4ERFA

Crystal structure of mdm2 (17-111) in complex with compound 29 (am-8553)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
92
structure length
92
Chain Sequence
IPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of novel inhibitors of the MDM2-p53 interaction.
pubmed doi rcsb
molecule keywords E3 ubiquitin-protein ligase Mdm2
molecule tags Ligase/ligase inhibitor
source organism Homo sapiens
total genus 27
structure length 92
sequence length 92
chains with identical sequence C, E
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02201 SWIB SWIB/MDM2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.245.10 Mainly Alpha Orthogonal Bundle MDM2 SWIB/MDM2 domain 4erfA00
4MDNA 3JZPA 5LAYA 4WT2A 3TJ2A 2N06A 3VBGA 2N0WA 4OGTA 3W69A 3LBLA 2M86B 4J3EA 4EREA 4ODEA 4LWTA 5LAZA 3LNZA 3TPXA 5C5AA 5AFGA 5HMKA 1RV1A 4J7EA 4QOCA 3V3BA 1YCQA 2LZGA 4ZYCA 3EQYA 4HG7A 4OQ3A 4JV9A 3JZKA 1V32A 4JVEA 4DIJA 3EQSA 3G03A 3JZQA 3FDOA 4J74A 2N14A 4JV7A 5LN2A 2Z5SM 4HBMA 3IWYA 1T4EA 3FEAA 3FE7A 4ODFA 4QO4A 4J7DA 5TRFA 4OCCA 2VYRA 3LBKA 5HMHA 3JZSA 3TU1A 4ZYIA 4ZFIA 3JZOA 4OASA 2MPSA 5LAVA 2RUHA 2N0UA 3U15A 1V31A 1UHRA 2MWYA 4LWUA 4LWVA 4ZGKA 4UD7A 3LNJA 4HFZA 1T4FM 2GV2A 4JVRA 3LBJE 3VZVA 2Z5TM 1TTVA 4OGVA 1YCRA 2AXIA 4OGNA 4N5TA 4JWRA 1Z1MA 4UMNA 3JZRA 4ZYFA 3IUXA 4UE1A 4IPFA 4ERFA 4RXZA 4JSCA 4OBAA 4MDQA 4JRGA 5HMIA 5LAWA 3DABA 3DACA
chains in the Genus database with same CATH superfamily
4MDNA 3JZPA 5LAYA 4WT2A 3TJ2A 2N06A 3VBGA 2N0WA 4OGTA 3W69A 3LBLA 2M86B 4J3EA 4EREA 4ODEA 4LWTA 5LAZA 3LNZA 3TPXA 5C5AA 5AFGA 5HMKA 1RV1A 4J7EA 4QOCA 3V3BA 1YCQA 2LZGA 4ZYCA 3EQYA 4HG7A 4OQ3A 4JV9A 3JZKA 1V32A 4JVEA 4DIJA 3EQSA 3G03A 3JZQA 3FDOA 4J74A 2N14A 4JV7A 5LN2A 2Z5SM 4HBMA 3IWYA 1T4EA 3FEAA 3FE7A 4ODFA 4QO4A 4J7DA 5TRFA 4OCCA 2VYRA 3LBKA 5HMHA 3JZSA 3TU1A 4ZYIA 4ZFIA 3JZOA 4OASA 2MPSA 5LAVA 2RUHA 2N0UA 3U15A 1V31A 1UHRA 2MWYA 4LWUA 4LWVA 4ZGKA 4UD7A 3LNJA 4HFZA 1T4FM 2GV2A 4JVRA 3LBJE 3VZVA 2Z5TM 1TTVA 4OGVA 1YCRA 2AXIA 4OGNA 4N5TA 4JWRA 1Z1MA 4UMNA 3JZRA 4ZYFA 3IUXA 4UE1A 4IPFA 4ERFA 4RXZA 4JSCA 4OBAA 4MDQA 4JRGA 5HMIA 5LAWA 3DABA 3DACA
