4EREA

Crystal structure of mdm2 (17-111) in complex with compound 23
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
90
structure length
85
Chain Sequence
SEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of novel inhibitors of the MDM2-p53 interaction.
pubmed doi rcsb
molecule keywords E3 ubiquitin-protein ligase Mdm2
molecule tags Ligase/ligase inhibitor
source organism Homo sapiens
total genus 25
structure length 85
sequence length 90
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02201 SWIB SWIB/MDM2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.245.10 Mainly Alpha Orthogonal Bundle MDM2 SWIB/MDM2 domain 4ereA00
4JVRA 4JWRA 3LBKA 1V32A 4ODFA 4HG7A 3JZQA 4J3EA 5LAVA 4RXZA 3LNJA 4ZYFA 4IPFA 3IUXA 4ERFA 3JZKA 4UMNA 4JVEA 4ZGKA 4JV9A 4OGVA 5AFGA 5LAWA 4JV7A 2N14A 3DACA 2RUHA 2MWYA 4OASA 1YCQA 2N0UA 1RV1A 4OCCA 4UE1A 4JSCA 4QOCA 1T4EA 1V31A 4MDQA 2N0WA 2N06A 4ZYIA 4HFZA 3JZSA 5HMHA 2VYRA 1UHRA 1Z1MA 4WT2A 3JZOA 1T4FM 5HMKA 3TPXA 4N5TA 3JZRA 2LZGA 5LAZA 4LWTA 3JZPA 2AXIA 4OGTA 5LAYA 3LBLA 4J7DA 3EQSA 3TJ2A 4OQ3A 5LN2A 4EREA 4HBMA 3IWYA 4LWVA 5TRFA 2MPSA 3W69A 3VZVA 2GV2A 3EQYA 3FDOA 4UD7A 4MDNA 4LWUA 3U15A 4QO4A 1TTVA 4JRGA 4ZFIA 3V3BA 3FE7A 4J7EA 4ODEA 3TU1A 3LNZA 5C5AA 1YCRA 3DABA 4DIJA 4J74A 3LBJE 4OBAA 2M86B 2Z5TM 4ZYCA 3G03A 2Z5SM 4OGNA 3VBGA 5HMIA 3FEAA
chains in the Genus database with same CATH superfamily
4JVRA 4JWRA 3LBKA 1V32A 4ODFA 4HG7A 3JZQA 4J3EA 5LAVA 4RXZA 3LNJA 4ZYFA 4IPFA 3IUXA 4ERFA 3JZKA 4UMNA 4JVEA 4ZGKA 4JV9A 4OGVA 5AFGA 5LAWA 4JV7A 2N14A 3DACA 2RUHA 2MWYA 4OASA 1YCQA 2N0UA 1RV1A 4OCCA 4UE1A 4JSCA 4QOCA 1T4EA 1V31A 4MDQA 2N0WA 2N06A 4ZYIA 4HFZA 3JZSA 5HMHA 2VYRA 1UHRA 1Z1MA 4WT2A 3JZOA 1T4FM 5HMKA 3TPXA 4N5TA 3JZRA 2LZGA 5LAZA 4LWTA 3JZPA 2AXIA 4OGTA 5LAYA 3LBLA 4J7DA 3EQSA 3TJ2A 4OQ3A 5LN2A 4EREA 4HBMA 3IWYA 4LWVA 5TRFA 2MPSA 3W69A 3VZVA 2GV2A 3EQYA 3FDOA 4UD7A 4MDNA 4LWUA 3U15A 4QO4A 1TTVA 4JRGA 4ZFIA 3V3BA 3FE7A 4J7EA 4ODEA 3TU1A 3LNZA 5C5AA 1YCRA 3DABA 4DIJA 4J74A 3LBJE 4OBAA 2M86B 2Z5TM 4ZYCA 3G03A 2Z5SM 4OGNA 3VBGA 5HMIA 3FEAA
