4ELGA

Structure-activity relationship guides enantiomeric preference among potent inhibitors of b. anthracis dihydrofolate reductase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
166
structure length
166
Chain Sequence
MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-activity relationship for enantiomers of potent inhibitors of B. anthracis dihydrofolate reductase.
pubmed doi rcsb
molecule keywords Dihydrofolate reductase
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Bacillus anthracis
total genus 40
structure length 166
sequence length 166
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2012-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 4elgA00
2BLAA 3JWFA 4Q0DA 3FL9A 1SEJA 2B3ZA 3EIGA 3FQCA 5U26A 3SAIA 4DDRA 1AOEA 1U72A 3SA2A 4QJZD 1DYJA 3ROAA 1JUVA 1RX2A 3QYLA 5HF2X 3JW5A 1PD9A 2AZNA 2FZJA 2BL9A 3FQZA 3FRFX 3ZPGA 1DR2A 3GI2A 3K47A 3F0XX 1IA4A 1RA2A 1RX7A 1BOZA 1DRFA 3K74A 4NX7A 4KAKA 1RC4A 1M7AA 4HOFA 3FQFA 4NX6A 5U27A 3INVA 4M7UA 3Q1HA 2ANQA 3KJSA 4Q0EA 1DG5A 4IXED 5JG0X 1KLKA 3DGAA 3FQVA 4KM2A 4LEKX 4IXGX 3NRRA 3FYWX 3L3RA 1DHFA 4PTHA 3KY8A 3FQOA 4M6KA 3IX9A 3DL6A 1PD8A 5JA3A 4H96A 4KJKA 2HQPA 3NXOA 3QLSA 1DRBA 2W3VA 3CD2A 4P3RA 4Q6AA 2G6VA 2W3WA 4KLXA 3EEMA 2FZHA 4XE6X 1DHIA 4HOEA 3ZPCA 1DDRA 4PDJA 1DAJA 2HXVA 1RX6A 4ELGA 1DRHA 4DPHA 5HQZA 1RX1A 4QJCA 4TU5X 3IROA 4KD7A 3NXYA 4EIZA 3QLZA 4LAHX 3F91A 1KMSA 3M08A 3SR5X 1KMVA 1LY3A 4X5IA 4ECKA 3SRQX 1RX3A 1HFPA 2D5NA 3HBBA 1DYIA 4H98A 3TD8A 5EAJA 3F8YA 1LY4A 1E26A 5HSRA 5HVBA 3D80A 1DLRA 1DF7A 4QHVA 2BLCA 1RA8A 3FYVX 3JWKA 3F0SX 5DXVA 2DRCA 3QYOA 4EIGA 3E0BA 5CC9A 4LAEX 1DYRA 5E8QA 4OR7A 1RX9A 3EEKA 4KY4A 1RX5A 3OAFA 4KFJA 3QGTA 3TQAA 5DFRA 4X5HA 3EEJA 3NZ6X 1IA3A 4KEBA 4PTJA 5ECXA 3S7AA 1D1GA 3FRDX 3FY9X 5HUIA 2W9GA 2FZIA 3F0QX 4QLGA 1LUDA 2H2QA 4GH8A 4XT8A 1S3VA 4EILA 3JW3A 1CD2A 1RD7A 2LF1A 3DFRA 1U70A 2ANOA 3QLWA 4P68A 2W3AA 3SQYX 3NZDA 1MVTA 4ELEA 4EJ1A 3IA5A 2XW7A 4QLFA 3FQ0A 1TDRA 1DR7A 4G95A 5HSUA 1AO8A 3KFYA 4OSGA 3CL9A 4PSTA 3JVXA 4XT4A 1S3YA 3QL3A 3D84X 1DR3A 3DRCA 3IRMA 2W9TA 2BLBA 4KM0A 3DL5A 4FGHA 3JTWA 3UM6A 1IA1A 2D0KA 1RH3A 2W3MA 1OHJA 3SA1A 5FDAA 4LAGX 3I3RA 2L28A 4KNEA 1DYHA 3F0VX 2KGKA 4G8ZX 2C2TA 3GYFA 3F0UX 3S9UA 3QLRA 5HQYA 2CIGA 3NXTA 4M6JA 4KL9A 4M6LA 1DHJA 2DHFA 1ZDRA 3SRWX 5HT5A 2W9SA 2ITHA 1DR4A 1VDRA 3IA4A 1RG7A 1DRAA 3NZCX 1MVSA 1J3IA 2HM9A 4FHBA 4KY8A 4HOGA 4ELHA 3QFXA 5HT4A 4IXFX 3FY8X 1J3JA 4PSYA 4H95A 3SGYA 3IRNA 3CLBA 3KGYA 4DPDA 1OHKA 4XT7A 1DG7A 3FRAX 1DISA 4X5JA 2QK8A 5HPBA 3KJRA 3DG8A 1YHOA 3GHWA 3K2HA 4HA9A 2GD9A 1RX8A 4RGCA 4KYAA 2OBCA 1JOMA 1S3WA 4M7VA 3HJ3A 3NXVA 5HI6A 3CSEA 