4EQYA

Crystal structure of acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase from burkholderia thailandensis
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
261
structure length
261
Chain Sequence
SRIHPTAIIEPGAQLHETVEVGPYAIVGSNVTIGARTTIGSHSVIEGHTTIGEDNRIGHYASVGGRPQDMKYKDEPTRLVIGDRNTIREFTTIHTGTVQDAGVTTLGDDNWIMAYVHIGHDCRVGSHVVLSSNAQMAGHVEIGDWAIVGGMSGVHQYVRIGAHSMLGGASALVQDIPPFVIAAGNKAEPHGINVEGLRRRGFSPDAISALRSAYRILYKNSLSLEEAKVQLSELAQAGGDGDAAVKALVDFVESSQRGIIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
molecule keywords Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acylt
molecule tags Transferase
source organism Burkholderia thailandensis
total genus 105
structure length 261
sequence length 261
chains with identical sequence B, C, E, F, G
ec nomenclature ec 2.3.1.129: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF13720 Acetyltransf_11 Udp N-acetylglucosamine O-acyltransferase; Domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1180.10 Mainly Alpha Up-down Bundle Udp N-acetylglucosamine O-acyltransferase; Domain 2 Udp N-acetylglucosamine O-acyltransferase, C-terminal domain 4eqyA02
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4eqyA01
4R36A 3R3IA 1FXJA 1T3DA 3F1XA 1KK4A 5ADXU 2OI5A 3VBMA 4MFGA 2V0KA 3EH0A 1QRFA 2V0LA 2IC7A 2RIJA 2P2OA 2V0HA 3R1WA 3FSBA 3DK5A 4M98A 4DCLA 1YP3A 3MQGA 3ECTA 4EA7A 3FSYA 1SSQA 2WLCA 1YP4A 3TWDA 3BSWA 3TIOA 4E6TA 3BSSA 3R5AA 2ICYA 4E6UA 3VBIA 4IHFA 5E3RA 5ADXV 2QIVX 1QRGA 3Q1XA 3EEVA 4AC3A 1KK5A 3R5BA 2JF2A 4E1KA 3KWEA 3TV0A 1YP2A 1KRVA 1OCXA 3FTTA 1KHRA 3CJ8A 1KGTA 4KPZA 4J09A 3TK8A 3TISA 5L6SA 1LXAA 3FS8A 2OI7A 4HZCA 2OEGA 3JQYA 4HUSA 1HM9A 2IUAA 3OUPA 4N27A 3SRTA 1MRLA 2OI6A 3OTMA 1HM8A 2WLDA 4KNRA 3I3XA 2IU9A 4EABA 3IGJA 2XATA 2WLGA 2QKXA 4KNXA 3FWWA 3OU9A 3MC4A 4R7PA 4E75A 4M9CA 3R2WA 4G87A 3TDTA 4G3SA 3R5CA 3KWDA 3GVDA 1XHDA 1V3WA 3BFPA 3IXCA 4FCEA 1XATA 4R37A 1SSMA 3DHOA 2FKOA 5E3PA 3HSQA 4N69A 1Z90A 5DG3A 3VBJA 4KPXA 1KK6A 4IHHA 4EA8A 3BXYA 2OEFA 2JF3A 4M28A 5U2KA 4KQLA 1HM0A 2AQ9A 3D8VA 2WLEA 4AA7A 3R3RA 4ISXA 5L6VA 3VBKA 2Q4JA 4HCQA 3PMOA 3R8YA 