4ESHA

The crystal structure of thymidylate kinase from pseudomonas aeruginosa pao1 in complex with deoxythymidine.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
211
structure length
207
Chain Sequence
b'NAMTGLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIGLARGRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLERLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title The crystal structure of thymidylate kinase from Pseudomonas aeruginosa PAO1 in complex with deoxythymidine.
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 83
structure length 207
sequence length 211
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4eshA00
5JSZA 2ZR0A 1VYVA 3GD7A 1KO5A 2EW1A 4TTPA 3CPHA 4S2EA 5FL3A 1HEIA 1Z06A 2RGBA 2EQBA 1OXXK 1TX4B 3PEWA 2CEAA 1WB9A 1R4AA 3PR1A 4B35A 4WVFA 4B3BA 3MJHA 1GFIA 4JS0A 1MRNA 2FZLA 4FCWA 5J4YA 4JT4A 1R0YA 4BRUA 1M7HA 1UBCA 1DOAA 1GVNB 2HXSA 2G1KA 1G6HA 2GCPA 3A4MA 5K8LA 4H9GA 2VP6A 3OESA 2ZRNA 4TL8A 1LS1A 2BEKA 2R62A 1P3JA 3EXAA 1US8B 1W1WA 4HDQB 2GJ9A 4NYMQ 4US0R 1IXRC 5HKKA 4XVQA 4ZO4A 5GVSA 1DS6A 2W0SA 4LJ9A 1IXZA 4NYJQ 3GLFA 1J2JA 1XEWX 4XSGA 4BZXA 4YMUA 3AF4A 3CF2A 1CR4A 3IO3A 2PCLA 1Q1ZA 4HAXA 1ZNZA 3DEFA 5E7MA 1U8AA 3UPUA 2O8FB 2H18A 1E2FA 3PEVA 3F5FA 4GMXA 2E1RA 2QTFA 1JR3D 4JBWA 4IXNA 4UXHA 2AL7A 2OBLA 1F2UB 2FMXA 1R0XA 1UBGA 1Q21A 1ZM4A 2R6AA 3U3RA 4RSGA 2R8RA 3UMSA 3VX3A 2BV3A 2QZ4A 2JAQA 3C15C 4Q4HA 1HTWA 1SVKA 4URWR 4TLDA 2RH5A 1Q3TA 3ZLJA 1FX0B 4P32A 3GLGA 1IHUA 3HU1A 4BLQA 3K70D 1XJQA 4Y0AA 1RPZA 4GRAA 1E1QD 1Z3IX 2PL3A 2ZAMA 3L0OA 1P2TA 1FNNA 2I4IA 2BMEA 2WMNB 3QY0A 4NYMR 4AI6A 4GZMA 2EFCB 5L8VA 4HLUC 2ZYVX 1CLUA 3W6PA 3EWSA 5JBQA 1S1MA 1Z6XA 1OH6A 1QZXA 5HPYB 2D7DA 1YRBA 2MSCB 1KI6B 1TQDA 1VCOA 2KSQA 1GAJA 3GJ3A 4JLOA 4CEJB 2W58A 4AYWA 2QAGA 1KK3A 4TSFD 2JASA 2J5XA 1LV7A 1BIFA 3BB3A 2DFTA 3DVLA 3MMPA 3VNVA 3CX6A 6Q21A 3ZH9B 2FEOA 4Q02A 3BB4A 1AS3A 3SBDA 1W36C 3SOPA 2O8DB 2F43A 4R7ZA 3SR0A 3TBKA 2AD1A 2BKEA 2IYRA 3AM1A 2DB3A 1MR3F 1W48A 3H2YA 3FB4A 3A1UA 4P3YA 4DUGD 5KPJA 5IF9A 1SZPA 1T6NA 1E69A 3W6OA 1RVDA 4JLPA 4RZ3A 2ZTSA 3KFXA 2PEYA 1YZTA 3NHAA 4K46A 1UF9A 1Z0FA 1XDBA 4B3FX 3U7EB 2YOHA 4MUBA 2D4HA 3L0SA 2G9NA 2H8KA 1NNEA 3RC3A 2W6IA 5SZIA 4C0AC 3BRWD 1T3SA 2X19A 1PVOA 4A2QA 2NZJA 1N0UA 1U9IA 8OHMA 3EZ6A 1CBUA 2BM1A 3T35A 1X6VA 3KB2A 3MWLA 4V0LA 1Y63A 1BMFD 3VR3A 5K8TA 4P4SB 1SKYE 2H7VA 1R5OA 1JALA 2ZJBA 5EP1A 4EIWA 1XD9A 3P20A 4RKFA 4NE2A 1DAIA 2W2XA 2OSBA 1FP6A 1H65A 3KDSE 3VAAA 3ASYA 5FL7A 2GJKA 1R2QA 2UZ3A 3KZ1E 5P21A 3A1VA 4ZIRB 1F2TA 1JEDA 1R7RA 4JL8A 3VKWA 3B60A 1T0JB 1JQJC 4L8GA 1ESNA 2DR3A 4AG5A 3OIWA 3GLIB 2H16A 2PT5A 3SYNA 3RS3A 4S35A 1YR7A 1VMAA 1CIPA 3ETLA 4XOIA 1GKYA 1R0WA 5DYGA 4YONB 3WHLA 3J81k 1OSNA 4IKEA 3MRSA 1ZD8A 1D6JA 1TAGA 2UZIR 3EASA 3CR8A 1TQ6A 3WMGA 3U44B 4A0RA 1JXOA 1IAQA 1W4AA 1JR3E 3MG9A 2H1LA 2W00A 3VHXA 2BJWA 3A1SA 4B73A 3IPYA 3RLFA 2WAXA 3U60B 1XRJA 5HTKA 2ZRCA 3LO5A 4EAQA 4QNMA 4RFVA 2PX0A 1P2UA 3EC2A 1VYTA 3IPXA 3HP1A 4ZCIA 2QBYB 3L43A 4ARZA 2OZEA 4DLRA 1L2TA 1GITA 3BFXA 3I8SA 3W34A 2ZE6A 5GJVC 4C0HA 3ICQB 1AS2A 4YMSA 3B1YA 1CR2A 3LA6A 4PO1A 1E2QA 2ZRLA 3FPAA 4FMBB 521PA 3UIEA 3GMTA 4PO8A 3SQXA 2VIIA 2RGGA 5DSZA 4ZCMA 5DISB 3U3MA 3FVQA 4WXRA 3VKHA 4QHTA 5BQ5A 5CLQA 1N0WA 4DT1B 4FCVA 2CNWA 4J0QA 4KYIB 2P2LA 1XCMA 4LCBA 1F6BA 1OIXA 1OYYA 2D74A 2XOKA 3BOSA 1K5GA 5FPYA 2VSXA 1DAHA 2YC2C 1SXJC 4PFSA 4GOJA 1OV4A 3QKSA 2ZI5A 4KHZA 1B23P 1W46A 4AG6A 4BZQA 3L82B 5SZHB 3R8CA 2QM7A 1SVIA 3SJZA 2CE2X 3NXSA 4R98A 4NTZA 4EPYA 1XD8A 1XNJA 2A2ZA 4YC7A 4Z54A 4OJQA 4LC0A 1CRPA 1Z0KA 4C0KA 3ZDQA 3TAHA 4DKXA 4MRVA 2A5JA 2ZUDA 3JZAA 1NI3A 3BAFA 4HDCA 4DB4A 1G5TA 2ZYWX 2GJ8A 2GETA 4KODA 4UXIA 5JJIA 5A5GA 5JLJA 4QFMA 4QHYA 1Q20A 2HUPA 3UATA 3H84A 2W0MA 1OE0A 1JPNA 3LQRA 2ZSFA 3B2EA 1QBKC 1BS1A 3AKYA 4FMDB 4TQAA 3L0PA 1OXVA 1E9RA 1Q57A 2RMKA 4E03A 2GCOA 2OAQ1 5FFMA 2VHCA 2B92A 1WBBA 2EFEB 3IO5A 2IUTA 5AK0A 2KI5A 5FTJA 3B1WA 2JLWA 1XU4A 3NBXX 3MD0A 2A5DA 1H8ED 1S0UA 2O8CB 5JMTA 3NBYC 2J0QA 1YZGA 4IDNA 3RSOA 1N5JA 2J0VA 4DZZA 3CIOA 2XXAB 1YR6A 2OM2A 5FBVB 1C4OA 2AFIE 3NBFA 4XSHA 4HSEA 5JS7A 5EP3A 1B0UA 1E32A 4GNKA 2C8VA 3QJYA 1I4DD 4DLZA 1HQCA 1N5KA 2X8AA 3GEHA 3QXHA 1Z8FA 2OILA 2VBCA 5FOTA 3RWMB 4A2PA 4B32A 4QL3A 5AJWA 3MCAA 3OZXA 3I4LA 2B7BA 1E2KA 5FBLB 1TF2A 5EUMA 3Q3JB 3QPVA 3TAUA 5HKKD 5KSZA 