3K45A 3GHVA 2P4GA 4KBNA 3FL8A 4XT6A 6DFRA 3RO9A 2ZZAA 1DIUA 3QLYA 1HFQA 4X5FA 3UM5A 4ELBA 4ELFA 1M78A 4CD2A 1RA9A 1RB2A 1DLSA 4PSSA 3SRRX 3N0HA 3SH2A 4QLEA 4KJJA 4XT5A 3JWCA 2OIPA 4XECX 4I1NA 3TQ8A 3UM8A 3SRSX 5CCCA 4FGGA 4X5GA 1U71A 3NXRA 4P66A 1J3KA 4QI9A 3VCOA 4Q67A 3QL0A 4M2XA 4DFRA 3QG2A 4I13A 2W3BA 3M09A 1S3UA 3FREX 4H97A 5ECCA 3NZ9X 5HVEA 2O7PA 1AI9A 4HA7A 1M79A 1RB3A 3NZBX 3RG9A 2CD2A 3NZAX 8DFRA 3DAUA 3S3VA 1RE7A 3I8AX 1PDBA 3F0BX 3QLXA 1IA2A 1RA1A 2C2SA 3JWMA 3NXXA 1DG8A 1BZFA 4DP3A 1DR6A 4KJLA 3R33A 3NTZA 3JSUA 2INQA 4XRBA 3F8ZA 3OCHA 5HF0X 3SRUX 3LG4A 3DATA 1RX4A 1CZ3A 1RA3A 1JOLA 1HFRA 4P3QA 3FS6A 3NU0A 3EELA 3TQBA 2JYBA 1DR5A 2W9HA 3GHCA 1QZFA 1VJ3A 7DFRA 1DDSA 3EX8A 1DR1A 3FRBX 3TQ9A 1RF7A 4G3MA 1DREA
chains in the Genus database with same CATH superfamily
2BLAA 3JWFA 4Q0DA 3FL9A 1SEJA 2B3ZA 3EIGA 3FQCA 5U26A 3SAIA 4DDRA 1AOEA 1U72A 3SA2A 4QJZD 1DYJA 3ROAA 1JUVA 1RX2A 3QYLA 5HF2X 3JW5A 1PD9A 2AZNA 2FZJA 2BL9A 3FQZA 3FRFX 3ZPGA 1DR2A 3GI2A 3K47A 3F0XX 1IA4A 1RA2A 1RX7A 1BOZA 1DRFA 3K74A 4NX7A 4KAKA 1RC4A 1M7AA 4HOFA 3FQFA 4NX6A 5U27A 3INVA 4M7UA 3Q1HA 2ANQA 3KJSA 4Q0EA 1DG5A 4IXED 5JG0X 1KLKA 3DGAA 3FQVA 4KM2A 4LEKX 4IXGX 3NRRA 3FYWX 3L3RA 1DHFA 4PTHA 3KY8A 3FQOA 4M6KA 3IX9A 3DL6A 1PD8A 5JA3A 4H96A 4KJKA 2HQPA 3NXOA 3QLSA 1DRBA 2W3VA 3CD2A 4P3RA 4Q6AA 2G6VA 2W3WA 4KLXA 3EEMA 2FZHA 4XE6X 1DHIA 4HOEA 3ZPCA 1DDRA 4PDJA 1DAJA 2HXVA 1RX6A 4ELGA 1DRHA 4DPHA 5HQZA 1RX1A 4QJCA 4TU5X 3IROA 4KD7A 3NXYA 4EIZA 3QLZA 4LAHX 3F91A 1KMSA 3M08A 3SR5X 1KMVA 1LY3A 4X5IA 4ECKA 3SRQX 1RX3A 1HFPA 2D5NA 3HBBA 1DYIA 4H98A 3TD8A 5EAJA 3F8YA 1LY4A 1E26A 5HSRA 5HVBA 3D80A 1DLRA 1DF7A 4QHVA 2BLCA 1RA8A 3FYVX 3JWKA 3F0SX 5DXVA 2DRCA 3QYOA 4EIGA 3E0BA 5CC9A 4LAEX 1DYRA 5E8QA 4OR7A 1RX9A 3EEKA 4KY4A 1RX5A 3OAFA 4KFJA 3QGTA 3TQAA 5DFRA 4X5HA 3EEJA 3NZ6X 1IA3A 4KEBA 4PTJA 5ECXA 3S7AA 1D1GA 3FRDX 3FY9X 5HUIA 2W9GA 2FZIA 3F0QX 4QLGA 1LUDA 2H2QA 4GH8A 4XT8A 1S3VA 4EILA 3JW3A 1CD2A 1RD7A 2LF1A 3DFRA 1U70A 2ANOA 3QLWA 4P68A 2W3AA 3SQYX 3NZDA 1MVTA 4ELEA 4EJ1A 3IA5A 2XW7A 4QLFA 3FQ0A 1TDRA 1DR7A 4G95A 5HSUA 1AO8A 3KFYA 4OSGA 3CL9A 4PSTA 3JVXA 4XT4A 1S3YA 3QL3A 3D84X 1DR3A 3DRCA 3IRMA 2W9TA 2BLBA 4KM0A 3DL5A 4FGHA 3JTWA 3UM6A 1IA1A 2D0KA 1RH3A 2W3MA 1OHJA 3SA1A 5FDAA 4LAGX 3I3RA 2L28A 4KNEA 1DYHA 3F0VX 2KGKA 4G8ZX 2C2TA 3GYFA 3F0UX 3S9UA 3QLRA 5HQYA 2CIGA 3NXTA 4M6JA 4KL9A 4M6LA 1DHJA 2DHFA 1ZDRA 3SRWX 5HT5A 2W9SA 2ITHA 1DR4A 1VDRA 3IA4A 1RG7A 1DRAA 3NZCX 1MVSA 1J3IA 2HM9A 4FHBA 4KY8A 4HOGA 4ELHA 3QFXA 5HT4A 4IXFX 3FY8X 1J3JA 4PSYA 4H95A 3SGYA 3IRNA 3CLBA 3KGYA 4DPDA 1OHKA 4XT7A 1DG7A 3FRAX 1DISA 4X5JA 2QK8A 5HPBA 3KJRA 3DG8A 1YHOA 