chains in the Genus database with same CATH topology
4JVRA 4JWRA 3LBKA 1V32A 4ODFA 4HG7A 3JZQA 4J3EA 5LAVA 4RXZA 3LNJA 4ZYFA 4IPFA 3IUXA 4ERFA 3JZKA 4UMNA 4JVEA 4ZGKA 4JV9A 4OGVA 5AFGA 5LAWA 4JV7A 2N14A 3DACA 2RUHA 2MWYA 4OASA 1YCQA 2N0UA 1RV1A 4OCCA 4UE1A 4JSCA 4QOCA 1T4EA 1V31A 4MDQA 2N0WA 2N06A 4ZYIA 4HFZA 3JZSA 5HMHA 2VYRA 1UHRA 1Z1MA 4WT2A 3JZOA 1T4FM 5HMKA 3TPXA 4N5TA 3JZRA 2LZGA 5LAZA 4LWTA 3JZPA 2AXIA 4OGTA 5LAYA 3LBLA 4J7DA 3EQSA 3TJ2A 4OQ3A 5LN2A 4EREA 4HBMA 3IWYA 4LWVA 5TRFA 2MPSA 3W69A 3VZVA 2GV2A 3EQYA 3FDOA 4UD7A 4MDNA 4LWUA 3U15A 4QO4A 1TTVA 4JRGA 4ZFIA 3V3BA 3FE7A 4J7EA 4ODEA 3TU1A 3LNZA 5C5AA 1YCRA 3DABA 4DIJA 4J74A 3LBJE 4OBAA 2M86B 2Z5TM 4ZYCA 3G03A 2Z5SM 4OGNA 3VBGA 5HMIA 3FEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JVR A;  4JWR A;  3LBK A;  1V32 A;  4ODF A;  4HG7 A;  3JZQ A;  4J3E A;  5LAV A;  4RXZ A;  3LNJ A;  4ZYF A;  4IPF A;  3IUX A;  4ERF A;  3JZK A;  4UMN A;  4JVE A;  4ZGK A;  4JV9 A;  4OGV A;  5AFG A;  5LAW A;  4JV7 A;  2N14 A;  3DAC A;  2RUH A;  2MWY A;  4OAS A;  1YCQ A;  2N0U A;  1RV1 A;  4OCC A;  4UE1 A;  4JSC A;  4QOC A;  1T4E A;  1V31 A;  4MDQ A;  2N0W A;  2N06 A;  4ZYI A;  4HFZ A;  3JZS A;  5HMH A;  2VYR A;  1UHR A;  1Z1M A;  4WT2 A;  3JZO A;  1T4F M;  5HMK A;  3TPX A;  4N5T A;  3JZR A;  2LZG A;  5LAZ A;  4LWT A;  3JZP A;  2AXI A;  4OGT A;  5LAY A;  3LBL A;  4J7D A;  3EQS A;  3TJ2 A;  4OQ3 A;  5LN2 A;  4ERE A;  4HBM A;  3IWY A;  4LWV A;  5TRF A;  2MPS A;  3W69 A;  3VZV A;  2GV2 A;  3EQY A;  3FDO A;  4UD7 A;  4MDN A;  4LWU A;  3U15 A;  4QO4 A;  1TTV A;  4JRG A;  4ZFI A;  3V3B A;  3FE7 A;  4J7E A;  4ODE A;  3TU1 A;  3LNZ A;  5C5A A;  1YCR A;  3DAB A;  4DIJ A;  4J74 A;  3LBJ E;  4OBA A;  2M86 B;  2Z5T M;  4ZYC A;  3G03 A;  2Z5S M;  4OGN A;  3VBG A;  5HMI A;  3FEA A; 
#chains in the Genus database with same CATH topology
