3JWF A;  1DDR A;  2HXV A;  5HSU A;  3F0U X;  4PSY A;  1DG7 A;  4XT7 A;  1J3I A;  1DHI A;  3K2H A;  2W3V A;  3NTZ A;  3QL3 A;  3UM8 A;  2P4G A;  3QFX A;  2AZN A;  3N0H A;  4X5F A;  1S3V A;  3IRN A;  5ECX A;  1RE7 A;  4DPD A;  4FGH A;  3KJS A;  4Q6A A;  3SGY A;  1DRF A;  1DG5 A;  3SA2 A;  4IXE D;  1OHJ A;  3FQO A;  3F0Q X;  2W9G A;  2FZH A;  3F0B X;  4KEB A;  2BLB A;  3QLW A;  3NXY A;  5DFR A;  1AI9 A;  5HT5 A;  3I8A X;  4G8Z X;  2H2Q A;  2C2T A;  5ECC A;  1U72 A;  4M7V A;  5JG0 X;  3FQF A;  4OSG A;  4M6L A;  1DIU A;  1AOE A;  3SA1 A;  3GHC A;  7DFR A;  4DPH A;  3Q1H A;  3ZPG A;  3K47 A;  4I1N A;  1RH3 A;  1DHF A;  3F0V X;  3FQC A;  3FL8 A;  1RX2 A;  2OBC A;  4H98 A;  1OHK A;  3FL9 A;  1U71 A;  3SR5 X;  3KGY A;  4LAE X;  3QYO A;  4LAH X;  2DHF A;  1HFR A;  4HOG A;  4HA9 A;  3NZA X;  4XT6 A;  3GHV A;  4KJL A;  4ECK A;  1RX7 A;  4Q0E A;  4KD7 A;  3CSE A;  3NXT A;  1RX6 A;  1DR4 A;  4G3M A;  3D80 A;  4DFR A;  3I3R A;  3VCO A;  3CLB A;  1KLK A;  1QZF A;  3S7A A;  5HI6 A;  4KY8 A;  3EEM A;  3QYL A;  4P3Q A;  2HM9 A;  3EIG A;  4HOF A;  3FQ0 A;  4PDJ A;  4PTH A;  3QL0 A;  5FDA A;  3F0X X;  2CIG A;  3JW5 A;  3SRR X;  4G95 A;  3FRA X;  1DHJ A;  3JW3 A;  1RB2 A;  3M08 A;  3DGA A;  2ZZA A;  4IXG X;  1JOL A;  2LF1 A;  5HVB A;  1RD7 A;  2KGK A;  3FRF X;  3DL6 A;  3RO9 A;  1PD9 A;  1RA1 A;  3IRM A;  1IA3 A;  1RX5 A;  4P68 A;  3TQA A;  3F8Z A;  2W3W A;  1DR6 A;  1M79 A;  1S3W A;  4QLG A;  4EIZ A;  3NXX A;  3FQZ A;  3DG8 A;  1DR2 A;  1HFP A;  3FS6 A;  4LEK X;  4EIL A;  3NXV A;  5CCC A;  1MVS A;  4ELE A;  3NZC X;  4QLE A;  1CD2 A;  3QLX A;  3E0B A;  4PST A;  1E26 A;  3QG2 A;  4KYA A;  3DAT A;  4M2X A;  3QGT A;  4EIG A;  5E8Q A;  1DR5 A;  3NZ6 X;  1VJ3 A;  8DFR A;  3FY9 X;  3EEL A;  4QJZ D;  4PSS A;  3TQB A;  3OCH A;  3QLZ A;  4X5I A;  3CD2 A;  3NRR A;  3F0S X;  2DRC A;  2G6V A;  2JYB A;  4OR7 A;  3SRQ X;  5HSR A;  1RX8 A;  4P3R A;  4X5H A;  4KY4 A;  1IA1 A;  1J3J A;  2ITH A;  1RX1 A;  4KM0 A;  2W3M A;  3NXR A;  1RG7 A;  1DG8 A;  3SH2 A;  3GYF A;  1RX9 A;  3QLY A;  3TD8 A;  2FZI A;  4FHB A;  3IX9 A;  3HJ3 A;  4LAG X;  3K45 A;  1VDR A;  4X5J A;  4ELH A;  4KBN A;  3SRU X;  4KM2 A;  1KMS A;  4QJC A;  1DIS A;  3DFR A;  3DRC A;  3RG9 A;  3JWK A;  4KLX A;  4XT4 A;  3ZPC A;  5HQZ A;  3CL9 A;  5DXV A;  3IA5 A;  3F8Y A;  1RX3 A;  3FYV X;  4GH8 A;  5HPB A;  2FZJ A;  4QHV A;  4H96 A;  2QK8 A;  1LUD A;  3HBB A;  1DR7 A;  5HF2 X;  4H97 A;  5U26 A;  4DDR