3GHWA 3K2HA 4HA9A 2GD9A 1RX8A 4RGCA 4KYAA 2OBCA 1JOMA 1S3WA 4M7VA 3HJ3A 3NXVA 5HI6A 3CSEA 3K45A 3GHVA 2P4GA 4KBNA 3FL8A 4XT6A 6DFRA 3RO9A 2ZZAA 1DIUA 3QLYA 1HFQA 4X5FA 3UM5A 4ELBA 4ELFA 1M78A 4CD2A 1RA9A 1RB2A 1DLSA 4PSSA 3SRRX 3N0HA 3SH2A 4QLEA 4KJJA 4XT5A 3JWCA 2OIPA 4XECX 4I1NA 3TQ8A 3UM8A 3SRSX 5CCCA 4FGGA 4X5GA 1U71A 3NXRA 4P66A 1J3KA 4QI9A 3VCOA 4Q67A 3QL0A 4M2XA 4DFRA 3QG2A 4I13A 2W3BA 3M09A 1S3UA 3FREX 4H97A 5ECCA 3NZ9X 5HVEA 2O7PA 1AI9A 4HA7A 1M79A 1RB3A 3NZBX 3RG9A 2CD2A 3NZAX 8DFRA 3DAUA 3S3VA 1RE7A 3I8AX 1PDBA 3F0BX 3QLXA 1IA2A 1RA1A 2C2SA 3JWMA 3NXXA 1DG8A 1BZFA 4DP3A 1DR6A 4KJLA 3R33A 3NTZA 3JSUA 2INQA 4XRBA 3F8ZA 3OCHA 5HF0X 3SRUX 3LG4A 3DATA 1RX4A 1CZ3A 1RA3A 1JOLA 1HFRA 4P3QA 3FS6A 3NU0A 3EELA 3TQBA 2JYBA 1DR5A 2W9HA 3GHCA 1QZFA 1VJ3A 7DFRA 1DDSA 3EX8A 1DR1A 3FRBX 3TQ9A 1RF7A 4G3MA 1DREA
chains in the Genus database with same CATH topology
2BLAA 3JWFA 4Q0DA 3FL9A 1SEJA 2B3ZA 3EIGA 3FQCA 5U26A 3SAIA 4DDRA 1AOEA 1U72A 3SA2A 4QJZD 1DYJA 3ROAA 1JUVA 1RX2A 3QYLA 5HF2X 3JW5A 1PD9A 2AZNA 2FZJA 2BL9A 3FQZA 3FRFX 3ZPGA 1DR2A 3GI2A 3K47A 3F0XX 1IA4A 1RA2A 1RX7A 1BOZA 1DRFA 3K74A 4NX7A 4KAKA 1RC4A 1M7AA 4HOFA 3FQFA 4NX6A 5U27A 3INVA 4M7UA 3Q1HA 2ANQA 3KJSA 4Q0EA 1DG5A 4IXED 5JG0X 1KLKA 3DGAA 3FQVA 4KM2A 4LEKX 4IXGX 3NRRA 3FYWX 3L3RA 1DHFA 4PTHA 3KY8A 3FQOA 4M6KA 3IX9A 3DL6A 1PD8A 5JA3A 4H96A 4KJKA 2HQPA 3NXOA 3QLSA 1DRBA 2W3VA 3CD2A 4P3RA 4Q6AA 2G6VA 2W3WA 4KLXA 3EEMA 2FZHA 4XE6X 1DHIA 4HOEA 3ZPCA 1DDRA 4PDJA 1DAJA 2HXVA 1RX6A 4ELGA 1DRHA 4DPHA 5HQZA 1RX1A 4QJCA 4TU5X 3IROA 4KD7A 3NXYA 4EIZA 3QLZA 4LAHX 3F91A 1KMSA 3M08A 3SR5X 1KMVA 1LY3A 4X5IA 4ECKA 3SRQX 1RX3A 1HFPA 2D5NA 3HBBA 1DYIA 4H98A 3TD8A 5EAJA 3F8YA 1LY4A 1E26A 5HSRA 5HVBA 3D80A 1DLRA 1DF7A 4QHVA 2BLCA 1RA8A 3FYVX 3JWKA 3F0SX 5DXVA 2DRCA 3QYOA 4EIGA 3E0BA 5CC9A 4LAEX 1DYRA 5E8QA 4OR7A 1RX9A 3EEKA 4KY4A 1RX5A 3OAFA 4KFJA 3QGTA 3TQAA 5DFRA 4X5HA 3EEJA 3NZ6X 1IA3A 4KEBA 4PTJA 5ECXA 3S7AA 1D1GA 3FRDX 3FY9X 5HUIA 2W9GA 2FZIA 3F0QX 4QLGA 1LUDA 2H2QA 4GH8A 4XT8A 1S3VA 4EILA 3JW3A 1CD2A 1RD7A 2LF1A 3DFRA 1U70A 2ANOA 3QLWA 4P68A 2W3AA 3SQYX 3NZDA 1MVTA 4ELEA 4EJ1A 3IA5A 2XW7A 4QLFA 3FQ0A 1TDRA 1DR7A 4G95A 5HSUA 1AO8A 3KFYA 4OSGA 3CL9A 4PSTA 3JVXA 4XT4A 1S3YA 3QL3A 3D84X 1DR3A 3DRCA 3IRMA 2W9TA 2BLBA 4KM0A 3DL5A 4FGHA 3JTWA 3UM6A 1IA1A 2D0KA 1RH3A 2W3MA 1OHJA 3SA1A 5FDAA 4LAGX 3I3RA 2L28A 4KNEA 1DYHA 3F0VX 2KGKA 4G8ZX 2C2TA 3GYFA 3F0UX 3S9UA 3QLRA 5HQYA 2CIGA 3NXTA 4M6JA 4KL9A 4M6LA 1DHJA 2DHFA 1ZDRA 3SRWX 5HT5A 2W9SA 2ITHA 1DR4A 1VDRA 3IA4A 1RG7A 1DRAA 3NZCX 1MVSA 1J3IA 2HM9A 4FHBA 4KY8A 4HOGA 4ELHA 3QFXA 5HT4A 4IXFX 3FY8X 1J3JA 4PSYA 4H95A 3SGYA 