2EU8A 4K8OA 5A4JA 4RFSB 1SXJE 5KNCA 3AVTA 2YWHA 4MGYR 4Q1EA 4AKEA 4BFTA 4WXPA 4C2UA 4XD7D 3U5ZB 2BMDA 2F1HA 5JJKA 4NONA 3I92A 2CJWB 3OEEA 5IDVA 2ZI3A 2ZRIA 2IWHA 2ZJ5A 3VR1A 1D2EA 1DEKA 2OBNA 3X1YA 4D6PA 3SHFA 2CLDX 2O5VA 2IS6A 2MSDB 4QKQA 1FNMA 1OXSC 3RS7A 1CR1A 1M7GA 3F8TA 2CCJA 4W7SA 2D06A 5FOVA 1RJ9B 2I3BA 1NIPA 2IHBA 1E2EA 2NQ2C 4DIDA 2W2VA 4BFYA 3LFUA 1XPOA 4D4KA 2O8BA 1QHHA 2FJUA 3O8RA 4URYR 2CL7X 4JKIA 2ZANA 3G0HA 5HE8A 4DEXA 1XCPA 1VHTA 3LRPA 1OH5A 4WZ6A 5C1BA 4LV5B 3OEHA 3EZ9A 3MUFA 2XTNA 2E87A 2P65A 4XH9B 1XJ0A 1FUUA 2IYUA 4GP7A 5GJCA 2RGNC 2JLZA 3EIHA 2Q0HA 3K0CC 4OQFA 4OYHA 1KAGA 2N46A 4M8NE 3CF6R 3T5GA 4A8JA 3CRQA 4QBHA 2NPIA 4CVNA 5JS8A 2WM9B 2WBLC 5FTNA 5JZVA 5C46F 2ONKA 1TMKA 1W4BA 3LX5A 3AVWA 4Q9KA 3QG5A 3W6NA 4D82A 4B6FA 4DCSA 1E0JA 1YVDA 2H57A 4WBSA 4DCUA 4EPXA 3GQBA 1ZUNB 2ZYUX 1Z28A 3BS4A 4PHFA 3THYB 3X1WA 4D26A 2HF8A 2C96A 2ZQ5A 3LLUA 1N25A 5CM8B 4NH0A 4Q1AA 2HYIC 3ZJYA 1SKYB 2VP2A 5FUVA 3UWOA 2W83A 2A5FA 4M1YA 4PAOA 3EPJA 3RAPR 4HUTA 4DBLC 3NWJA 2AKAB 3CO5A 4B48A 1XD2B 3CW2A 3C7KA 3NG1A 4A0FA 5M04A 3KFVA 1JB1A 2ZYTX 1XXHA 3PVSA 2IXEA 2JLQA 3H4MA 3QXSA 3U6BA 2W6JD 1PLKA 4OHWA 3WBJA 1NSFA 4LY6A 4KVGA 3CRVA 1P9WA 1Z2AA 4QRHA 4Q47A 4MDFA 3A6PC 2F9MA 5KDDA 2GCNA 2QM8A 2RGDA 1QHYA 5C2JB 2WZQA 1LW7A 2OO7A 2P6NA 4PHTA 1CEEA 4DEYA 3NDBB 3B8HA 4FWTA 1XP8A 5BYJA 3IIMA 1SULA 1G19A 4LJ7A 3UK6A 3K9HA 3I32A 3AV0B 1SHKA 5EP4A 1JJ7A 4M9ZA 3U4QB 4D4LA 4NKRA 3GLFE 5A0FA 1UKZA 4FMCF 1E1QA 2EYQA 1DAEA 4EQ6A 5CB8A 1NVUQ 1T5IA 1WQ1R 2A30A 3QVUA 1RFLA 2IYWA 3KL4A 2YJTD 4CEHB 3K8YA 5EXTA 4XTCS 2KBEA 2YWFA 2A3RA 3EWAA 5J4LA 1KI8A 1KJZA 3B7GA 1LS6A 2FSFA 2FE4A 1P9NA 4Q4AA 2DFKB 2WPDA 4YMWA 1XMSA 1JJVA 4A9AA 2DCUA 2ZE7A 4HUQA 3FOZA 1GP2A 3SJAA 1M8PA 1G17A 4P4UA 3SHWA 2GVZC 1GZSA 3Q72A 3ZQJA 3BJIC 4HZUA 1UAAA 4KBGA 3BFVA 2O0JA 4FI3C 4KAXA 1A5TA 1E1RA 5CIWA 1HV8A 4MKHA 2ZXUA 2FN4A 2O8EA 1OXUA 4Q1DA 4WA7A 5KNDA 4V03A 1WF3A 5IK2A 4A92A 2WTUA 2ZSEA 1W44A 4DCVA 4I99A 1VTKA 1I4TD 4OI1A 4FW9A 3RS0A 2JCSA 1P61B 4DCNA 3ASZA 3EC1A 2CE7A 2QPTA 4NL4H 2A5GA 1RZ3A 1MRSA 4KV9A 4OK5A 2CNWD 4Q7LA 4B2LA 5AUNB 2J46A 3AF1A 4Q7MB 3RHFA 1T9HA 1ZVQA 4KO8A 4DDVA 4A36A 2GXAA 3CNNA 3ZVLA 2UVQA 2VO1A 2N42A 1AK2A 2D3WA 2XSZA 3KTAB 1N6NA 3K09C 4F4CA 5BN3A 4XJXA 2AR7A 2DWPA 3MJRA 4HLCA 421PA 1KKLA 1NP6A 4URXR 1ZMXA 4JLJA 1RRPA 5E4FA 5L3RA 1RRFA 1IONA 4NDZA 2PCJA 2HXYA 3SU8A 2PZFA 3RNLA 4PSAA 1P4SA 5BXQC 2C77A 2J7PA 4PPNA 3BBPA 1VPLA 2QPOA 3WNBA 4NBSA 1SGWA 2IBMA 3AGQA 3U7FB 3B78A 1QDEA 2G0NA 3LD9A 2G3YA 3N5CA 3BERA 2RKOA 2AWNA 1NBMA 3C4JA 4RJLA 3JVUA 3GJ6A 2JLXA 1VG0B 3ECCA 1W2GA 3TVDA 2ANBA 1ZM2A 4IDHA 1VCIA 2QRZA 3CZPA 2QMOA 3FYHA 1G8YA 1ODFA 4OQMA 4CT5A 4D4JA 4TWZA 3S1AB 1TF5A 2VYFA 5JI3E 4PC6A 4HAZA 1QF9A 3I61A 1SXJB 3G5UA 4HYYA 1H8HA 1OFHA 3ZD6A 3IEVA 2EWWA 1PV4A 4PTLA 1Q1EA 2C9OA 4Q18A 2VLIA 2KWIA 3V4RA 2V7QA 2GZDA 3QNUA 2G77B 3RRMA 3W8RA 4IDOA 3TJZA 4GPTA 4C2TA 1YQTA 1EG7A 1GL6A 1XZPA 4KFSA 2CMKA 4LJYA 2BC9A 2N1BA 1ZP6A 3VU9A 3REFA 4Q9HA 2BMJA 2ORVA 3AUYA 3GJ8A 3K0AA 4L4UA 1A1VA 1P6XA 2QY9A 3WMFA 2JATA 3OEED 2WOJA 1XMIA 4Z8XA 4AKGA 4O25A 4RZXA 1Z5ZA 4CDGA 3RABA 2IYXA 4IFEA 1AZSC 5EJEA 1NY5A 3C8UA 3OIYA 3LAWA 3THWA 4DLSA 2ZSBA 1KK0A 4IDPA 2IUSA 1GTVA 4Q4JA 4AIIA 2IYVA 1DAGA 4ACAA 4M53A 1NG1A 2ZUCA 4IHQA 3TRFA 1AGRA 1G8HA 1K6MA 1R8SA 1ZBDA 3HJNA 3UKDA 1U2RA 1L7VC 2GZAA 3C14C 3B1XA 2FNAA 3K0SA 2WV9A 4M1KA 2EFDB 1Q1QA 5KDOA 2W2TA 5IT5A 4L15A 1JQLB 4GMDA 5HZKA 5FTLA 1E2JA 3N2EA 3QIAA 1TQ4A 5KSPA 3OEHD 5JFGA 1XTKA 3IBGA 2D2EA 1BYUA 1G5RA 1A82A 2BWJA 3MWJA 4PC7A 4DCTA 2OV2A 2JGNA 4Q4LA 4F93B 3QKUA 4W5HA 1E4VA 3IILA 2AWOA 4OI0A 5JHGB 4Q00A 3F3YA 3SJBA 2F1JA 1KAOA 1BKDR 1ZAKA 5EXPA 3VQTA 3KJGA 4AWXA 5B2ZA 4IOJA 4I1OA 4D80A 5K8UA 4JLAA 5JSZB 1M1YE 1JI0A 4IVRA 4XWKA 3CBQA 2BEJA 2ZI7A 1VG1A 2ZJZA 3W5JA 1FZQA 2BCJQ 3TUIC 2Z6VA 5KSOA 3T06B 1U8ZA 2ZI6A 4XVRA 2GEUA 4LSGA 2F7SA 1WDTA 3A36A 2ORIA 2ZAOA 1XEXB 4RZ2A 4Q1BA 1GUAA 5FBQB 2QP9X 3WHKA 2Q21A 3L8ZA 4LWZA 5CITA 5D3MA 4XD7A 5BW8A 2O52A 4B2IA 2WJYA 4HB2A 4JBXA 5FUYA 3R9IA 5EE5B 1C9KA 3KKOA 1NY6A 4LYHA 4MGKR 1I2DA 3K9GA 2XTMA 2R9VA 2QT1A 2VQSA 2CK3A 2D7CA 4K81B 3GLFB 5GJBA 5BYKA 5TARA 4BFSA 2GRJA 1OF1A 4RD4A 2HLDD 4KXFB 1VIYA 2D62A 4C3ZA 5LBIA 2YNMA 2YC4C 4JJZA 2ZRHA 2HT6A 3ZZUA 3QOFA 4G5OA 3EPLA 3HR8A 3H1TA 3LDAA 4V0NA 1ZCBA 1ZIPA 3CWZA 1UKVY 3AKCA 1HY3A 3U6KA 