chains in the Genus database with same CATH topology
4MDNA 3JZPA 5LAYA 4WT2A 3TJ2A 2N06A 3VBGA 2N0WA 4OGTA 3W69A 3LBLA 2M86B 4J3EA 4EREA 4ODEA 4LWTA 5LAZA 3LNZA 3TPXA 5C5AA 5AFGA 5HMKA 1RV1A 4J7EA 4QOCA 3V3BA 1YCQA 2LZGA 4ZYCA 3EQYA 4HG7A 4OQ3A 4JV9A 3JZKA 1V32A 4JVEA 4DIJA 3EQSA 3G03A 3JZQA 3FDOA 4J74A 2N14A 4JV7A 5LN2A 2Z5SM 4HBMA 3IWYA 1T4EA 3FEAA 3FE7A 4ODFA 4QO4A 4J7DA 5TRFA 4OCCA 2VYRA 3LBKA 5HMHA 3JZSA 3TU1A 4ZYIA 4ZFIA 3JZOA 4OASA 2MPSA 5LAVA 2RUHA 2N0UA 3U15A 1V31A 1UHRA 2MWYA 4LWUA 4LWVA 4ZGKA 4UD7A 3LNJA 4HFZA 1T4FM 2GV2A 4JVRA 3LBJE 3VZVA 2Z5TM 1TTVA 4OGVA 1YCRA 2AXIA 4OGNA 4N5TA 4JWRA 1Z1MA 4UMNA 3JZRA 4ZYFA 3IUXA 4UE1A 4IPFA 4ERFA 4RXZA 4JSCA 4OBAA 4MDQA 4JRGA 5HMIA 5LAWA 3DABA 3DACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MDN A;  3JZP A;  5LAY A;  4WT2 A;  3TJ2 A;  2N06 A;  3VBG A;  2N0W A;  4OGT A;  3W69 A;  3LBL A;  2M86 B;  4J3E A;  4ERE A;  4ODE A;  4LWT A;  5LAZ A;  3LNZ A;  3TPX A;  5C5A A;  5AFG A;  5HMK A;  1RV1 A;  4J7E A;  4QOC A;  3V3B A;  1YCQ A;  2LZG A;  4ZYC A;  3EQY A;  4HG7 A;  4OQ3 A;  4JV9 A;  3JZK A;  1V32 A;  4JVE A;  4DIJ A;  3EQS A;  3G03 A;  3JZQ A;  3FDO A;  4J74 A;  2N14 A;  4JV7 A;  5LN2 A;  2Z5S M;  4HBM A;  3IWY A;  1T4E A;  3FEA A;  3FE7 A;  4ODF A;  4QO4 A;  4J7D A;  5TRF A;  4OCC A;  2VYR A;  3LBK A;  5HMH A;  3JZS A;  3TU1 A;  4ZYI A;  4ZFI A;  3JZO A;  4OAS A;  2MPS A;  5LAV A;  2RUH A;  2N0U A;  3U15 A;  1V31 A;  1UHR A;  2MWY A;  4LWU A;  4LWV A;  4ZGK A;  4UD7 A;  3LNJ A;  4HFZ A;  1T4F M;  2GV2 A;  4JVR A;  3LBJ E;  3VZV A;  2Z5T M;  1TTV A;  4OGV A;  1YCR A;  2AXI A;  4OGN A;  4N5T A;  4JWR A;  1Z1M A;  4UMN A;  3JZR A;  4ZYF A;  3IUX A;  4UE1 A;  4IPF A;  4ERF A;  4RXZ A;  4JSC A;  4OBA A;  4MDQ A;  4JRG A;  5HMI A;  5LAW A;  3DAB A;  3DAC A; 
#chains in the Genus database with same CATH topology