3IRNA 3CLBA 3KGYA 4DPDA 1OHKA 4XT7A 1DG7A 3FRAX 1DISA 4X5JA 2QK8A 5HPBA 3KJRA 3DG8A 1YHOA 3GHWA 3K2HA 4HA9A 2GD9A 1RX8A 4RGCA 4KYAA 2OBCA 1JOMA 1S3WA 4M7VA 3HJ3A 3NXVA 5HI6A 3CSEA 3K45A 3GHVA 2P4GA 4KBNA 3FL8A 4XT6A 6DFRA 3RO9A 2ZZAA 1DIUA 3QLYA 1HFQA 4X5FA 3UM5A 4ELBA 4ELFA 1M78A 4CD2A 1RA9A 1RB2A 1DLSA 4PSSA 3SRRX 3N0HA 3SH2A 4QLEA 4KJJA 4XT5A 3JWCA 2OIPA 4XECX 4I1NA 3TQ8A 3UM8A 3SRSX 5CCCA 4FGGA 4X5GA 1U71A 3NXRA 4P66A 1J3KA 4QI9A 3VCOA 4Q67A 3QL0A 4M2XA 4DFRA 3QG2A 4I13A 2W3BA 3M09A 1S3UA 3FREX 4H97A 5ECCA 3NZ9X 5HVEA 2O7PA 1AI9A 4HA7A 1M79A 1RB3A 3NZBX 3RG9A 2CD2A 3NZAX 8DFRA 3DAUA 3S3VA 1RE7A 3I8AX 1PDBA 3F0BX 3QLXA 1IA2A 1RA1A 2C2SA 3JWMA 3NXXA 1DG8A 1BZFA 4DP3A 1DR6A 4KJLA 3R33A 3NTZA 3JSUA 2INQA 4XRBA 3F8ZA 3OCHA 5HF0X 3SRUX 3LG4A 3DATA 1RX4A 1CZ3A 1RA3A 1JOLA 1HFRA 4P3QA 3FS6A 3NU0A 3EELA 3TQBA 2JYBA 1DR5A 2W9HA 3GHCA 1QZFA 1VJ3A 7DFRA 1DDSA 3EX8A 1DR1A 3FRBX 3TQ9A 1RF7A 4G3MA 1DREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BLA A;  3JWF A;  4Q0D A;  3FL9 A;  1SEJ A;  2B3Z A;  3EIG A;  3FQC A;  5U26 A;  3SAI A;  4DDR A;  1AOE A;  1U72 A;  3SA2 A;  4QJZ D;  1DYJ A;  3ROA A;  1JUV A;  1RX2 A;  3QYL A;  5HF2 X;  3JW5 A;  1PD9 A;  2AZN A;  2FZJ A;  2BL9 A;  3FQZ A;  3FRF X;  3ZPG A;  1DR2 A;  3GI2 A;  3K47 A;  3F0X X;  1IA4 A;  1RA2 A;  1RX7 A;  1BOZ A;  1DRF A;  3K74 A;  4NX7 A;  4KAK A;  1RC4 A;  1M7A A;  4HOF A;  3FQF A;  4NX6 A;  5U27 A;  3INV A;  4M7U A;  3Q1H A;  2ANQ A;  3KJS A;  4Q0E A;  1DG5 A;  4IXE D;  5JG0 X;  1KLK A;  3DGA A;  3FQV A;  4KM2 A;  4LEK X;  4IXG X;  3NRR A;  3FYW X;  3L3R A;  1DHF A;  4PTH A;  3KY8 A;  3FQO A;  4M6K A;  3IX9 A;  3DL6 A;  1PD8 A;  5JA3 A;  4H96 A;  4KJK A;  2HQP A;  3NXO A;  3QLS A;  1DRB A;  2W3V A;  3CD2 A;  4P3R A;  4Q6A A;  2G6V A;  2W3W A;  4KLX A;  3EEM A;  2FZH A;  4XE6 X;  1DHI A;  4HOE A;  3ZPC A;  1DDR A;  4PDJ A;  1DAJ A;  2HXV A;  1RX6 A;  4ELG A;  1DRH A;  4DPH A;  5HQZ A;  1RX1 A;  4QJC A;  4TU5 X;  3IRO A;  4KD7 A;  3NXY A;  4EIZ A;  3QLZ A;  4LAH X;  3F91 A;  1KMS A;  3M08 A;  3SR5 X;  1KMV A;  1LY3 A;  4X5I A;  4ECK A;  3SRQ X;  1RX3 A;  1HFP A;  2D5N A;  3HBB A;  1DYI A;  4H98 A;  3TD8 A;  5EAJ A;  3F8Y A;  1LY4 A;  1E26 A;  5HSR A;  5HVB A;  3D80 A;  1DLR A;  1DF7 A;  4QHV A;  2BLC A;  1RA8 A;  3FYV X;  3JWK A;  3F0S X;  5DXV A;  2DRC A;  3QYO A;  4EIG A;  3E0B A;  5CC9 A;  4LAE X;  1DYR A;  5E8Q A;  4OR7 A;  1RX9 A;  3EEK A;  4KY4 A;  1RX5 A;  3OAF A;  4KFJ A;  3QGT A;  3TQA A;  5DFR A;  4X5H A;  3EEJ A;  3NZ6 X;  1IA3 A;  4KEB A;  4PTJ A;  5ECX A;  3S7A A;  1D1G A;  3FRD X;  3FY9 X;  5HUI A;  2W9G A;  2FZI A;  3F0Q X;  4QLG A;  1LUD