4BFWA 1COWA 1F2UA 1EFTA 1MO6A 3D8BA 3P4XA 3ZIAD 1RYFA 4FIDA 4ASUA 1G291 1RYHA 2P67A 3AVOA 3AF0A 1U0JA 1ONBA 3QBTA 3FWYA 3G82C 3VR5A 4Q4HB 2REBA 4ON9A 2VHUA 3WNDA 1QRAA 2VEDA 1XEFA 4BFUA 1WRBA 2ASEA 2BBWA 4RVCA 3WMEA 1FX0A 2GBLC 4QNRA 3ADKA 3Q85A 5FOXA 3LNCA 1W4CA 1SKQA 3I3SR 3GLGB 3ZVMA 1XX6A 2V54A 4ESVA 2OCPA 3QEOA 3MGCA 4EUNA 1R8QA 2DY1A 2IYLD 1OYWA 3EPKA 5FBWB 1E2MA 2WPDD 3KJHA 4B47A 2WWXA 1KI6A 5G41A 4BLOA 1OFUX 4O0MA 3QXXA 4V0MA 4CEJA 4UJ3A 2R44A 1FP7A 1KKMA 2ORWA 3QKRA 2QAGB 1HA3A 3IUYA 4YMVA 4TLCA 1J99A 1E1RD 2JJ8A 2OFWA 2KB0A 1G7SA 2LCFA 2Q9AA 4CRWB 4UNNA 1QHIA 1UEIA 1DELA 4LYAA 5DIFA 4NZYA 4ZCLA 1OIWA 4EJSC 5IK2D 1OXTA 2ZRAA 2IEZA 2O8DA 3K70C 1FMJA 4L9WA 1NN5A 1RC8A 1DAKA 5LB4A 4AYXA 2VSOA 4II7A 4L5BA 5L3SA 5SZKB 1S9HA 4OQXA 1NVVQ 3CONA 2NTYC 1G41A 1LNZA 2PT7A 3GLHA 4B3GA 4AYTA 2W6JA 1II8A 1XTQA 1E99A 1OJLA 4BUJA 3ND8A 1JNYA 2Q9CA 1EFUA 2QMEA 2XTZA 3HPRA 2GA8A 5D3QA 2BIFA 2FSGA 5EE1A 5G40A 1KMHA 2R6FA 2HF9A 2XSZD 1YHNA 1YRAA 4TN1A 3FFAA 5KPDA 4M1WA 2A5YB 2QENA 4BGDA 3NC0C 2V9PA 5J4KA 3FKQA 4MRNA 2ERYA 4PHGA 5CJ2A 4XWOA 2HJGA 3SJCA 5KSYA 3HR7A 1G1MA 2OESA 2VHTA 4HDOB 4X8HA 1PLLA 2PBRA 2GTPA 5DHFA 3BGWA 2FDCA 1D9ZA 2DPXA 5KU1A 1U8YA 3T15A 3KJIA 3BH0A 1N6PA 1VG8A 2J7PD 1RW4A 2JIZD 1KJYA 2RGAA 1IY1A 4Q21A 1F2TB 1FL9A 2J0SA 2Y8EA 2I1VB 4Q03A 2EFGA 3UWKA 1NVVR 2V3CC 4BFXA 3FE2A 1N6OA 1NBMD 2NO7A 1W7AA 4IEIA 2QGZA 5EXXA 4LRWA 1U90A 4NP6A 3AVYA 2ZITA 1KO4A 3OE7D 3VHLB 2GXSA 2DHRA 4PPFA 1TEXA 1G7TA 3A1WA 3U44A 3FMOB 3ICEA 3BD9A 2A78A 3QQ5A 4QGGA 3KQUA 5JWOA 4P0TA 2J3EA 1H8HD 4OL0A 1TU4A 1YZKA 5J5CA 1HUQA 4TT3A 3QENA 2XB2A 2R6DA 3AF2A 4M0LA 4OK6A 2V7QD 1XBTA 5FBRB 1AZTA 2IEYA 5JEDA 4C4PA 5FPSA 2FF7A 4B44A 5DI3B 2DBYA 1E9DA 1N0VC 2A7QA 4LHWA 1Z0AA 5TY0A 2QA5A 2IYYA 4IJMA 1EX6A 1AN0A 4JVSB 4UQOA 4CF7A 4MRSA 3C16C 4RCZA 2ZI4A 4GDFA 2QQEA 3LLMA 5DLQC 3RVBA 4OQLA 3CF0A 4PZYA 4DT1A 1GKUB 2CCGA 3GJ5A 1HURA 1UDXA 2ZVQX 2VH5R 4TYNA 2QMHA 2GF0A 3I1FA 1Q1BA 1GM5A 4B33A 2UKDA 3P32A 4FD2A 1VDZA 5AJVB 1HE8B 4NHOA 4G1UC 3VR2A 1L4UA 3CRRA 1G8GA 4TL7A 1D2NA 2Z43A 4KFTA 3W9YA 3BH7A 4MGZR 1IBRA 1II9A 4RD0A 3PJRA 3ZYCA 4MYUA 2C95A 2GXQA 2PZEA 2Z0MA 4PQFA 2BMFA 3PUYA 3EAQA 3QPUA 3TSZA 2CXXA 1R5BA 1NIJA 2QL6A 4YXWD 3A4LA 5SZJA 2DFLA 5JWRA 1XF9A 3D7MA 3AVVA 3AVXA 1Y3AA 1DPFA 2WMOB 2ONJA 1FTSA 1CJVC 2FX3A 1V5WA 2GAAA 2WICA 4BLSA 2NO1A 2XEXA 3NIBA 2VHQA 5J4VA 1O87A 4A2WA 4TLAA 4AURA 3T1TA 2V1UA 4ACBA 1KO1A 1NLFA 5H8WA 4LJ6A 3ND9A 1SHZA 3TGPA 5TVKA 1IN4A 2YYZA 2DWQA 1YE8A 1U94A 4LDJA 1AQUA 1OB2A 2HT1A 2QNRA 2OAP1 3M4YA 3V00A 4YQFA 2LKDA 3SNHA 1PUIA 2B21A 2O8BB 4IRUB 3DM5A 3WXMA 1CRQA 1TU3A 2PJZA 2ZS7A 3PITA 4JSYA 4ZDIA 1DG1G 1IN7A 1YR8A 3WYFA 2PJRA 2QTVB 4DLYA 1KSHA 4KSBA 4KBFA 1S8FA 1GNPA 4LJ4A 2H17A 2ZU6A 4B43A 5AWFC 4DIEA 3LV8A 1E94E 4RFSA 2JLVA 4LUCA 1CF4A 2VF8A 2CK3D 2QMUA 3TR5A 3QSYA 1KMQA 3FHCB 5FPKA 1DG3A 4FCTA 2CJWA 2GJSA 2J9RA 4HB0A 1CR0A 4WIAA 2PLFA 1IXSB 4US2R 3F0TA 4G5GA 2FA9A 4CW7A 1E9CA 1RE0A 1VCMA 1CKEA 1YZLA 3Q5EA 5KHOC 1COWD 1GIAA 4H1UA 1P60A 4ASUD 1CS4C 2FGKA 3QF4A 4TYYA 4Q9LA 4LHZA 3U3JA 2IWRA 4Q7JB 4AKHA 3WP1B 2K5UA 2ZM5A 3AVUA 2G6BA 2FFQA 3BIFA 5FOSA 3LY5A 1TQ2A 4M1SA 5FPTA 3E70C 2FPKA 1UBEA 1SVOA 2NIPA 1DBSA 5J40A 4FXPA 3FGNA 2ZS8A 4KITB 2P5SA 4IOLA 2X77A 4DSTA 1DADA 4KCGA 4KSCA 3AKDA 4B71A 5CYOA 2WIBA 3AP3A 1XMJA 5EE0A 1W49A 4C7OA 1XFAA 2ZRMA 4ITRC 4A0HA 4F38A 4A8JB 1K5DA 5TXGA 4DJTA 4GP6A 5FPHA 2NO0A 3FMPB 1W4RA 4G5RA 2XNDD 4NCIA 4LV8B 4HZIA 2QPAA 3AVQA 4HLQB 4PSKA 2C78A 1E9AA 1S2MA 1DARA 4DB2A 1N5IA 4HAYA 2ODEA 1T8TA 1AS0A 1RRCA 3U61B 1E2LA 2FSHA 1PUJA 3I73A 2R6GA 4N0EA 2RAPA 3RRNA 3A1TA 3DKVA 1W0KA 4TL9A 5CJPA 2XZPA 1X3SA 4Z51A 4C30A 2C5LA 5J47A 1CULC 2LKCA 3HYRA 5LB2A 3OIVA 2QAGC 3DMDA 3M6AA 1CJUC 1Q12A 3BB1A 5H68A 3KXIA 3KQNA 4IW3B 3OAAA 3HPQA 4JVLA 2HLDA 3B9PA 5L3QA 1JAIA 2WKRA 2ZSDA 1NKSA 3LBNA 2NGRA 3ADCA 1K8RA 1XXHB 2ATVA 4MDEA 3EIEA 5CIQA 3TQFA 3FDIA 3ZD7A 4D25A 4OHYA 4M1OA 2IX3A 3R7WB 2AN9A 4UNRA 1MT0A 1N6LA 2ODBA 4P4TA 5KDLA 3Q5DA 4TQ9A 1TNDA 2OFOA 2J0UA 1GILA 3ZIAA 2J59A 1IY2A 4V0ME 4CEIA 5TB5A 4QJ5A 1X1SA 2FU5C 3L0IB 2RGXA 4I81A 2ZJ2A 2J1LA 1MKYA 4RCYA 3N70A 2NPFA 4EJSB 5LPNA 1HT2E 4QOSA 1A4RA 1NKTA 3RS4A 1SVMA 5DE3A 5F9HA 3K70B 1U9IC 5G3ZA 4UNQA 2ZE8A 1OHHA 1NL3A 1HQYE 3B9QA 4Q9JA 1XTRA 3LVRE 3O47A 1G16A 4EDHA 2VA8A 3C41J 3CWQA 4ILEA 3GJXC 4ESHA 2VHJA 3AH8A 