3VNPA 4E79A 4MYOA 3P47A 1S80A 3FSCA 3P1BA 1KRUA 1QQ0A 4G3QA 4M99A 4N6AA 5DEPA 2W0VA 4EGGA 1G97A 2IU8A 5AFUU 1THJA 4HURA 2GGOA 1TDTA 3OW5A 4H7OA 1KRRA 3DJ4A 1KQAA 3D98A 1MR7A 3R5DA 1FWYA 2NPOA 1J2ZA 3BSYA 3BRKX 4MZUA 3T57A 4EQYA 1QRMA 2WLFA 3EG4A 3MQHA 4HZDA 3SPTA 1HV9A 1MR9A 3FOQA 4N6BA 1G95A 3R0SA 4M2BA 3ST8A 4AAWA 4EAAA 3GOSA 3VBNA 3C8VA 2ICXA 3GUEA 4M2AA 5AFUV 4J18A 2I5KA 4IHGA 5F42A 2VD4A 4EA9A 3VBLA 3NZ2A 2W0WA 1QREA 3OTZA 2GGQA 3KWCA 3VBPA 1KGQA 3FSXA 2QIAA 5E3QA 2VHEA 3HJJA 1V67A 4G3PA 3V4EA 2V0IA 1SSTA 2V0JA 2TDTA 4K6RA 3I3AA 1QRLA 5DEMA
chains in the Genus database with same CATH superfamily
4R36A 3R3IA 1FXJA 1T3DA 3F1XA 1KK4A 5ADXU 2OI5A 3VBMA 4MFGA 2V0KA 3EH0A 1QRFA 2V0LA 1EWWA 2IC7A 2RIJA 2P2OA 2V0HA 3R1WA 3GQ7A 3FSBA 3DK5A 4M98A 4DCLA 1L0SA 1YP3A 3ECTA 3MQGA 4EA7A 3FSYA 1SSQA 2WLCA 1YP4A 3TWDA 3BSWA 3TIOA 4E6TA 3BSSA 3R5AA 3OGZA 2ICYA 4E6UA 3VBIA 4IHFA 5E3RA 5ADXV 2QIVX 1QRGA 3Q1XA 3EEVA 4AC3A 1KK5A 3R5BA 2JF2A 4E1KA 3KWEA 3TV0A 1YP2A 1KRVA 3OH1A 1OCXA 3FTTA 1KHRA 3CJ8A 3SUCA 1KGTA 4KPZA 4J09A 3TK8A 3TISA 5L6SA 1LXAA 3FS8A 2OI7A 3OH2A 2OEGA 3OH3A 4HZCA 3JQYA 4HUSA 1HM9A 2IUAA 3OUPA 4N27A 3SRTA 1MRLA 2OI6A 3OTMA 1HM8A 2WLDA 4KNRA 3I3XA 2IU9A 4EABA 1N4IA 2XATA 3IGJA 3GQ8A 2WLGA 2QKXA 4KNXA 3FWWA 3OU9A 3MC4A 4R7PA 4E75A 4M9CA 3R2WA 4G87A 3TDTA 4G3SA 3R5CA 3KWDA 3GVDA 1XHDA 1V3WA 3BFPA 3GQ9A 3IXCA 4FCEA 1XATA 4R37A 1SSMA 3DHOA 2FKOA 5E3PA 3HSQA 4N69A 1Z90A 3GQAA 5DG3A 3VBJA 4KPXA 1KK6A 4IHHA 4EA8A 3BXYA 2OEFA 2JF3A 1Z2FA 4M28A 5U2KA 4KQLA 1HM0A 2AQ9A 3D8VA 2WLEA 4AA7A 4EGGA 3R3RA 4ISXA 5L6VA 3OH4A 2Q4JA 4HCQA 3PMOA 3R8YA 3VBKA 3VNPA 4MYOA 4E79A 3P47A 1S80A 3FSCA 3P1BA 1KRUA 1QQ0A 4G3QA 4M99A 4N6AA 5DEPA 2W0VA 1M8NA 1G97A 2IU8A 5AFUU 1THJA 4HURA 2GGOA 1TDTA 3OW5A 4H7OA 1KRRA 3DJ4A 1KQAA 3D98A 1MR7A 3R5DA 1FWYA 1J2ZA 2NPOA 3BSYA 3BRKX 4MZUA 3T57A 4EQYA 1QRMA 2WLFA 3EG4A 3MQHA 4HZDA 3SPTA 1HV9A 1MR9A 3FOQA 4N6BA 1G95A 3R0SA 4M2BA 3ST8A 4AAWA 4EAAA 3GOSA 3VBNA 3C8VA 2ICXA 3GUEA 4M2AA 5AFUV 4J18A 2I5KA 4IHGA 5F42A 2VD4A 4EA9A 3VBLA 3NZ2A 2W0WA 1QREA 3OTZA 3OH0A 2GGQA 3KWCA 3VBPA 1KGQA 3FSXA 2QIAA 5E3QA 2VHEA 3HJJA 1V67A 4G3PA 3V4EA 2V0IA 1SSTA 2V0JA 2TDTA 4K6RA 3I3AA 1QRLA 5DEMA