 4JVR A;  4JWR A;  3LBK A;  1V32 A;  4ODF A;  4HG7 A;  3JZQ A;  4J3E A;  5LAV A;  4RXZ A;  3LNJ A;  4ZYF A;  4IPF A;  3IUX A;  4ERF A;  3JZK A;  4UMN A;  4JVE A;  4ZGK A;  4JV9 A;  4OGV A;  5AFG A;  5LAW A;  4JV7 A;  2N14 A;  3DAC A;  2RUH A;  2MWY A;  4OAS A;  1YCQ A;  2N0U A;  1RV1 A;  4OCC A;  4UE1 A;  4JSC A;  4QOC A;  1T4E A;  1V31 A;  4MDQ A;  2N0W A;  2N06 A;  4ZYI A;  4HFZ A;  3JZS A;  5HMH A;  2VYR A;  1UHR A;  1Z1M A;  4WT2 A;  3JZO A;  1T4F M;  5HMK A;  3TPX A;  4N5T A;  3JZR A;  2LZG A;  5LAZ A;  4LWT A;  3JZP A;  2AXI A;  4OGT A;  5LAY A;  3LBL A;  4J7D A;  3EQS A;  3TJ2 A;  4OQ3 A;  5LN2 A;  4ERE A;  4HBM A;  3IWY A;  4LWV A;  5TRF A;  2MPS A;  3W69 A;  3VZV A;  2GV2 A;  3EQY A;  3FDO A;  4UD7 A;  4MDN A;  4LWU A;  3U15 A;  4QO4 A;  1TTV A;  4JRG A;  4ZFI A;  3V3B A;  3FE7 A;  4J7E A;  4ODE A;  3TU1 A;  3LNZ A;  5C5A A;  1YCR A;  3DAB A;  4DIJ A;  4J74 A;  3LBJ E;  4OBA A;  2M86 B;  2Z5T M;  4ZYC A;  3G03 A;  2Z5S M;  4OGN A;  3VBG A;  5HMI A;  3FEA A; 
#chains in the Genus database with same CATH homology
 4JVR A;  4JWR A;  3LBK A;  1V32 A;  4ODF A;  4HG7 A;  3JZQ A;  4J3E A;  5LAV A;  4RXZ A;  3LNJ A;  4ZYF A;  4IPF A;  3IUX A;  4ERF A;  3JZK A;  4UMN A;  4JVE A;  4ZGK A;  4JV9 A;  4OGV A;  5AFG A;  5LAW A;  4JV7 A;  2N14 A;  3DAC A;  2RUH A;  2MWY A;  4OAS A;  1YCQ A;  2N0U A;  1RV1 A;  4OCC A;  4UE1 A;  4JSC A;  4QOC A;  1T4E A;  1V31 A;  4MDQ A;  2N0W A;  2N06 A;  4ZYI A;  4HFZ A;  3JZS A;  5HMH A;  2VYR A;  1UHR A;  1Z1M A;  4WT2 A;  3JZO A;  1T4F M;  5HMK A;  3TPX A;  4N5T A;  3JZR A;  2LZG A;  5LAZ A;  4LWT A;  3JZP A;  2AXI A;  4OGT A;  5LAY A;  3LBL A;  4J7D A;  3EQS A;  3TJ2 A;  4OQ3 A;  5LN2 A;  4ERE A;  4HBM A;  3IWY A;  4LWV A;  5TRF A;  2MPS A;  3W69 A;  3VZV A;  2GV2 A;  3EQY A;  3FDO A;  4UD7 A;  4MDN A;  4LWU A;  3U15 A;  4QO4 A;  1TTV A;  4JRG A;  4ZFI A;  3V3B A;  3FE7 A;  4J7E A;  4ODE A;  3TU1 A;  3LNZ A;  5C5A A;  1YCR A;  3DAB A;  4DIJ A;  4J74 A;  3LBJ E;  4OBA A;  2M86 B;  2Z5T M;  4ZYC A;  3G03 A;  2Z5S M;  4OGN A;  3VBG A;  5HMI A;  3FEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...