3QPWA 3MWKA 1OB5A 3GJ0A 4AC9A 3EZ2A 2DWOA 2Q9BA 4PPQA 1UEJA 2L0XA 2J41A 3AVPA 3OIUA 3AP1A 1UKEA 4LJAA 1G7CA 2OBMA 1SVLA 3SFVA 1AJEA 2BVNA 2J87A 4Q4AB 2ZR9A 2F55A 2Z4SA 4CIDA 2IYZA 5B64A 1FUKA 4HUQB 3GLGE 4QM6A 2IA5A 4TT3D 4LGMA 2GEDA 3M1IA 3IIJA 1UBFA 4KFUA 4C0SA 2QRNA 2IS2A 4HZUB 5KYKA 1DO0A 2J7KA 2Z83A 5BN5A 3FKSA 1IN5A 1N3BA 1Z2CA 3ZS9A 2RGCA 1D2MA 3M0EA 1A2KC 4TTRA 3TW4A 2O8EB 2X2FA 4NCHA 1OLOA 1KO7A 3WYAA 1M6NA 3AKEA 4FMDF 4OBEA 3KKQA 3QG1A 1FOEB 4RD1A 4LK2A 4LYFA 3SS8A 2ZJYA 4E5UA 4QM7A 4A0GA 2YZ2A 2WSMA 5KUTA 4MYTA 4G01B 2FZ4A 3RS5A 3CKLA 4A6XA 4GI7A 4KVAA 3U3KA 4TYWA 3VNUA 3T1VA 1KSGA 3T1OA 1EGAA 1Z08A 1JECA 4PX9A 2GK7A 3TNFA 3KKPA 3KTAA 1KY2A 4XIGS 4LJ8A 2ZR7A 1GDDA 1KI7A 2ZROA 2ZRJA 4U00A 4GFDA 5DH9A 2NG1A 2A9KA 2JIZA 3ADDA 5FR1A 5JCZA 1ZNYA 4M9SA 1UJ2A 2VF7A 1L4YA 5G53C 3GLHE 2BJVA 1T0HB 2CL6X 1Z0JA 2MMCA 3EX7C 4HAVA 4LHVA 4G0NA 4I1UA 3MLEA 1MABB 3IKJA 2PH1A 1PZNA 4TYQA 3OE7A 4X8MA 4P33A 1E0SA 3CZQA 3CH4B 3IHLA 3LW7A 2WKQA 4TLBA 1KNXA 2G83A 4B3DA 2F3TA 1E9SA 1DAMA 4JSTA 3KXKA 1JXMA 1G64A 3LXXA 3NEJA 4IVPA 3Q9LA 4QJ3A 2JJ1A 3NVAA 1CXZA 2HDNB 2OCBA 2OHFA 4URUR 121PA 3VX4A 4YMTA 1FQJA 2ZE5A 4M9QA 1OKKA 5HCIA 3TVTA 1FMLA 1NMYA 4MKFA 5EZ6B 4JL6A 1Z6GA 3B85A 4JIMA 3THXA 2IF0A 1SXJA 3KKMA 5TMPA 4ZI3A 1LVGA 3BFKA 3K0FB 2BHRA 1XWIA 3TUZC 4JZKA 2IS4A 5DI9A 1Q3HA 3HWSA 4HB3A 2P5TB 4C0BA 4BE7B 4XVUA 5IRCD 1A2BA 2ECKA 4DC9A 4PC3A 5JHHB 1E9FA 3QUSA 1KI2A 4GSYA 3GCGA 2PEZA 2RHDA 1YU9A 2ZI9A 1FW6A 1KDOA 1Q22A 2F1IA 3TH5A 3TQCA 1DAFA 3K0AB 4ZV4A 3AGPA 2P0EA 4KI0A 4C9BA 1EWQA 5TV2A 1NN1A 2EYUA 4W5JA 4M22A 5DGXA 4BPBA 1YZQA 2WJVA 2QROA 1Z47A 3DDCA 4BLPA 4AKIA 1GOTA 4MUAA 4WZBE 3THWB 1Z6YA 1OPXA 1HT1E 3DMNA 5HZHA 4NCJA 3LXRA 3RRZA 3SZRA 1P7CA 4YXWA 5E7JA 3TR0A 4C0LA 2GDJA 4M1MA 2QP4A 4F91B 1E6CA 3WP0A 2ZIAA 1GL7A 1ZUHA 2ZRKA 3W3ZB 1KZGB 3CB4A 3WRYC 2JDID 3TMKA 1N6HA 3EARA 3D31A 4OQNA 2QGNA 4BLRA 2ZETA 1S9DA 1G18A 1QHXA 1W0JA 2WJIA 2YHSA 2B8TA 2H92A 1KTVA 3ZS8A 4E09A 3TW8B 4LI0A 1YZNA 1O3YA 2J45A 1NMXA 1IN8A 1VG9B 2GK6A 4PZZA 5L3VA 2WOOA 3PQCA 5E7IA 4F7WA 2WWYA 2IS1A 3AB3A 1T5LA 3D6TB 4N1AA 3KJEA 1W2HA 4RD2A 1KSFX 1T3LA 1VIAA 5CK4A 4OK3A 1P2VA 3O8BA 1LB1B 4OHXA 2V6JA 3NEYA 1G3IA 2XAUA 3IHWA 4OI2A 4UNPA 1VKJA 1AA9A 1W0KD 3CRW1 3W90A 2NO9A 1US8A 1CJMA 1XJCA 2FPMA 3QI2A 1KDTA 1MOZA 1XEXA 1KDPA 1PJRA 3LBIA 3V9PA 1P62B 3NDPA 4JMPA 4A8JC 4US1R 1KI9A 4P31A 2P6RA 2WJGA 3OAAD 1VHLA 3UANA 2XZOA 1ZU5A 2XNSA 5D3MB 1KSJA 3FMFA 4PANA 2O8FA 2JJ2D 4PSVA 4PR0A 1J7KA 4BEJA 3K1JA 3KUDA 3SE0A 1R5NA 2WHXA 1ZNWA 5AUOB 5FOWA 4GL2A 4TMVA 1X8KA 1ZINA 1WMSA 5E95A 3TKLA 2RGNA 3VR6A 1F3OA 1RIFA 1GG2A 2FG5A 2QE7A 1OH8A 2HYDA 1AQYA 1NVXQ 3GFPA 2WVJA 1YKSA 3K0CA 3LBHA 3BORA 2FWRA 3GEEA 3WY9A 4JYCA 1KY3A 3B82A 3H0KA 5DN6A 4BQSA 1Z0IA 2QP3A 1J90A 4G5SA 4Q66C 2QTHA 2VSFA 3SI7A 3W3AA 3ZVNA 3BE4A 4E22A 4LV6A 1W36D 3CUEF 3KX2A 5BN4A 1NRJB 5DO9A 4MQBA 1ESMA 3EIQA 3VFDA 1OHHD 4BFZA 4Q48A 2GXUA 2ZS9A 1T3HA 2MSEB 1OIVA 4RY2A 5AJYA 5F3WB 4ZKDA 5JJLA 3RC8A 1OT3A 4UNSA 1W5SA 1NJFA 4GOKA 1P2SA 2IXGA 4NYIQ 2CHGA 4URZR 4UJ5A 4QXAA 3LWNA 5CM9C 3DL0A 1ELOA 1RKBA 4HI0E 4NYJR 4LBZA 3HDTA 3Q8XB 3R8FA 4DLTA 2BDTA 2AK3A 1W47A 1UPTA 4XWAA 3A4NA 2XNDA 1KO8A 4PZLA 1TL7C 2QN6A 2OXCA 3QKRB 4G5QA 2QU8A 4DLVA 4R71A 2F43B 5IHPA 2KE5A 3FKSD 3OFND 1XTJA 3PG5A 2TMKA 1EFRA 2YWGA 4KJZA 4LHYA 1IJEA 2XJ4A 2JEOA 3P26A 3Q7PA 4OKSA 5LDDC 1QG4A 1TTTA 2QAJA 4KYUA 2F1RA 2IYTA 2ZUBA 3NKVA 4Y0VA 4LBWA 1Z83A 4V0KA 4ERNA 1KJWA 2BBSA 1PLJA 2JA1A 2ZJAA 1C1YA 2GKSA 4U5XA 5FUWA 2ZPTX 4CT4B 821PA 5L3SB 1R6BX 3PUWA 4JJKA 2JLUA 1NMZA 2FFBA 2EFHB 3GEIA 1Z6AA 4M1TA 4N0DA 4B3CA 4X8LA 3GLHB 2O0HA 4NU0A 4NYIR 1G20E 1II8B 3DO6A 4R2IA 5CDFA 1N2CE 3IEUA 2FPLA 4TQUS 3BC1A 2V6IA 3TLXA 3VTKA 4U7DA 4P4SA 2EVWX 4LZZA 2OEPA 1I4LD 1KMHB 2FFAA 3U7HB 4LPSA 1EESA 1FPMA 3IQXA 4TZ0A 2NMVA 1WXQA 3UG7A 5FI0B 2YOGA 4IDQA 2C9CA 2ZRDA 2WWFA 4PO9A 1FFHA 3CLVA 1QVAA 4LHXA 1NJGA 3BXZA 4ZIRA 1GKIA 2FGJA 5H1YA 3P27A 4KFRA 4WW0A 1XXHE 4RD3A 2WWWA 3JVVA 4C0QC 3GLIA 5B57C 1G8FA 1NN0A 1Z29A 3PV0A 4DLUA 5ANRB 3X1DA 1WBDA 1E0KA 2XJ9A 2V8OA 4DDUA 3CX7A 4JBYA 3IQWA 2GZHA 4Z1MA 1LTQA 3EG5A 3WYGA 3EZ7A 1EX7A 2BCGY 1IJFA 1XEWY 3FHTA 4D81A 3AEZA 4IXMA 1IOZA 2G1JA 5C4GB 1F5NA 4G3XA 5GADl 4EPTA 4FN5A 1D9XA 2IHYA 1Z22A 4Q1CA 4L16A 1UFQA 2JJ1D 2V1XA 4PAQA 5TDHA 4BECA 1ZU4A 3N2IA 3L2OB 2HEIA 1VYUA 4B74A 