A;  2H2Q A;  4GH8 A;  4XT8 A;  1S3V A;  4EIL A;  3JW3 A;  1CD2 A;  1RD7 A;  2LF1 A;  3DFR A;  1U70 A;  2ANO A;  3QLW A;  4P68 A;  2W3A A;  3SQY X;  3NZD A;  1MVT A;  4ELE A;  4EJ1 A;  3IA5 A;  2XW7 A;  4QLF A;  3FQ0 A;  1TDR A;  1DR7 A;  4G95 A;  5HSU A;  1AO8 A;  3KFY A;  4OSG A;  3CL9 A;  4PST A;  3JVX A;  4XT4 A;  1S3Y A;  3QL3 A;  3D84 X;  1DR3 A;  3DRC A;  3IRM A;  2W9T A;  2BLB A;  4KM0 A;  3DL5 A;  4FGH A;  3JTW A;  3UM6 A;  1IA1 A;  2D0K A;  1RH3 A;  2W3M A;  1OHJ A;  3SA1 A;  5FDA A;  4LAG X;  3I3R A;  2L28 A;  4KNE A;  1DYH A;  3F0V X;  2KGK A;  4G8Z X;  2C2T A;  3GYF A;  3F0U X;  3S9U A;  3QLR A;  5HQY A;  2CIG A;  3NXT A;  4M6J A;  4KL9 A;  4M6L A;  1DHJ A;  2DHF A;  1ZDR A;  3SRW X;  5HT5 A;  2W9S A;  2ITH A;  1DR4 A;  1VDR A;  3IA4 A;  1RG7 A;  1DRA A;  3NZC X;  1MVS A;  1J3I A;  2HM9 A;  4FHB A;  4KY8 A;  4HOG A;  4ELH A;  3QFX A;  5HT4 A;  4IXF X;  3FY8 X;  1J3J A;  4PSY A;  4H95 A;  3SGY A;  3IRN A;  3CLB A;  3KGY A;  4DPD A;  1OHK A;  4XT7 A;  1DG7 A;  3FRA X;  1DIS A;  4X5J A;  2QK8 A;  5HPB A;  3KJR A;  3DG8 A;  1YHO A;  3GHW A;  3K2H A;  4HA9 A;  2GD9 A;  1RX8 A;  4RGC A;  4KYA A;  2OBC A;  1JOM A;  1S3W A;  4M7V A;  3HJ3 A;  3NXV A;  5HI6 A;  3CSE A;  3K45 A;  3GHV A;  2P4G A;  4KBN A;  3FL8 A;  4XT6 A;  6DFR A;  3RO9 A;  2ZZA A;  1DIU A;  3QLY A;  1HFQ A;  4X5F A;  3UM5 A;  4ELB A;  4ELF A;  1M78 A;  4CD2 A;  1RA9 A;  1RB2 A;  1DLS A;  4PSS A;  3SRR X;  3N0H A;  3SH2 A;  4QLE A;  4KJJ A;  4XT5 A;  3JWC A;  2OIP A;  4XEC X;  4I1N A;  3TQ8 A;  3UM8 A;  3SRS X;  5CCC A;  4FGG A;  4X5G A;  1U71 A;  3NXR A;  4P66 A;  1J3K A;  4QI9 A;  3VCO A;  4Q67 A;  3QL0 A;  4M2X A;  4DFR A;  3QG2 A;  4I13 A;  2W3B A;  3M09 A;  1S3U A;  3FRE X;  4H97 A;  5ECC A;  3NZ9 X;  5HVE A;  2O7P A;  1AI9 A;  4HA7 A;  1M79 A;  1RB3 A;  3NZB X;  3RG9 A;  2CD2 A;  3NZA X;  8DFR A;  3DAU A;  3S3V A;  1RE7 A;  3I8A X;  1PDB A;  3F0B X;  3QLX A;  1IA2 A;  1RA1 A;  2C2S A;  3JWM A;  3NXX A;  1DG8 A;  1BZF A;  4DP3 A;  1DR6 A;  4KJL A;  3R33 A;  3NTZ A;  3JSU A;  2INQ A;  4XRB A;  3F8Z A;  3OCH A;  5HF0 X;  3SRU X;  3LG4 A;  3DAT A;  1RX4 A;  1CZ3 A;  1RA3 A;  1JOL A;  1HFR A;  4P3Q A;  3FS6 A;  3NU0 A;  3EEL A;  3TQB A;  2JYB A;  1DR5 A;  2W9H A;  3GHC A;  1QZF A;  1VJ3 A;  7DFR A;  1DDS A;  3EX8 A;  1DR1 A;  3FRB X;  3TQ9 A;  1RF7 A;  4G3M A;  1DRE A; 
#chains in the Genus database with same CATH topology