A;  2ANO A;  3L3R A;  1DRA A;  4XT5 A;  5HT4 A;  4EJ1 A;  5HVE A;  3GI2 A;  2D0K A;  2C2S A;  4KAK A;  2BLA A;  4IXF X;  4XRB A;  3SQY X;  1DDS A;  3S3V A;  3NXO A;  3FYW X;  3EX8 A;  3FQV A;  4QLF A;  3QLS A;  1TDR A;  1D1G A;  5HF0 X;  5EAJ A;  1JOM A;  4RGC A;  2W9S A;  4X5G A;  4PTJ A;  3JTW A;  1KMV A;  1DYI A;  4HOE A;  4CD2 A;  3UM5 A;  4KL9 A;  4HA7 A;  2ANQ A;  3EEJ A;  3NU0 A;  3NZ9 X;  1IA2 A;  2W3B A;  5U27 A;  1M78 A;  1DR3 A;  4KJK A;  3INV A;  3R33 A;  3S9U A;  3NZB X;  4H95 A;  2B3Z A;  4QI9 A;  5HUI A;  3KJR A;  3QLR A;  1RF7 A;  1DF7 A;  3NZD A;  1U70 A;  4KJJ A;  2W9T A;  1DRE A;  1J3K A;  6DFR A;  1DAJ A;  2XW7 A;  4XE6 X;  1PD8 A;  3FRD X;  4TU5 X;  1HFQ A;  1ZDR A;  1DRH A;  4DP3 A;  3EEK A;  3D84 X;  3FRB X; 
#chains in the Genus database with same CATH homology
 3SAI A;  2CD2 A;  4ELF A;  3F91 A;  3KFY A;  1RA9 A;  1PDB A;  3FY8 X;  1DLR A;  2D5N A;  1LY3 A;  2GD9 A;  1S3Y A;  2HQP A;  3FRE X;  3JSU A;  3M09 A;  3SRW X;  4M7U A;  1BZF A;  3LG4 A;  4ELG A;  1JUV A;  3UM6 A;  3KY8 A;  4M6K A;  1DYJ A;  3OAF A;  2BL9 A;  3JWC A;  1YHO A;  1DLS A;  1LY4 A;  2O7P A;  4Q0D A;  3GHW A;  4I13 A;  1RA2 A;  4M6J A;  4ELB A;  1AO8 A;  1RC4 A;  1S3U A;  1DR1 A;  2INQ A;  4XEC X;  3TQ8 A;  2BLC A;  3DL5 A;  3IRO A;  1RB3 A;  4NX6 A;  3ROA A;  4KFJ A;  2W3A A;  1RA3 A;  1M7A A;  4P66 A;  4KNE A;  3SRS X;  1DYR A;  1DRB A;  5JA3 A;  1MVT A;  3TQ9 A;  1IA4 A;  1DYH A;  1RA8 A;  1BOZ A;  3JVX A;  4Q67 A;  4FGG A;  1RX4 A;  5CC9 A;  3K74 A;  3JWM A;  5HQY A;  3DAU A;  2OIP A;  4XT8 A;  2W9H A;  1CZ3 A;  1SEJ A;  4NX7 A;  3IA4 A;  2L28 A;  3JWF A;  1DDR A;  2HXV A;  5HSU A;  3F0U X;  4PSY A;  1DG7 A;  4XT7 A;  1J3I A;  1DHI A;  3K2H A;  2W3V A;  3NTZ A;  3QL3 A;  3UM8 A;  2P4G A;  3QFX A;  2AZN A;  3N0H A;  4X5F A;  1S3V A;  3IRN A;  5ECX A;  1RE7 A;  4DPD A;  4FGH A;  3KJS A;  4Q6A A;  3SGY A;  1DRF A;  1DG5 A;  3SA2 A;  4IXE D;  1OHJ A;  3FQO A;  3F0Q X;  2W9G A;  2FZH A;  3F0B X;  4KEB A;  2BLB A;  3QLW A;  3NXY A;  5DFR A;  1AI9 A;  5HT5 A;  3I8A X;  4G8Z X;  2H2Q A;  2C2T A;  5ECC A;  1U72 A;  4M7V A;  5JG0 X;  3FQF A;  4OSG A;  4M6L A;  1DIU A;  1AOE A;  3SA1 A;  3GHC A;  7DFR A;  4DPH A;  3Q1H A;  3ZPG A;  3K47 A;  4I1N A;  1RH3 A;  1DHF A;  3F0V X;  3FQC A;  3FL8 A;  1RX2 A;  2OBC A;  4H98 A;  1OHK A;  3FL9 A;  1U71 A;  3SR5 X;  3KGY A;  4LAE X;  3QYO A;  4LAH X;  2DHF A;  1HFR A;  4HOG A;  4HA9 A;  3NZA X;  