4UXJA 4BLTA 4DVGA 4JLKA 1OKKD 5GJWC 1X8JA 2ZRBA 1SXJD 2QBYA 4TL6A 1KNQA 1KDRA 3B13B 4ARZB 2OCYC 1MO5A 1E79A 3K09A 1KK1A 4CGZA 2VP0A 1WCV1 3JZMA 1TUEA 1AGPA 4EKDA 5DI3A 1EK0A 1T91A 2OXRA 2VL7A 4O2LA 1UKYA 4DLXA 1Z07A 3LH5A 1LFDB 4B6EA 2CLSA 1KI1A 4DSNA 2JLRA 4POAA 2FSIA 4B2PA 2ZEJA 4QBIA 2REXB 4LOAA 1WP9A 4FMCB 4OI4A 3NH9A 3CH5A 4V02A 1SVSA 1V43A 2VRWA 2OLJA 1EXMA 1R10A 4TMKA 4EFMA 4TMXA 2AFHE 2Q6TA 3QKSB 1FQKA 2IUUA 1T4GA 2CHQA 2GJAA 2ZU0C 3T12A 3RDPA 2KBFA 2Z5FA 4MYCA 3K9LA 4JLBA 3E2IA 4C0JA 4L9SA 3RSLA 1ZRHA 5FH9A 5C18A 4QGFA 2IK8A 1N6IA 1AKEA 2X1VA 4URVR 1G7RA 1GRNA 3IIKA 2OLKA 3TE6A 1P73A 5FUXA 2FEMA 1EFHA 1VCNA 3PUXA 4EPVA 2QSZA 2V4ZA 4LYJA 1UDWA 2QI9C 4H1VA 1ZNXA 2CVHA 2WAYA 2ZREA 4TZ6A 3DKPA 1U0LA 3AUXA 2HV8A 3REGA 4Q9IA 3T34A 3U2QA 2ODWA 1E2PA 4DSUA 1E2DA 1G3UA 2GF9A 3BK7A 3HU2A 3NBZC 4KLZA 3CX8A 2R2AA 2VTKA 2Q3HA 3DHWC 4GT1A 4AY2A 4FINA 1CTQA 1DVRA 2E9SA 2GCOB 1HH4A 3CRMA 4F4JA 5GVRA 1ETUA 1KOFA 2GWHA 3V4FA 1F48A 1KIMA 1W0JD 2QG6A 1J70A 3ONWA 1G8PA 3EPHA 621PA 3DPUA 1HE1C 2GHIA 4M2LA 4Q1FA 4ZPXA 4I1SA 4DDTA 5ELXA 2EWVA 3MWYW 2O8CA 3CM0A 4A6PA 1Q44A 1E98A 1P75A 2IC5A 3PEUA 4F92B 2XXAA 4BZPA 2ATXA 3HYTA 1R0ZA 2AHOA 4HLDA 1E9EA 2RHMA 2WSSD 4M21A 5AR1A 2XX3A 1NBME 2X2EA 3A37A 4MRRA 1II0A 1S4QA 1MO3A 2OUKA 2ZRFA 3CNOA 1E0AA 2AXPA 1NVWQ 4QC2A 3NH6A 5EXSA 1T8UA 5JCPA 1ZM7A 2IF2A 3ZQ6A 4R2HA 4M4SA 3PEYA 1M74A 3EW9A 4IEEA 4WAUA 2AX4A 3I5YA 2HJVA 2OT3B 4BEBA 1KHTA 4D2IA 3DM9B 3O8CA 3NTUA 4U02A 4X8OA 2XB4A 1DE0A 5KTYA 2ZVPX 4PQYA 1IQPA 4Q01A 3W5IA 1P5ZB 1J8MF 4PPGA 4MITA 3RRYA 3EZFA 2ZRPA 1X1RA 2QE7D 1Q0UA 3AQ4A 1XTIA 2ERXA 3FTQA 3QXJA 4OHZA 3SEAA 1Z0DA 4EPWA 4PC2A 2RCNA 4F4IA 2GEVA 2IL1A 1ZUIA 3BWDD 5JRZA 1ZIOA 5DN6D 1RJ9A 1SQ5A 3PIRA 4TMWA 1IN6A 1E3MA 2OG2A 4ZKEA 1BOFA 1S96A 3PXGA 5KO2A 1NLZA 1ZD1A 3OF5A 3OHMA 1A7JA 2PMKA 1L8QA 2CBZA 2WIAA 3KKNA 2CL0X 3QF4B 1E2HA 4JLVA 4TTQA 1QHHB 1DTSA 2IT1A 3CPEA 5LD2C 3Q7QA 4OJKA 2F3RA 4JVNA 3RYTC 4D0NA 2JDIA 4NCKA 4TLEA 5DYIA 5H70A 1NN3A 4A82A 1KK2A 2C98A 3R20A 4RD6A 2OFXA 3AP2A 3NHBA 4PXAA 3FHOA 1G3MA 2GVDC 3C5CA 4LBYA 2WKPA 2FFHA 5AJXA 5JRJA 1RRGA 1J8YF 2AKYA 1QHSA 2GESA 1S1CA 1SVWA 4LC1A 1DO2A 1P72A 221PA 2C03A 5HE9A 4QBFA 3RANA 2PMDA 4HEJA 1ZC4A 4MKIA 4QBGB 4A1FA 2IXFA 3U7GA 2D2FA 4C7OB 2R65A 1G5PA 4M9XA 3THYA 4AD8A 3RS2A 3SFZA 1KZ7B 1EFRD 4W5WA 1OFTA 4D0GA 5EZ5A 1ZD9A 2Z4RA 5EE3A 1W5TA 3B1VA 1HYQA 2MMGA 3QKTA 4PQRA 3LQQA 4LBVA 2PLRA 2DFNA 2YV5A 2REOA 4JKYA 2H5EA 5JWHA 2FOLA 2HCJB 3TSOA 2BOVA 2P3SA 3MSXA 5UKDA 1E9BA 1XD2A 4I1VA 3SYKA 4DHEA 1KYIA 1X8LA 3WBKA 2JJ2A 2YINC 1E2IA 3LVQE 3X1ZA 3PUVA 2C2HA 5JI2E 5FTKA 2GBLA 2LWIA 4HLUA 4W9MC 3KQHA 2W6ID 4MYHA 5FOUA 5CK5A 1I2MA 1S3SA 2CVFA 5L3QB 4CZ2A 1G3RA 5LD2B 4B34A 2Q3MA 4JT2A 3C5HA 3R7WA 2RGEA 2QORA 4IOMA 5C4MA 1JR3A 1ZJ6A 1GL9B 2ZRGA 4LX0A 1QG2A 3VMFA 4CYMA 2B7CA 4HATA 4XTRA 2SHKA 2J0UB 4ZDWA 4I4LA 3DOEA 4HAUA 3U4QA 1G4AE 2YVUA 1FTNA 4CEIB 1E96A 3DZDA 3X2SA 5CLLA 5FL7D 4EQ6B 1G4UR 3LW8A 2VP4A 1WE2A 3T61A 4Z1MD 4EJSA 1XMVA 3VKGA 3CR7A 3QEJA 4DLWA 4CEHA 1N5LA 2WWHA 2ZJOA 4KLNA 5KOYA 1W36B 3TUJC 1JPJA 4KU4A 3THOA 3SC3A 3R9XA 2QUZA 1WA5A 4QGAA 3U3OA 2CLCX 3UXMA 5J4HA 3FMIA 2BBTA 2YWEA 3NC1C 4UKDA 1TEVA 5K8IA 3GJ4A 2JLSA 2B8WA 3QVVA 4PAMA 1XB2A 2QSYA 3B1ZA 5FI1B 1D8TA 2WWIA 4QGHA 2YKGA 1QHNA 1QHGA 2IYQA 4AK9A 4TSFA 3E1SA 1G9XA 1OFIA 2YOFA 3R9WA 1M2OB 4JVMA 2C9YA 3OFNA 3PUZA 4D4MA 1GRRA 4Q19A 4FWIB 4PC1A 1NSTA 2AK2A 3A58B 1E79D 2Q3FA 4WOPA 5CB6A 2WJJA 1VECA 1ANKA 1ZW6A 1TADA 2VPPA 4IOKA 1MV5A 4RZUA 1D5CA 2KJQA 1CP2A 4LJ5A 4RKEA 4BFVA 4DUGA 4EPRA 1YR9A 1MH1A 1P9RA 4HB4A 3D3QA 3IGFA 4JLDA 5B30A 3PFIA 2FV8A 5DHAA 3UMFA 3DZ8A 1M7BA 3WRXC 1AIPA 1QVRA 3K53A 3ZZTA 4BRWA 3CNLA 1G6OA 1UM8A 4DDWA 5BWMA 2XITA 2JLYA 4Z8YA 3GFOA 4GBMA 4B76A 4JLNA 5F2EA 3K0EA 3B6EA 3K9NA 3PENA 2NO6A 1F60A 3W8NA 2XOKD 1GRQA 4JL5A 3VR4A 3X1XA 4MRPA 3HU3A 1S3GA 2XGJA 5CYPA 1ZYUA 3FFBA 1M34E 4QJ4A 4ZI2A 1E2NA 1BMFA 1NG9A 2CCKA 3SYLA 3TSWA 2CDNA 4IFBA 4MA4A 3ZGXA 1Z63A 1CU1A 2F6RA 5KNBA 4D0LB 1ZM3A 2OE2A 1E2GA 3AF3A 3EA0A 2IW3A 1TPZA 2BM0A 3P4YA 5AUQA 1U0HC 3ZVRA 5AUPB 3CPJB 2OCAA 4MGIR 4TMTA 2F9LA 3E5HA 3GFTA 2QQ0A 1AKYA 4NMMA 4YDSA 3KQKA 3I5XA 4NPHA 1N6KA 2RB4A 4HAWA 1BO6A 3TK1A 4DWJA 5CDFE 1MABA 1ZM9A 3EA5A 4E07A 3QXCA 1YZUA 1GNRA 3IDQA 3QBVA 3QF7A 2QEQA 5FR2A 3ADBA 4IVQA 3GPLA 1JAHA 2PZGA 4OHVA 5HR5A 1KI4A 3L8YA 1XTSA 