 4MDN A;  3JZP A;  5LAY A;  4WT2 A;  3TJ2 A;  2N06 A;  3VBG A;  2N0W A;  4OGT A;  3W69 A;  3LBL A;  2M86 B;  4J3E A;  4ERE A;  4ODE A;  4LWT A;  5LAZ A;  3LNZ A;  3TPX A;  5C5A A;  5AFG A;  5HMK A;  1RV1 A;  4J7E A;  4QOC A;  3V3B A;  1YCQ A;  2LZG A;  4ZYC A;  3EQY A;  4HG7 A;  4OQ3 A;  4JV9 A;  3JZK A;  1V32 A;  4JVE A;  4DIJ A;  3EQS A;  3G03 A;  3JZQ A;  3FDO A;  4J74 A;  2N14 A;  4JV7 A;  5LN2 A;  2Z5S M;  4HBM A;  3IWY A;  1T4E A;  3FEA A;  3FE7 A;  4ODF A;  4QO4 A;  4J7D A;  5TRF A;  4OCC A;  2VYR A;  3LBK A;  5HMH A;  3JZS A;  3TU1 A;  4ZYI A;  4ZFI A;  3JZO A;  4OAS A;  2MPS A;  5LAV A;  2RUH A;  2N0U A;  3U15 A;  1V31 A;  1UHR A;  2MWY A;  4LWU A;  4LWV A;  4ZGK A;  4UD7 A;  3LNJ A;  4HFZ A;  1T4F M;  2GV2 A;  4JVR A;  3LBJ E;  3VZV A;  2Z5T M;  1TTV A;  4OGV A;  1YCR A;  2AXI A;  4OGN A;  4N5T A;  4JWR A;  1Z1M A;  4UMN A;  3JZR A;  4ZYF A;  3IUX A;  4UE1 A;  4IPF A;  4ERF A;  4RXZ A;  4JSC A;  4OBA A;  4MDQ A;  4JRG A;  5HMI A;  5LAW A;  3DAB A;  3DAC A; 
#chains in the Genus database with same CATH homology
 4MDN A;  3JZP A;  5LAY A;  4WT2 A;  3TJ2 A;  2N06 A;  3VBG A;  2N0W A;  4OGT A;  3W69 A;  3LBL A;  2M86 B;  4J3E A;  4ERE A;  4ODE A;  4LWT A;  5LAZ A;  3LNZ A;  3TPX A;  5C5A A;  5AFG A;  5HMK A;  1RV1 A;  4J7E A;  4QOC A;  3V3B A;  1YCQ A;  2LZG A;  4ZYC A;  3EQY A;  4HG7 A;  4OQ3 A;  4JV9 A;  3JZK A;  1V32 A;  4JVE A;  4DIJ A;  3EQS A;  3G03 A;  3JZQ A;  3FDO A;  4J74 A;  2N14 A;  4JV7 A;  5LN2 A;  2Z5S M;  4HBM A;  3IWY A;  1T4E A;  3FEA A;  3FE7 A;  4ODF A;  4QO4 A;  4J7D A;  5TRF A;  4OCC A;  2VYR A;  3LBK A;  5HMH A;  3JZS A;  3TU1 A;  4ZYI A;  4ZFI A;  3JZO A;  4OAS A;  2MPS A;  5LAV A;  2RUH A;  2N0U A;  3U15 A;  1V31 A;  1UHR A;  2MWY A;  4LWU A;  4LWV A;  4ZGK A;  4UD7 A;  3LNJ A;  4HFZ A;  1T4F M;  2GV2 A;  4JVR A;  3LBJ E;  3VZV A;  2Z5T M;  1TTV A;  4OGV A;  1YCR A;  2AXI A;  4OGN A;  4N5T A;  4JWR A;  1Z1M A;  4UMN A;  3JZR A;  4ZYF A;  3IUX A;  4UE1 A;  4IPF A;  4ERF A;  4RXZ A;  4JSC A;  4OBA A;  4MDQ A;  4JRG A;  5HMI A;  5LAW A;  3DAB A;  3DAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...