chains in the Genus database with same CATH topology
4R36A 3R3IA 1FXJA 1T3DA 3F1XA 1KK4A 5ADXU 2OI5A 3VBMA 4MFGA 2V0KA 3EH0A 1QRFA 2V0LA 2IC7A 2RIJA 2P2OA 2V0HA 3R1WA 3FSBA 3DK5A 4M98A 4DCLA 1YP3A 3MQGA 3ECTA 4EA7A 3FSYA 1SSQA 2WLCA 1YP4A 3TWDA 3BSWA 3TIOA 4E6TA 3BSSA 3R5AA 2ICYA 4E6UA 3VBIA 4IHFA 5E3RA 5ADXV 2QIVX 1QRGA 3Q1XA 3EEVA 4AC3A 1KK5A 3R5BA 2JF2A 4E1KA 3KWEA 3TV0A 1YP2A 1KRVA 1OCXA 3FTTA 1KHRA 3CJ8A 1KGTA 4KPZA 4J09A 3TK8A 3TISA 5L6SA 1LXAA 3FS8A 2OI7A 4HZCA 2OEGA 3JQYA 4HUSA 1HM9A 2IUAA 3OUPA 4N27A 3SRTA 1MRLA 2OI6A 3OTMA 1HM8A 2WLDA 4KNRA 3I3XA 2IU9A 4EABA 3IGJA 2XATA 2WLGA 2QKXA 4KNXA 3FWWA 3OU9A 3MC4A 4R7PA 4E75A 4M9CA 3R2WA 4G87A 3TDTA 4G3SA 3R5CA 3KWDA 3GVDA 1XHDA 1V3WA 3BFPA 3IXCA 4FCEA 1XATA 4R37A 1SSMA 3DHOA 2FKOA 5E3PA 3HSQA 4N69A 1Z90A 5DG3A 3VBJA 4KPXA 1KK6A 4IHHA 4EA8A 3BXYA 2OEFA 2JF3A 4M28A 5U2KA 4KQLA 1HM0A 2AQ9A 3D8VA 2WLEA 4AA7A 3R3RA 4ISXA 5L6VA 3VBKA 2Q4JA 4HCQA 3PMOA 3R8YA 3VNPA 4E79A 4MYOA 3P47A 1S80A 3FSCA 3P1BA 1KRUA 1QQ0A 4G3QA 4M99A 4N6AA 5DEPA 2W0VA 4EGGA 1G97A 2IU8A 5AFUU 1THJA 4HURA 2GGOA 1TDTA 3OW5A 4H7OA 1KRRA 3DJ4A 1KQAA 3D98A 1MR7A 3R5DA 1FWYA 2NPOA 1J2ZA 3BSYA 3BRKX 4MZUA 3T57A 4EQYA 1QRMA 2WLFA 3EG4A 3MQHA 4HZDA 3SPTA 1HV9A 1MR9A 3FOQA 4N6BA 1G95A 3R0SA 4M2BA 3ST8A 4AAWA 4EAAA 3GOSA 3VBNA 3C8VA 2ICXA 3GUEA 4M2AA 5AFUV 4J18A 2I5KA 4IHGA 5F42A 2VD4A 4EA9A 3VBLA 3NZ2A 2W0WA 1QREA 3OTZA 2GGQA 3KWCA 3VBPA 1KGQA 3FSXA 2QIAA 5E3QA 2VHEA 3HJJA 1V67A 4G3PA 3V4EA 2V0IA 1SSTA 2V0JA 2TDTA 4K6RA 3I3AA 1QRLA 5DEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R36 A;  3R3I A;  1FXJ A;  1T3D A;  3F1X A;  1KK4 A;  5ADX U;  2OI5 A;  3VBM A;  4MFG A;  2V0K A;  3EH0 A;  1QRF A;  2V0L A;  2IC7 A;  2RIJ A;  2P2O A;  2V0H A;  3R1W A;  3FSB A;  3DK5 A;  4M98 A;  4DCL A;  1YP3 A;  3MQG A;  3ECT A;  4EA7 A;  3FSY A;  1SSQ A;  2WLC A;  1YP4 A;  3TWD A;  3BSW A;  3TIO A;  4E6T A;  3BSS A;  3R5A A;  2ICY A;  4E6U A;  3VBI A;  4IHF A;  5E3R A;  5ADX V;  2QIV X;  1QRG A;  3Q1X A;  3EEV A;  4AC3 A;  1KK5 A;  3R5B A;  2JF2 A;  4E1K A;  3KWE A;  3TV0 A;  1YP2 