4EFLA 1YJ5A 4Q5IA 1Z6TA 1MO4A 1BYIA 1JR6A 3S1AA 3I8XA 5EQTA 5F9FA 2ZJ8A 1OW3B 3I62A 4DXAA 1U81A 2DYKA 1BH2A 3KUCA 3LX8A 5JEEA 2CHVA 3GLIE 5JECA 3P1JA 1GSIA 2P6UA 1NLYA 4JYBA 5EP2A 3UMRA 3DOFA 3GP8A 3THXB 3K0FA 3T5DA 3ZZ0A 3I72A 2C99A 4O2RA 2ZSAA 1IM2A 1TUIA 3KXLA 4BWYA 2GILA 2VP9A 3WNCA 3GJ7A 2PX3A 3VU9B 4MKGA 3SBEA 1AM4D 3UG6A 1JEEA 3RWOA 1XPRA 3A8TA 5F98A 1XZQA 2ANCA 1E4YA 2NOAA 4GOXA 2BKUA 2O0KA 5EUQB 3T1QA 3KQLA 1IY0A 2AD5A 4LPKA 5EE9A 1G21E 5HCNA 2ODNA 4DRZA 1CJKC 4A15A 4YLGA 2FH5B 4B3XA 4A4DA 3PCRB 1EFCA 5DNYB 2I1QA 2BBOA 4PHHA 3SQWA 4V0OA 1U99A 1XCGB 4WZAE 4TYPA 4DSOA 1OH7A 4O3MA 1UADA 4Q4JB 1ZC3A 4ABYA 1LF0A 2GNOA 2VP5A 4GZLA 5AJZA 4ZDJA 1CJTC 1TF7A 1LY1A 2GAOA 5E3HA 1KI3A 2NZ8A 3O8DA 4N3NA 3B5JA 3QE0A 4QG7A 1X86B 1N6RA 3H86A 1JBKA 1G3QA 2WWGA 3MAAC 3MFYA 2IYSA 4TMZA 2HCBA 1ZCAA 3SDZA 5G3YA 5FTMA 1GWNA 4MH0R 4YDHB 3BH6A 3TIFA 2AXNA 4B75A 3KB1A 2C04A 4BASA 2QT0A 2XZLA 5B58C 4ZDKA 4R9UC 1U98A 2R6CA 1XPUA 1KGDA 3SN6A 721PA 1NF3A 2G0TA 2WJHA 4NCNA 4QHSA 1GNQA 4Q7KA 2WSSA 1H8EA 1LF5A 2G88A 2V55B 3IBYA 4EFNA 4JLMA 1EWRA 2B6HA
chains in the Genus database with same CATH superfamily
4R2XA 5JSZA 1GT6A 3QYAA 3GD7A 1ZA2A 1B6RA 1EQ2A 3EOBI 4WY8A 3H4TA 3SXJA 1D0IA 1S01A 4MS4B 4EO7A 4HP8A 2PNJA 4DDKA 1HEIA 1OTYA 4V0SA 3VPSA 1L1FA 4I50F 1E6KA 3N05A 2EQBA 1OXXK 1EGQA 4HQLA 5DCWA 1JS1X 1R4AA 3PR1A 4TTAA 4DGQA 1RBQA 2NUAA 4JEMA 5EQDA 3PA6A 4WPGA 1GFIA 3RYCA 2X8JA 1M2NA 1MRNA 1ECGA 4BB5A 3QI7A 1M7HA 4BRUA 1UBCA 3K73O 2HXSA 3IQFA 4RF2A 1PNOA 2C3OA 3PA8A 3UHPA 3QYPA 2HU8A 1BH6A 3RTCA 1KAQA 3C6YA 3CO0S 2BEKA 4TL8A 1O08A 4US0R 4MJ7A 1EUYA 4HV4A 3FOFC 1ZS9A 3ER9A 1IXRC 5GVSA 3KDAA 1HBJA 2W0SA 4NICA 1AA6A 1RIIA 3MYRA 3WLFA 3GLFA 4FGWA 1FP4B 2Y3IA 1F4LA 1OASA 4BP3A 1XEWX 1KZ6A 2O3RA 2IX9A 3O92A 2ZBDA 4R40A 4XSGA 3R7SA 1ZRSA 4BZXA 3CF2A 1B3BA 1CR4A 4YMUA 5H4GA 1BSVA 3IO3A 4IIYA 1RHRA 2C2WA 4HAXA 1ZNZA 2H1VA 3DEFA 4F5WA 1KJ9A 3F8WA 4BKUA 3OZVA 4E7OA 1E2FA 1XSEA 3DW3X 2Z04A 3IUBA 4X91A 4BMXA 1JR4A 1O6BA 2G4VA 2AZ4A 3WC4A 3NTQA 1VHWA 2JCVA 1FXWF 2O2IA 1JSCA 1UBGA 1ZM4A 2R6AA 3ELYA 3MAJA 4RSGA 2Q2VA 2RHTA 5CNIA 2AXQA 5CBKA 2XCTB 2BV3A 2J3MA 4B4WA 3M9XA 4TVKA 5DCUA 3VJKA 4OGLA 3T94A 1J0XO 3W5VA 4TLDA 3QE9Y 4QASA 1V47A 2HUNA 4RK6A 3DE6X 3OEWA 1TCAA 5KWVA 1Z56C 1FX0B 4R51A 1UKBA 3H1BA 1IHXA 1WXHA 4P32A 2ZCUA 1DEAA 1HT3A 3P71T 4LECA 5CH5A 1RPZA 1E1QD 1XALA 1EQUA 1Z5VA 2EHDA 3L0OA 3NATA 2JG3A 4AI6A 4N54A 3UFXB 4Y2QA 2DULA 5FO1A 5BO5A 3URKA 5I7HA 5L4LA 2OBFA 4GXNA 4HLUC 2ZYVX 2WDZA 2Q2WA 4RIFA 1I14A 1JEYA 1ODKA 5HPYB 1L7AA 4R1QA 1XZGA 3IX7A 5AI5A 1P31A 2DT8A 4KL8S 2KSQA 4JLOA 2FCRA 2W58A 1EXVA 5KYKA 4MV5A 5HDBB 4TSFD 5TQ0A 5HIKA 3GEBA 2BSXA 2XQJA 3A2LA 4R41A 3MMPA 3VNVA 3ZH9B 1EFAA 4HXGA 4LYDA 4F85A 3BB4A 3SKYA 4MA5A 5D5QA 3SBDA 4Z4EA 4M6WA 2WUDA 1MTOA 2WNHA 2AD1A 3PNMA 4UD2A 4FFVA 5ENVA 3WAKA 3FB4A 4EJ0A 4P3YA 3MJ4A 2I6TA 1Y6JA 3O95A 3OT1A 3R4CA 1R1DA 3A4IA 4ZAGA 1VMDA 1GUZA 3LUJA 5JDCA 2ZB2A 2ZTSA 1VL0A 3Q0TA 4NEHB 3PNYA 3JQ9C 2PUCA 4B3FX 5GZ3A 2QW8A 5CA0F 4N01A 2XV1A 4ENSA 1QPGA 5KTRA 2PH7A 3CZCA 1H9BA 2FYTA 1Q6YA 5DNAA 4CLOA 1PVOA 1RWVA 2P2DA 2LGJA 4Y2XA 4HTAA 1U9IA 1QIKA 1GAWA 4QU8A 1UXKA 3MWEA 3LUKA 3PQ5A 3ESZA 4FEEA 3ROPA 1JEAA 1GUFA 2DPYA 4UMFA 1K4KA 5H9VA 1B0PA 2PY6A 3KSDO 4DJ5X 5KBYA 3S99A 3CNQS 3ROKA 5JY6A 1SKYE 4KGXA 4EIWA 1PL6A 4CKBB 4UAGA 4ED9A 4JYZA 2LRHA 3P20A 4F86A 1PL0A 1ZHHA 1DAIA 3CNEA 2OSBA 2E48A 2YZNA 4XARA 1U63A 4QDUA 3VAAA 1EA5A 2DECA 4YUWA 2GJKA 2VNSA 1T34A 3I9NA 2X0JA 5KYYA 1F2TA 3M2TA 1MFPA 1E61A 5CH8A 2M6LA 1UP7A 3VYTB 3WGOA 4CL3A 3OZEA 2HB6A 3VKWA 4L8GA 1MV8A 3LIIA 1IHYA 4F3TA 1ESNA 3LF2A 3PXEA 4JP8A 5CFRA 5LXTB 2V59A 3JQAA 5DBOA 3SYNA 3A26A 1Z18A 4HKTA 4K9PA 1YR7A 1SKAA 3HCPA 4WERA 4CIBA 3OKPA 3WHLA 5MN4A 1OSNA 4FDTA 2OBBA 3QM1A 3HCNA 4KMRA 2R4QA 3WK9A 1TAGA 3EASA 4NZMA 3CR8A 3WMGA 4OYLA 2A8YA 2ZG6A 1N2JA 5ITWA 1EZZA 5LUAA 5DMHA 2WG0A 2H1LA 4G0ZA 2IEDA 2XLBA 3A1SA 3K30A 3KTOA 3PC7A 3A9TA 2OAEA 4R0VA 2WAXA 3L6RA 3O7MA 1CUFA 2B99A 2DHEA 4ENVA 5C5DA 1QGED 3SG0A 4CG0A 2ZRCA 2R7AA 4I4CA 3HXKA 3LO5A 2QMYA 4JELA 2ZVJA 2ZP1A 2C8LA 4RFVA 4EAQA 1P2UA 1U7TA 3CLSC 4HMQA 2QLJA 5I7OA 4LRTB 3ER8A 3LM8A 4ZVPA 1AQ6A 3L43A 4ARZA 5KSZA 4I3GA 3B89A 4J7UA 3I8SA 2ZE6A 1V71A 2OHGA 1VKZA 1RXCA 1WMFA 1UDBA 2YV1A 3DMPA 5JSHA 5K45A 4AF8A 4FKMA 1E2QA 3HBLA 4PO1A 4RVDA 1MLDA 3OOHA 4PO8A 1ZK4A 