4XT6 A;  3GHV A;  4KJL A;  4ECK A;  1RX7 A;  4Q0E A;  4KD7 A;  3CSE A;  3NXT A;  1RX6 A;  1DR4 A;  4G3M A;  3D80 A;  4DFR A;  3I3R A;  3VCO A;  3CLB A;  1KLK A;  1QZF A;  3S7A A;  5HI6 A;  4KY8 A;  3EEM A;  3QYL A;  4P3Q A;  2HM9 A;  3EIG A;  4HOF A;  3FQ0 A;  4PDJ A;  4PTH A;  3QL0 A;  5FDA A;  3F0X X;  2CIG A;  3JW5 A;  3SRR X;  4G95 A;  3FRA X;  1DHJ A;  3JW3 A;  1RB2 A;  3M08 A;  3DGA A;  2ZZA A;  4IXG X;  1JOL A;  2LF1 A;  5HVB A;  1RD7 A;  2KGK A;  3FRF X;  3DL6 A;  3RO9 A;  1PD9 A;  1RA1 A;  3IRM A;  1IA3 A;  1RX5 A;  4P68 A;  3TQA A;  3F8Z A;  2W3W A;  1DR6 A;  1M79 A;  1S3W A;  4QLG A;  4EIZ A;  3NXX A;  3FQZ A;  3DG8 A;  1DR2 A;  1HFP A;  3FS6 A;  4LEK X;  4EIL A;  3NXV A;  5CCC A;  1MVS A;  4ELE A;  3NZC X;  4QLE A;  1CD2 A;  3QLX A;  3E0B A;  4PST A;  1E26 A;  3QG2 A;  4KYA A;  3DAT A;  4M2X A;  3QGT A;  4EIG A;  5E8Q A;  1DR5 A;  3NZ6 X;  1VJ3 A;  8DFR A;  3FY9 X;  3EEL A;  4QJZ D;  4PSS A;  3TQB A;  3OCH A;  3QLZ A;  4X5I A;  3CD2 A;  3NRR A;  3F0S X;  2DRC A;  2G6V A;  2JYB A;  4OR7 A;  3SRQ X;  5HSR A;  1RX8 A;  4P3R A;  4X5H A;  4KY4 A;  1IA1 A;  1J3J A;  2ITH A;  1RX1 A;  4KM0 A;  2W3M A;  3NXR A;  1RG7 A;  1DG8 A;  3SH2 A;  3GYF A;  1RX9 A;  3QLY A;  3TD8 A;  2FZI A;  4FHB A;  3IX9 A;  3HJ3 A;  4LAG X;  3K45 A;  1VDR A;  4X5J A;  4ELH A;  4KBN A;  3SRU X;  4KM2 A;  1KMS A;  4QJC A;  1DIS A;  3DFR A;  3DRC A;  3RG9 A;  3JWK A;  4KLX A;  4XT4 A;  3ZPC A;  5HQZ A;  3CL9 A;  5DXV A;  3IA5 A;  3F8Y A;  1RX3 A;  3FYV X;  4GH8 A;  5HPB A;  2FZJ A;  4QHV A;  4H96 A;  2QK8 A;  1LUD A;  3HBB A;  1DR7 A;  5HF2 X;  4H97 A;  5U26 A;  4DDR A;  2ANO A;  3L3R A;  1DRA A;  4XT5 A;  5HT4 A;  4EJ1 A;  5HVE A;  3GI2 A;  2D0K A;  2C2S A;  4KAK A;  2BLA A;  4IXF X;  4XRB A;  3SQY X;  1DDS A;  3S3V A;  3NXO A;  3FYW X;  3EX8 A;  3FQV A;  4QLF A;  3QLS A;  1TDR A;  1D1G A;  5HF0 X;  5EAJ A;  1JOM A;  4RGC A;  2W9S A;  4X5G A;  4PTJ A;  3JTW A;  1KMV A;  1DYI A;  4HOE A;  4CD2 A;  3UM5 A;  4KL9 A;  4HA7 A;  2ANQ A;  3EEJ A;  3NU0 A;  3NZ9 X;  1IA2 A;  2W3B A;  5U27 A;  1M78 A;  1DR3 A;  4KJK A;  3INV A;  3R33 A;  3S9U A;  3NZB X;  4H95 A;  2B3Z A;  4QI9 A;  5HUI A;  3KJR A;  3QLR A;  1RF7 A;  1DF7 A;  3NZD A;  1U70 A;  4KJJ A;  2W9T A;  1DRE A;  1J3K A;  6DFR A;  1DAJ A;  2XW7 A;  4XE6 X;  1PD8 A;  3FRD X;  4TU5 X;  1HFQ A;  1ZDR A;  1DRH A;  4DP3 A;  3EEK A;  3D84 X;  3FRB X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...