 2BLA A;  3JWF A;  4Q0D A;  3FL9 A;  1SEJ A;  2B3Z A;  3EIG A;  3FQC A;  5U26 A;  3SAI A;  4DDR A;  1AOE A;  1U72 A;  3SA2 A;  4QJZ D;  1DYJ A;  3ROA A;  1JUV A;  1RX2 A;  3QYL A;  5HF2 X;  3JW5 A;  1PD9 A;  2AZN A;  2FZJ A;  2BL9 A;  3FQZ A;  3FRF X;  3ZPG A;  1DR2 A;  3GI2 A;  3K47 A;  3F0X X;  1IA4 A;  1RA2 A;  1RX7 A;  1BOZ A;  1DRF A;  3K74 A;  4NX7 A;  4KAK A;  1RC4 A;  1M7A A;  4HOF A;  3FQF A;  4NX6 A;  5U27 A;  3INV A;  4M7U A;  3Q1H A;  2ANQ A;  3KJS A;  4Q0E A;  1DG5 A;  4IXE D;  5JG0 X;  1KLK A;  3DGA A;  3FQV A;  4KM2 A;  4LEK X;  4IXG X;  3NRR A;  3FYW X;  3L3R A;  1DHF A;  4PTH A;  3KY8 A;  3FQO A;  4M6K A;  3IX9 A;  3DL6 A;  1PD8 A;  5JA3 A;  4H96 A;  4KJK A;  2HQP A;  3NXO A;  3QLS A;  1DRB A;  2W3V A;  3CD2 A;  4P3R A;  4Q6A A;  2G6V A;  2W3W A;  4KLX A;  3EEM A;  2FZH A;  4XE6 X;  1DHI A;  4HOE A;  3ZPC A;  1DDR A;  4PDJ A;  1DAJ A;  2HXV A;  1RX6 A;  4ELG A;  1DRH A;  4DPH A;  5HQZ A;  1RX1 A;  4QJC A;  4TU5 X;  3IRO A;  4KD7 A;  3NXY A;  4EIZ A;  3QLZ A;  4LAH X;  3F91 A;  1KMS A;  3M08 A;  3SR5 X;  1KMV A;  1LY3 A;  4X5I A;  4ECK A;  3SRQ X;  1RX3 A;  1HFP A;  2D5N A;  3HBB A;  1DYI A;  4H98 A;  3TD8 A;  5EAJ A;  3F8Y A;  1LY4 A;  1E26 A;  5HSR A;  5HVB A;  3D80 A;  1DLR A;  1DF7 A;  4QHV A;  2BLC A;  1RA8 A;  3FYV X;  3JWK A;  3F0S X;  5DXV A;  2DRC A;  3QYO A;  4EIG A;  3E0B A;  5CC9 A;  4LAE X;  1DYR A;  5E8Q A;  4OR7 A;  1RX9 A;  3EEK A;  4KY4 A;  1RX5 A;  3OAF A;  4KFJ A;  3QGT A;  3TQA A;  5DFR A;  4X5H A;  3EEJ A;  3NZ6 X;  1IA3 A;  4KEB A;  4PTJ A;  5ECX A;  3S7A A;  1D1G A;  3FRD X;  3FY9 X;  5HUI A;  2W9G A;  2FZI A;  3F0Q X;  4QLG A;  1LUD A;  2H2Q A;  4GH8 A;  4XT8 A;  1S3V A;  4EIL A;  3JW3 A;  1CD2 A;  1RD7 A;  2LF1 A;  3DFR A;  1U70 A;  2ANO A;  3QLW A;  4P68 A;  2W3A A;  3SQY X;  3NZD A;  1MVT A;  4ELE A;  4EJ1 A;  3IA5 A;  2XW7 A;  4QLF A;  3FQ0 A;  1TDR A;  1DR7 A;  4G95 A;  5HSU A;  1AO8 A;  3KFY A;  4OSG A;  3CL9 A;  4PST A;  3JVX A;  4XT4 A;  1S3Y A;  3QL3 A;  3D84 X;  1DR3 A;  3DRC A;  3IRM A;  2W9T A;  2BLB A;  4KM0 A;  3DL5 A;  4FGH A;  3JTW A;  3UM6 A;  1IA1 A;  2D0K A;  1RH3 A;  2W3M A;  1OHJ A;  3SA1 A;  5FDA A;  4LAG X;  3I3R A;  2L28 A;  4KNE A;  1DYH A;  3F0V X;  2KGK A;  4G8Z X;  2C2T A;  3GYF A;  3F0U X;  3S9U A;  3QLR A;  5HQY A;  2CIG A;  3NXT A;  4M6J A;  4KL9 A;  4M6L A;  1DHJ A;  2DHF A;  1ZDR A;  3SRW X;  5HT5 A;  2W9S A;  2ITH A;  1DR4 A;  1VDR A;  3IA4 A;  1RG7 A;  1DRA A;  3NZC X;  1MVS A;  1J3I A;  2HM9 A;  4FHB A;  4KY8 A;  4HOG A;  4ELH A;  3QFX A;  5HT4 A;  4IXF X;  3FY8 X;  1J3J A;  4PSY A;  4H95 A;  3SGY A;  3IRN A;  3CLB A;  3KGY A;  4DPD A;  1OHK A;  4XT7 A;  1DG7 A;  3FRA X;  1DIS A;  4X5J A;  2QK8 A;  5HPB A;  3KJR A;  3DG8 A;  1YHO A;  3GHW A;  3K2H A;  4HA9 A;  2GD9 A;  1RX8 A;  4RGC A;  4KYA A;  2OBC A;  1JOM A;  1S3W A;  4M7V A;  3HJ3 A;  