A;  1KRV A;  1OCX A;  3FTT A;  1KHR A;  3CJ8 A;  1KGT A;  4KPZ A;  4J09 A;  3TK8 A;  3TIS A;  5L6S A;  1LXA A;  3FS8 A;  2OI7 A;  4HZC A;  2OEG A;  3JQY A;  4HUS A;  1HM9 A;  2IUA A;  3OUP A;  4N27 A;  3SRT A;  1MRL A;  2OI6 A;  3OTM A;  1HM8 A;  2WLD A;  4KNR A;  3I3X A;  2IU9 A;  4EAB A;  3IGJ A;  2XAT A;  2WLG A;  2QKX A;  4KNX A;  3FWW A;  3OU9 A;  3MC4 A;  4R7P A;  4E75 A;  4M9C A;  3R2W A;  4G87 A;  3TDT A;  4G3S A;  3R5C A;  3KWD A;  3GVD A;  1XHD A;  1V3W A;  3BFP A;  3IXC A;  4FCE A;  1XAT A;  4R37 A;  1SSM A;  3DHO A;  2FKO A;  5E3P A;  3HSQ A;  4N69 A;  1Z90 A;  5DG3 A;  3VBJ A;  4KPX A;  1KK6 A;  4IHH A;  4EA8 A;  3BXY A;  2OEF A;  2JF3 A;  4M28 A;  5U2K A;  4KQL A;  1HM0 A;  2AQ9 A;  3D8V A;  2WLE A;  4AA7 A;  3R3R A;  4ISX A;  5L6V A;  3VBK A;  2Q4J A;  4HCQ A;  3PMO A;  3R8Y A;  3VNP A;  4E79 A;  4MYO A;  3P47 A;  1S80 A;  3FSC A;  3P1B A;  1KRU A;  1QQ0 A;  4G3Q A;  4M99 A;  4N6A A;  5DEP A;  2W0V A;  4EGG A;  1G97 A;  2IU8 A;  5AFU U;  1THJ A;  4HUR A;  2GGO A;  1TDT A;  3OW5 A;  4H7O A;  1KRR A;  3DJ4 A;  1KQA A;  3D98 A;  1MR7 A;  3R5D A;  1FWY A;  2NPO A;  1J2Z A;  3BSY A;  3BRK X;  4MZU A;  3T57 A;  4EQY A;  1QRM A;  2WLF A;  3EG4 A;  3MQH A;  4HZD A;  3SPT A;  1HV9 A;  1MR9 A;  3FOQ A;  4N6B A;  1G95 A;  3R0S A;  4M2B A;  3ST8 A;  4AAW A;  4EAA A;  3GOS A;  3VBN A;  3C8V A;  2ICX A;  3GUE A;  4M2A A;  5AFU V;  4J18 A;  2I5K A;  4IHG A;  5F42 A;  2VD4 A;  4EA9 A;  3VBL A;  3NZ2 A;  2W0W A;  1QRE A;  3OTZ A;  2GGQ A;  3KWC A;  3VBP A;  1KGQ A;  3FSX A;  2QIA A;  5E3Q A;  2VHE A;  3HJJ A;  1V67 A;  4G3P A;  3V4E A;  2V0I A;  1SST A;  2V0J A;  2TDT A;  4K6R A;  3I3A A;  1QRL A;  5DEM A; 
#chains in the Genus database with same CATH topology
 4R36 A;  3R3I A;  1FXJ A;  1T3D A;  3F1X A;  1KK4 A;  5ADX U;  2OI5 A;  3VBM A;  4MFG A;  2V0K A;  3EH0 A;  1QRF A;  2V0L A;  1EWW A;  2IC7 A;  2RIJ A;  2P2O A;  2V0H A;  3R1W A;  3GQ7 A;  3FSB A;  3DK5 A;  4M98 A;  4DCL A;  1L0S A;  1YP3 A;  3ECT A;  3MQG A;  4EA7 A;  3FSY A;  1SSQ A;  2WLC A;  1YP4 A;  3TWD A;  3BSW A;  3TIO A;  4E6T A;  3BSS A;  3R5A A;  3OGZ A;  2ICY