3SQXA 1G8JA 2B4QA 2VIIA 3DTNA 4XDGA 1BWQA 2LBPA 3LY7A 5DSZA 4PX2A 1TMOA 5DISB 4ZCMA 5U4XA 5LQMA 4BQQA 1U2SA 3EJWA 1FK8A 4WXRA 3VKHA 4QHTA 1A1SA 1UP6A 3AWIA 3OCWA 4R7TA 3T1HB 2CNWA 2C4VA 3A7EA 4GBJA 1F6BA 2J5QA 2OXEA 3FCYA 3QFFA 1ISRA 1RMQA 2NUPA 2XBLA 5D1NA 5FPYA 5I7RA 1GR0A 1ZD3A 1QTNA 3FG9A 3VPHA 3WLAA 1SXJC 4PFSA 2H1OA 1V11A 1ZN9A 1L5FA 2PZAA 5M34A 4JASB 3MHTA 3R8CA 5SZHB 1MC5A 2QM7A 2UXDB 5I51A 3KBBA 1SVIA 4HNAB 2Q5OA 3UT0A 1D6MA 4LXXA 4R98A 1U0GA 4QXPA 5H9WA 4N48A 4O4LF 1XNJA 2WHPA 2WAAA 1SB8A 3JCZA 2HA5A 4QNNA 1LRKA 3ECSA 4JP5A 1VI5A 1GD1O 4PLPA 4Q3OA 2XQGA 3QU5A 4Z0PA 1KYQA 2GRUA 2ZYWX 3OPMA 4OKIA 3D2CA 4B4DA 4DQLA 3G9TA 1UPFA 4KODA 1YVPA 2FF5A 2IODA 3HYSA 1RTTA 2VSQA 3K96A 4P7FA 1Q20A 2HUPA 2E55A 4MWBA 4E4TA 2UUBB 2H54A 4F45A 3TB4A 3BMOB 3AM4A 4Y9RA 4G1EB 2VHYA 3DH0A 1X1EA 4FMDB 3ORYA 1OAAA 4MWOA 4OCZA 5EHXA 3UJ6A 2I6QA 4CTKA 2NZUG 2RMKA 3PNQA 3W1EA 5TLSA 1VPTA 2GCOA 3B6MA 1TZ2A 4BVEA 1QPZA 3I01M 1N2XA 3H5IA 3IO5A 4YFYA 4ZVQA 3VZQA 4LJSA 3GC6A 1BE1A 4JWKA 2KI5A 2D1FA 2BHSA 2VKQA 1TYZA 2PKRA 1UKCA 1ML3A 1ORDA 3D7SA 4OOFA 1F1JA 3UVEA 1S0UA 4C29A 4WKCA 2PIDA 4IGKA 4RHFA 4U3JB 5J2UA 2J0QA 2O8CB 2QY6A 3NOXA 2M1XA 1X7WB 4CLDA 1WNFA 4QTZA 4AMBA 3M6WA 4FEAA 3E03A 2MYPA 2ENWA 5FBVB 1UIMA 3AR8A 3SD7A 1U6IA 3NBFA 4QOHA 3F6EX 4GGOA 1T10A 4HSEA 5JS7A 1JFSA 1B0UA 3OTIA 4UW9A 3T4PA 4D42A 1E32A 4GNKA 1SUAA 3F74A 2C8VA 3OMLA 4KO4S 4J2TA 1I4DD 4MMYB 5ALOA 3U17A 4M83A 1C3JA 5DNVA 3UOAB 3ZQKA 1V5FA 3IXLA 1N5KA 1QIJA 1QTRA 2R86A 2APJA 3F49S 3QXHA 1M2WA 3EMKA 2VBCA 3OCJA 4ILKA 3RWMB 4B32A 1ISSA 4KGVA 4MRMB 4BKQA 5AJWA 5A0TA 3OZXA 1L1RA 1USKA 2PKQP 1W35A 4G1BA 2V7PA 2VI5A 3IDAA 5EUMA 5HKKD 2W2OA 3NOVA 3TAUA 5AW2A 5LQDA 5A4JA 5KNCA 2EAUA 1PJZA 1DC4A 4FHEA 4AP6A 1AN9A 4Q1EA 4AKEA 2ZIFA 4MQ4A 1A71A 3AR9A 5F7XA 1XRLA 5JZ9A 4EEKA 2BMDA 2XAAA 4IH9A 1YQQA 3GEGA 3I92A 3OEEA 4JJ8A 4MARA 4NONA 5BWBA 5I01A 5K4HA 2ZI3A 4G0XA 2XGOA 2ZJ5A 1VGQA 1Z4KA 1Z16A 1D2EA 1DEKA 4RADA 1GZDA 4X1KB 4YIKA 2W6NA 2O5VA 1AZLA 3L06A 4FS3A 5KYWB 2QJTA 1H6AA 3K9WA 2WP8J 1M7GA 1TGVA 1EK2A 2Y93A 5LVAA 2QX4A 5FOVA 2Y4NA 3BPSA 3D8RA 1U4OA 2I3BA 1NIPA 3MXOA 4DCVA 2IIQA 4DQXA 1ZMBA 1VZ3A 4EG1A 3OX3A 1IQRA 1OAOC 2GX6A 3MOGA 3NHUA 5HHTA 2HLNA 4PS1A 3IERA 1PP4A 1J39A 1BCSB 4G09A 3O8RA 2EZUA 3ZDXB 1HI9A 2QXTA 4M60A 5HE8A 3RGWS 1JG4A 1OH5A 5K0EA 2AEEA 1Q1GA 4YJ3B 3OEYA 4LV5B 3VNQA 4ZCPA 3ACCA 1X7YA 3EZ9A 3MUFA 5F21A 2XTNA 4KQEA 4X61A 2EGUA 4HBZA 5GJCA 1U3GA 1RU3A 3V1MA 1PS0A 2POQX 2FK8A 2JLZA 4IM7A 1OZHA 2O6LA 3ZLVA 1ZJ5A 3U4CA 1ZD4A 3KQSA 1FNBA 1GZ7A 1KAGA 4FX5A 5FWAA 5JZOA 3ELWA 3NRCA 3S8MA 4HFNA 2VDWB 4KWIA 2WTAA 2UVDA 1NW5A 1ZXXA 3OWXA 5ERGB 5M29A 1G6KA 2BMAA 1U65A 4Q9KA 3W6NA 4YK7A 1JHOA 4D7AA 3HYNA 4FB5A 5L6MB 3W5UA 2CD7A 1B0AA 1V4NA 4WBSA 5IUJC 1ZH0A 1BD4A 3TEMA 3THYB 3HBAA 2Y68A 3OU2A 3HJAA 2HDHA 2HF8A 1Y7PA 2JFPA 3ENKA 1U11A 4BJ5A 1B43A 3OU6A 2CNKA 1RKXA 3DEZA 3ZJYA 1RVV1 1L5ZA 2SECE 4XM2A 4TKZA 2VP2A 1NJ6A 5AK3A 2ID7A 4GP9A 4G26A 5FADA 4F97A 4MA0A 2W83A 2A5FA 4PAOA 4WBNB 1QAQA 2ZBRA 1T9DA 3UK0A 3RIHA 4KG7A 3VXKA 4HUTA 3U62A 1MX3A 4Y2PA 3NWJA 2R8EA 4ZVSA 1RXSA 3SF8A 4WADA 3C7KA 3WNZA 2K6GA 2NM0A 3LY8A 2BAGA 3KOZA 5FEMA 2JLQA 1N7GA 4YO7A 4LYYA 4AM8A 1I36A 1SOAA 4LY6A 2W93A 3RV4A 2I6FA 1P9WA 2ODQA 5JVDA 4MUJA 1ZGHA 3HGQA 4Q47A 4AG3A 3A6PC 2EBWA 3SR4A 3FDZB 1U3CA 1M67A 2GCNA 3COYA 4JCOA 5HF6A 3UICA 3IUMA 4CQMD 1QHYA 1ZH8A 5C2JB 1J9EA 4YCBA 3SY8A 2WZQA 1LW7A 2FW9A 1B2RA 2W90A 3IIEA 4DEYA 1E9VA 2X5XA 4L6IA 5TRTA 2H7CA 1FXUA 1T29A 1ZN2A 1MZPA 5FDFA 4FWTA 2PL5A 1LSJA 2H4FA 5D01A 3K9HA 2ZTMA 3EMVA 2CFSA 3PXXA 4BRSA 3B1KA 3JTMA 1BN7A 2OQIA 4FYKA 1ILWA 2DU8A 4MJLA 4FMCF 1E1QA 1SG9A 1WKCA 1ZY2A 4WKPA 5A0FA 1Q1NA 4EQ6A 1RYMA 1T5IA 5TE9A 3CSSA 3INGA 4P80A 4KNYA 1E1KA 3QVUA 1NONA 1PX2A 3H9EO 1YI8A 1PVVA 1BE8A 3EGIA 3K8YA 5E6RA 3NBQA 4ICIA 4UVDA 3TIIA 1A77A 1XNGA 2OCIA 1BHQ1 1KJZA 8ABPA 5IXSA 4ZZ3A 1USIA 1P9NA 3AHDA 3MBKA 3PHCA 4Q4AA 2VF4X 1JSRA 5ESRA 3C7DB 4YMWA 3M9LA 1JJVA 1SWWA 3WWEA 2ZE7A 4UUQA 1GP2A 1P5RA 3SJAA 1K08A 1RWWA 1GTZA 3SHWA 3UB4A 1LH0A 2GVZC 1Y42X 3JW8A 4Y18A 3T7EA 5JBIA 2L82A 4NJEB 1UAAA 3UH0A 4HH0A 3MMNA 2WJAA 1YFLA 4FI3C 1M2OA 1J56A 2VNJA 1K2VN 5CD1A 1R6VA 4MKHA 5A3RA 2ZK7A 1FFWA 2AMFA 1UT5A 2ATCA 3K0HA 4RAQA 3O3NB 1DJMA 5JCOC 2WT8A 4EVRA 3AF5A 2WJ4A 2HIGA 1WF3A 3DD5A 2H4WA 5DFAA 4A92A 3IL2A 1Z74A 5JT1A 1W44A 5KYUB 