3NXV A;  5HI6 A;  3CSE A;  3K45 A;  3GHV A;  2P4G A;  4KBN A;  3FL8 A;  4XT6 A;  6DFR A;  3RO9 A;  2ZZA A;  1DIU A;  3QLY A;  1HFQ A;  4X5F A;  3UM5 A;  4ELB A;  4ELF A;  1M78 A;  4CD2 A;  1RA9 A;  1RB2 A;  1DLS A;  4PSS A;  3SRR X;  3N0H A;  3SH2 A;  4QLE A;  4KJJ A;  4XT5 A;  3JWC A;  2OIP A;  4XEC X;  4I1N A;  3TQ8 A;  3UM8 A;  3SRS X;  5CCC A;  4FGG A;  4X5G A;  1U71 A;  3NXR A;  4P66 A;  1J3K A;  4QI9 A;  3VCO A;  4Q67 A;  3QL0 A;  4M2X A;  4DFR A;  3QG2 A;  4I13 A;  2W3B A;  3M09 A;  1S3U A;  3FRE X;  4H97 A;  5ECC A;  3NZ9 X;  5HVE A;  2O7P A;  1AI9 A;  4HA7 A;  1M79 A;  1RB3 A;  3NZB X;  3RG9 A;  2CD2 A;  3NZA X;  8DFR A;  3DAU A;  3S3V A;  1RE7 A;  3I8A X;  1PDB A;  3F0B X;  3QLX A;  1IA2 A;  1RA1 A;  2C2S A;  3JWM A;  3NXX A;  1DG8 A;  1BZF A;  4DP3 A;  1DR6 A;  4KJL A;  3R33 A;  3NTZ A;  3JSU A;  2INQ A;  4XRB A;  3F8Z A;  3OCH A;  5HF0 X;  3SRU X;  3LG4 A;  3DAT A;  1RX4 A;  1CZ3 A;  1RA3 A;  1JOL A;  1HFR A;  4P3Q A;  3FS6 A;  3NU0 A;  3EEL A;  3TQB A;  2JYB A;  1DR5 A;  2W9H A;  3GHC A;  1QZF A;  1VJ3 A;  7DFR A;  1DDS A;  3EX8 A;  1DR1 A;  3FRB X;  3TQ9 A;  1RF7 A;  4G3M A;  1DRE A; 
#chains in the Genus database with same CATH homology
 2BLA A;  3JWF A;  4Q0D A;  3FL9 A;  1SEJ A;  2B3Z A;  3EIG A;  3FQC A;  5U26 A;  3SAI A;  4DDR A;  1AOE A;  1U72 A;  3SA2 A;  4QJZ D;  1DYJ A;  3ROA A;  1JUV A;  1RX2 A;  3QYL A;  5HF2 X;  3JW5 A;  1PD9 A;  2AZN A;  2FZJ A;  2BL9 A;  3FQZ A;  3FRF X;  3ZPG A;  1DR2 A;  3GI2 A;  3K47 A;  3F0X X;  1IA4 A;  1RA2 A;  1RX7 A;  1BOZ A;  1DRF A;  3K74 A;  4NX7 A;  4KAK A;  1RC4 A;  1M7A A;  4HOF A;  3FQF A;  4NX6 A;  5U27 A;  3INV A;  4M7U A;  3Q1H A;  2ANQ A;  3KJS A;  4Q0E A;  1DG5 A;  4IXE D;  5JG0 X;  1KLK A;  3DGA A;  3FQV A;  4KM2 A;  4LEK X;  4IXG X;  3NRR A;  3FYW X;  3L3R A;  1DHF A;  4PTH A;  3KY8 A;  3FQO A;  4M6K A;  3IX9 A;  3DL6 A;  1PD8 A;  5JA3 A;  4H96 A;  4KJK A;  2HQP A;  3NXO A;  3QLS A;  1DRB A;  2W3V A;  3CD2 A;  4P3R A;  4Q6A A;  2G6V A;  2W3W A;  4KLX A;  3EEM A;  2FZH A;  4XE6 X;  1DHI A;  4HOE A;  3ZPC A;  1DDR A;  4PDJ A;  1DAJ A;  2HXV A;  1RX6 A;  4ELG A;  1DRH A;  4DPH A;  5HQZ A;  1RX1 A;  4QJC A;  4TU5 X;  3IRO A;  4KD7 A;  3NXY A;  4EIZ A;  3QLZ A;  4LAH X;  3F91 A;  1KMS A;  3M08 A;  3SR5 X;  1KMV A;  1LY3 A;  4X5I A;  4ECK A;  3SRQ X;  1RX3 A;  1HFP A;  2D5N A;  3HBB A;  1DYI A;  4H98 A;  3TD8 A;  5EAJ A;  3F8Y A;  1LY4 A;  1E26 A;  5HSR A;  5HVB A;  3D80 A;  1DLR A;  1DF7 A;  4QHV A;  2BLC A;  1RA8 A;  3FYV X;  3JWK A;  3F0S X;  5DXV A;  2DRC A;  3QYO A;  4EIG A;  3E0B A;  5CC9 A;  4LAE X;  1DYR A;  5E8Q A;  4OR7 A;  1RX9 A;  