A;  4E6U A;  3VBI A;  4IHF A;  5E3R A;  5ADX V;  2QIV X;  1QRG A;  3Q1X A;  3EEV A;  4AC3 A;  1KK5 A;  3R5B A;  2JF2 A;  4E1K A;  3KWE A;  3TV0 A;  1YP2 A;  1KRV A;  3OH1 A;  1OCX A;  3FTT A;  1KHR A;  3CJ8 A;  3SUC A;  1KGT A;  4KPZ A;  4J09 A;  3TK8 A;  3TIS A;  5L6S A;  1LXA A;  3FS8 A;  2OI7 A;  3OH2 A;  2OEG A;  3OH3 A;  4HZC A;  3JQY A;  4HUS A;  1HM9 A;  2IUA A;  3OUP A;  4N27 A;  3SRT A;  1MRL A;  2OI6 A;  3OTM A;  1HM8 A;  2WLD A;  4KNR A;  3I3X A;  2IU9 A;  4EAB A;  1N4I A;  2XAT A;  3IGJ A;  3GQ8 A;  2WLG A;  2QKX A;  4KNX A;  3FWW A;  3OU9 A;  3MC4 A;  4R7P A;  4E75 A;  4M9C A;  3R2W A;  4G87 A;  3TDT A;  4G3S A;  3R5C A;  3KWD A;  3GVD A;  1XHD A;  1V3W A;  3BFP A;  3GQ9 A;  3IXC A;  4FCE A;  1XAT A;  4R37 A;  1SSM A;  3DHO A;  2FKO A;  5E3P A;  3HSQ A;  4N69 A;  1Z90 A;  3GQA A;  5DG3 A;  3VBJ A;  4KPX A;  1KK6 A;  4IHH A;  4EA8 A;  3BXY A;  2OEF A;  2JF3 A;  1Z2F A;  4M28 A;  5U2K A;  4KQL A;  1HM0 A;  2AQ9 A;  3D8V A;  2WLE A;  4AA7 A;  4EGG A;  3R3R A;  4ISX A;  5L6V A;  3OH4 A;  2Q4J A;  4HCQ A;  3PMO A;  3R8Y A;  3VBK A;  3VNP A;  4MYO A;  4E79 A;  3P47 A;  1S80 A;  3FSC A;  3P1B A;  1KRU A;  1QQ0 A;  4G3Q A;  4M99 A;  4N6A A;  5DEP A;  2W0V A;  1M8N A;  1G97 A;  2IU8 A;  5AFU U;  1THJ A;  4HUR A;  2GGO A;  1TDT A;  3OW5 A;  4H7O A;  1KRR A;  3DJ4 A;  1KQA A;  3D98 A;  1MR7 A;  3R5D A;  1FWY A;  1J2Z A;  2NPO A;  3BSY A;  3BRK X;  4MZU A;  3T57 A;  4EQY A;  1QRM A;  2WLF A;  3EG4 A;  3MQH A;  4HZD A;  3SPT A;  1HV9 A;  1MR9 A;  3FOQ A;  4N6B A;  1G95 A;  3R0S A;  4M2B A;  3ST8 A;  4AAW A;  4EAA A;  3GOS A;  3VBN A;  3C8V A;  2ICX A;  3GUE A;  4M2A A;  5AFU V;  4J18 A;  2I5K A;  4IHG A;  5F42 A;  2VD4 A;  4EA9 A;  3VBL A;  3NZ2 A;  2W0W A;  1QRE A;  3OTZ A;  3OH0 A;  2GGQ A;  3KWC A;  3VBP A;  1KGQ A;  3FSX A;  2QIA A;  5E3Q A;  2VHE A;  3HJJ A;  1V67 A;  4G3P A;  3V4E A;  2V0I A;  1SST A;  2V0J A;  2TDT A;  4K6R A;  3I3A A;  1QRL A;  5DEM A; 
#chains in the Genus database with same CATH homology