3EEK A;  4KY4 A;  1RX5 A;  3OAF A;  4KFJ A;  3QGT A;  3TQA A;  5DFR A;  4X5H A;  3EEJ A;  3NZ6 X;  1IA3 A;  4KEB A;  4PTJ A;  5ECX A;  3S7A A;  1D1G A;  3FRD X;  3FY9 X;  5HUI A;  2W9G A;  2FZI A;  3F0Q X;  4QLG A;  1LUD A;  2H2Q A;  4GH8 A;  4XT8 A;  1S3V A;  4EIL A;  3JW3 A;  1CD2 A;  1RD7 A;  2LF1 A;  3DFR A;  1U70 A;  2ANO A;  3QLW A;  4P68 A;  2W3A A;  3SQY X;  3NZD A;  1MVT A;  4ELE A;  4EJ1 A;  3IA5 A;  2XW7 A;  4QLF A;  3FQ0 A;  1TDR A;  1DR7 A;  4G95 A;  5HSU A;  1AO8 A;  3KFY A;  4OSG A;  3CL9 A;  4PST A;  3JVX A;  4XT4 A;  1S3Y A;  3QL3 A;  3D84 X;  1DR3 A;  3DRC A;  3IRM A;  2W9T A;  2BLB A;  4KM0 A;  3DL5 A;  4FGH A;  3JTW A;  3UM6 A;  1IA1 A;  2D0K A;  1RH3 A;  2W3M A;  1OHJ A;  3SA1 A;  5FDA A;  4LAG X;  3I3R A;  2L28 A;  4KNE A;  1DYH A;  3F0V X;  2KGK A;  4G8Z X;  2C2T A;  3GYF A;  3F0U X;  3S9U A;  3QLR A;  5HQY A;  2CIG A;  3NXT A;  4M6J A;  4KL9 A;  4M6L A;  1DHJ A;  2DHF A;  1ZDR A;  3SRW X;  5HT5 A;  2W9S A;  2ITH A;  1DR4 A;  1VDR A;  3IA4 A;  1RG7 A;  1DRA A;  3NZC X;  1MVS A;  1J3I A;  2HM9 A;  4FHB A;  4KY8 A;  4HOG A;  4ELH A;  3QFX A;  5HT4 A;  4IXF X;  3FY8 X;  1J3J A;  4PSY A;  4H95 A;  3SGY A;  3IRN A;  3CLB A;  3KGY A;  4DPD A;  1OHK A;  4XT7 A;  1DG7 A;  3FRA X;  1DIS A;  4X5J A;  2QK8 A;  5HPB A;  3KJR A;  3DG8 A;  1YHO A;  3GHW A;  3K2H A;  4HA9 A;  2GD9 A;  1RX8 A;  4RGC A;  4KYA A;  2OBC A;  1JOM A;  1S3W A;  4M7V A;  3HJ3 A;  3NXV A;  5HI6 A;  3CSE A;  3K45 A;  3GHV A;  2P4G A;  4KBN A;  3FL8 A;  4XT6 A;  6DFR A;  3RO9 A;  2ZZA A;  1DIU A;  3QLY A;  1HFQ A;  4X5F A;  3UM5 A;  4ELB A;  4ELF A;  1M78 A;  4CD2 A;  1RA9 A;  1RB2 A;  1DLS A;  4PSS A;  3SRR X;  3N0H A;  3SH2 A;  4QLE A;  4KJJ A;  4XT5 A;  3JWC A;  2OIP A;  4XEC X;  4I1N A;  3TQ8 A;  3UM8 A;  3SRS X;  5CCC A;  4FGG A;  4X5G A;  1U71 A;  3NXR A;  4P66 A;  1J3K A;  4QI9 A;  3VCO A;  4Q67 A;  3QL0 A;  4M2X A;  4DFR A;  3QG2 A;  4I13 A;  2W3B A;  3M09 A;  1S3U A;  3FRE X;  4H97 A;  5ECC A;  3NZ9 X;  5HVE A;  2O7P A;  1AI9 A;  4HA7 A;  1M79 A;  1RB3 A;  3NZB X;  3RG9 A;  2CD2 A;  3NZA X;  8DFR A;  3DAU A;  3S3V A;  1RE7 A;  3I8A X;  1PDB A;  3F0B X;  3QLX A;  1IA2 A;  1RA1 A;  2C2S A;  3JWM A;  3NXX A;  1DG8 A;  1BZF A;  4DP3 A;  1DR6 A;  4KJL A;  3R33 A;  3NTZ A;  3JSU A;  2INQ A;  4XRB A;  3F8Z A;  3OCH A;  5HF0 X;  3SRU X;  3LG4 A;  3DAT A;  1RX4 A;  1CZ3 A;  1RA3 A;  1JOL A;  1HFR A;  4P3Q A;  3FS6 A;  3NU0 A;  3EEL A;  3TQB A;  2JYB A;  1DR5 A;  2W9H A;  3GHC A;  1QZF A;  1VJ3 A;  7DFR A;  1DDS A;  3EX8 A;  1DR1 A;  3FRB X;  3TQ9 A;  1RF7 A;  4G3M A;  1DRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...