 4R36 A;  3R3I A;  1FXJ A;  1T3D A;  3F1X A;  1KK4 A;  5ADX U;  2OI5 A;  3VBM A;  4MFG A;  2V0K A;  3EH0 A;  1QRF A;  2V0L A;  2IC7 A;  2RIJ A;  2P2O A;  2V0H A;  3R1W A;  3FSB A;  3DK5 A;  4M98 A;  4DCL A;  1YP3 A;  3MQG A;  3ECT A;  4EA7 A;  3FSY A;  1SSQ A;  2WLC A;  1YP4 A;  3TWD A;  3BSW A;  3TIO A;  4E6T A;  3BSS A;  3R5A A;  2ICY A;  4E6U A;  3VBI A;  4IHF A;  5E3R A;  5ADX V;  2QIV X;  1QRG A;  3Q1X A;  3EEV A;  4AC3 A;  1KK5 A;  3R5B A;  2JF2 A;  4E1K A;  3KWE A;  3TV0 A;  1YP2 A;  1KRV A;  1OCX A;  3FTT A;  1KHR A;  3CJ8 A;  1KGT A;  4KPZ A;  4J09 A;  3TK8 A;  3TIS A;  5L6S A;  1LXA A;  3FS8 A;  2OI7 A;  4HZC A;  2OEG A;  3JQY A;  4HUS A;  1HM9 A;  2IUA A;  3OUP A;  4N27 A;  3SRT A;  1MRL A;  2OI6 A;  3OTM A;  1HM8 A;  2WLD A;  4KNR A;  3I3X A;  2IU9 A;  4EAB A;  3IGJ A;  2XAT A;  2WLG A;  2QKX A;  4KNX A;  3FWW A;  3OU9 A;  3MC4 A;  4R7P A;  4E75 A;  4M9C A;  3R2W A;  4G87 A;  3TDT A;  4G3S A;  3R5C A;  3KWD A;  3GVD A;  1XHD A;  1V3W A;  3BFP A;  3IXC A;  4FCE A;  1XAT A;  4R37 A;  1SSM A;  3DHO A;  2FKO A;  5E3P A;  3HSQ A;  4N69 A;  1Z90 A;  5DG3 A;  3VBJ A;  4KPX A;  1KK6 A;  4IHH A;  4EA8 A;  3BXY A;  2OEF A;  2JF3 A;  4M28 A;  5U2K A;  4KQL A;  1HM0 A;  2AQ9 A;  3D8V A;  2WLE A;  4AA7 A;  3R3R A;  4ISX A;  5L6V A;  3VBK A;  2Q4J A;  4HCQ A;  3PMO A;  3R8Y A;  3VNP A;  4E79 A;  4MYO A;  3P47 A;  1S80 A;  3FSC A;  3P1B A;  1KRU A;  1QQ0 A;  4G3Q A;  4M99 A;  4N6A A;  5DEP A;  2W0V A;  4EGG A;  1G97 A;  2IU8 A;  5AFU U;  1THJ A;  4HUR A;  2GGO A;  1TDT A;  3OW5 A;  4H7O A;  1KRR A;  3DJ4 A;  1KQA A;  3D98 A;  1MR7 A;  3R5D A;  1FWY A;  2NPO A;  1J2Z A;  3BSY A;  3BRK X;  4MZU A;  3T57 A;  4EQY A;  1QRM A;  2WLF A;  3EG4 A;  3MQH A;  4HZD A;  3SPT A;  1HV9 A;  1MR9 A;  3FOQ A;  4N6B A;  1G95 A;  3R0S A;  4M2B A;  3ST8 A;  4AAW A;  4EAA A;  3GOS A;  3VBN A;  3C8V A;  2ICX A;  3GUE A;  4M2A A;  5AFU V;  4J18 A;  2I5K A;  4IHG A;  5F42 A;  2VD4 A;  4EA9 A;  3VBL A;  3NZ2 A;  2W0W A;  1QRE A;  3OTZ A;  2GGQ A;  3KWC A;  3VBP A;  1KGQ A;  3FSX A;  2QIA A;  5E3Q A;  2VHE A;  3HJJ A;  1V67 A;  4G3P A;  3V4E A;  2V0I A;  1SST A;  2V0J A;  2TDT A;  4K6R A;  3I3A A;  1QRL A;  5DEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...