4I99A 5DVZA 1GADO 2OZPA 4OI1A 4FW9A 1K0FA 5IXYA 3F6RA 2JCSA 1V41E 3ASZA 1U2ZA 2CE7A 2YASA 4KLAA 5LKAA 2A5GA 3IVCA 3PKJA 2JBAA 2R60A 4KV9A 4FFBB 3HB1A 3AFGA 4G1MB 3AUJB 3N2KA 4XB1A 4Y7DA 1UWVA 5DXJA 1C3XA 5CVVA 3CJRA 1I7PA 4JEUA 1YDMA 4BO9A 1RT9A 2G7MC 4L72A 1IK6A 1KZYC 2I6SA 4WECA 4DDVA 4TSKA 3RT9A 4QUBA 1DQRA 1WVIA 3NAGA 1AK2A 1EDBA 1Y1RA 2E6UX 4LY3A 3EOAI 2HHLA 5GM1A 4JX9A 4DXDA 3UWMA 3OTHA 3W7BA 1NQWA 4XJXA 1YQ9A 1MJNA 1NP6A 5IAGA 3DO5A 3VR2D 3IQZA 5KX5A 2VN8A 2C9ZA 4JLJA 3JD3A 1DFHA 1N2ZA 3E3AA 4GMGA 5ADWA 2WJPA 2JHAA 4MAMA 2W98A 3RNLA 1UPBA 3HCAA 5LQKA 1R8YA 2QLTA 4MYRA 2R48A 4MR9B 2FPIA 1D4OA 2NNWB 3HKDA 1TLLA 4HDRA 3PD7A 4PE5B 1U5BA 4NBSA 4YBZA 3K70D 2IBMA 3AGQA 4W5TA 3B78A 4MQFA 1W8DA 3NTOA 3N5CA 4J9UE 3BERA 3I2IA 4PYJA 4DTCA 2WFLB 3C4JA 3JVUA 1RWQA 5AW8A 1LLQA 4E5KA 5JXGA 2H7XA 4P22A 1W2GA 3K15A 3I05A 2X9NA 5IN5A 1CZNA 3ISVA 2FQXA 2VZ0A 2Q4RA 4IDHA 3ZBQA 2X14A 4BX0A 2CBXA 4CV0A 1JKXA 2QMOA 1RLUA 1G8YA 3D0QA 4UREA 4I3HA 1ZOOA 4D4JA 3IMEA 2DLDA 1XQVA 4XUEA 1ES9A 4YY3B 2VYFA 4WESB 5F7JA 5K4GA 3MTEA 3F8SA 1SXJB 1MG5A 3ZD6A 3P0FA 4AMZA 3KHUA 4EF5A 1K89A 1FE8A 4KE9A 3WICA 4E46A 4HLNA 2GZDA 1R6XA 5CBPB 3ZHUA 1CQJA 2C42A 4AN4A 2O3UA 4IDOA 2HLHA 4LOLA 4O4JA 5EKXA 3OTQA 2R7KA 2ET6A 4EMTA 1GZHB 2OK8A 3V8VA 3PFWO 1GJRA 3PZRA 1QC5A 2I4LA 1JH8A 4PCAA 4LCEA 5G0SA 4YV0A 4GL4A 4DHWA 3D3KA 1JHYA 2DUUA 2BEVA 1CUXA 2N1BA 2C5EA 4MVCA 4EB8A 1BRMA 1AVTA 1F0YA 1JKFA 1Q0HA 2A0FA 2ORYA 2ZUUA 3HB0A 4HRVA 4M1EA 4Q9HA 3CEMA 2ORVA 3D3EA 3ZI7A 3RVQA 1UP4A 3AHGA 1QR2A 3VTZA 2J30A 2XCRB 4UDYX 1P6XA 4DGSA 1H0HA 2B4AA 3VPCA 1GQSA 3DLCA 2VRNA 2MDTA 3RODA 5AW6A 4DR3B 4AKGA 3DLAA 2A0WA 4NATA 2P9HA 2RSLA 3PQDA 1GKKA 1AZSC 5COBA 3LDGA 5EJEA 1CVRA 4RQAA 1NY5A 1O6GA 1RKQA 1T0PA 5ECYA 1TVKB 5FWYB 3FR8A 3K1YA 2QB5A 2IUSA 4K8RB 4Q4JA 5K3OA 4AECA 4ACAA 1YZFA 4TRRA 1QE0A 2GO7A 3VC2A 1OVGA 4D5EA 2OENG 4IGAA 1I7NA 4D45A 1G8HA 1POWA 4OLBA 1ZBDA 1U2RA 3HV0A 4NOMA 5IYZA 1L7VC 4W5OA 1RXVA 4HK4A 3NEAA 2C0CA 1ZK3A 2A4KA 3B1XA 3NBUA 2HBRA 5T57A 4DTIA 2FNAA 3K0SA 4FGKA 3G0IA 1MORA 3N2GB 1ZSYA 2EFDB 4P2BA 1J7JA 3DT6A 4CI9A 2D5BA 3NOOA 1E2JA 3QIAA 4Y6RA 1X77A 3ND7A 2M32A 5SYNA 1FP2A 1N0IA 4CM4B 3PVCA 5B1EA 3A06A 2W2KB 3IB3A 3OY7A 1Z15A 1FQOA 3C1OA 5IKMA 3HXMA 3EUFA 5BYBA 5BSKA 1G5RA 3DNPA 1J25A 1VMIA 2E4VA 2BWJA 2QMQA 3F46A 3OCYA 4I19A 4O29A 2DQ4A 3TD9A 3CLHA 3LE8A 4X3OA 2X6QA 2JGNA 2WZDA 2GHRA 3AEXA 4Q4LA 3OCVA 4EMSA 4HNGA 1FY2A 3D4BA 4Q00A 2PXAA 3F3YA 2ONZA 1WOYA 4QU0A 4HTFB 8LDHA 1ZAKA 3ESQA 1M2EA 3KJGA 5EHGA 1LK5A 3OMXA 4I1OA 2K2WA 1T1SA 1BXGB 1F2VA 2A35A 4JLAA 2ZJ3A 1FYXA 5DCLA 5JSZB 1XV5A 4ZJPA 1Y8ZA 3SEQA 4I6EA 1A5ZA 3T9BA 4ID9A 2QN1A 2ZDQA 4PFKA 2BEJA 2KYRA 2ZI7A 4R8LA 1VFNA 2AVDA 2BCJQ 2ZVDA 5DM70 3GJYA 4GO1A 3T06B 2CHUA 2C7GA 2GEUA 3GNLA 2NUAB 1DKLA 1WDTA 3RYCB 1JFFB 3EMDA 3FPSA 5IVPA 2GAJA 1SBYA 2B8NA 3LQ2A 4MLDA 5FBQB 3PQ2A 2A7XA 2Q5IA 1X7XA 4PSCA 4F7DA 1QYVA 4LVNA 4QIHA 3ICQB 1F0KA 3EGXA 5FUYA 1SC6A 4IWXA 3LC1O 4LYHA 2ZWPA 3KEGA 1I2DA 1CUDA 3K9GA 5JSQA 2R9VA 1NBEA 2QT1A 2CK3A 2YV3A 3GLFB 3AZOA 5JXJA 1C7FA 4KXFB 2R7MA 4X6UA 2YNMA 2YC4C 3FIJA 3RC2A 3ZZUA 2AN3A 2SNIE 5CXUA 1MGPA 3IUEA 3QOFA 4G5OA 1BS9A 5CW1A 3HR8A 3L02A 2GK4A 1BTOA 3FVWA 2E3JA 3GLRA 1HY3A 3EDOA 1I2ZA 4BFWA 3GGCA 3QTTA 1F2UA 4RGYA 1ZGBA 4Y6LA 5C0OE 4J49A 2KPOA 3EXEB 2PN1A 4GXTA 3GROA 1ZZEA 4JMLA 1NMEA 1U0JA 2R97A 3QBTA 1Z7EA 1Y4ZA 3DMFA 3G82C 4QUKA 5A6SA 3F7NA 5IEBA 4ON9A 3WNDA 5F3DA 2HU7A 4OPMA 5H7XA 5HNKA 3P9KA 4RVCA 2NSDA 2Q5QA 3RC1A 2Q50A 3D6UA 1I10A 1AMNA 2OVBA 1SKQA 1JA9A 1SK8A 3QU9A 4JSRA 3BBLA 5JJBA 1NXTA 4ZT2A 3KL2A 3L5KA 1C8KA 4ESVA 1ZN7A 3IE0A 3IT3A 4UQPA 1CDZA 3MGCA 4Y3UA 3SYMA 5CLHA 1R8QA 2DY1A 3L4SO 4DILA 4EUNA 3EPKA 2IHNA 3UCFA 9MHTA 3PKZA 3L4BA 4PX5A 1DIHA 4XSVA 3R75A 5CA1A 3D4OA 4DJFC 2PS1A 1JEYB 3T99A 2G5PA 4F21A 3QXXA 3SMVA 2XMQA 3A6KA 1KKMA 2V03A 2AN1A 4EY3A 4F8JA 4YMVA 1QNLA 2E4WA 2VPZA 4P54A 1T9BA 2PWYA 4TLCA 1E1RD 5AKKA 5TQ0B 2JJ8A 3H0EA 4E3WA 2GASA 2OFWA 1W30A 1G7SA 2LCFA 5LJLA 3AFOA 5KNDD 2UUPA 1GDTA 2ZUWA 4E2XA 4NZYA 1KY5A 1OIWA 1V7QA 5HMMA 5TPWA 4N82A 4KE7A 2ZRAA 4TV9A 3ZU6A 4B2YA 1G8MA 4OH7A 1CS0B 2IVZA 4M6WB 2CLEB 1NN5A 3HBJA 5EJFA 3AW8A 3OLCX 4TS3A 1DJOA 4AURA 1U2GA 5JCJD 2DERA 4JBLA 5SZKB 4ZV7A 1WUHS 2ES4A 3WL6A 1SXPA 1NVVQ 4RGBA 3TZ6A 2A0UA 2NTYC 2W7TA 1G41A 3LVFO 4IXWA 1E3QA 1OXBB 2VC2B 3MS7A 1QCYA 2COEA 5JD3A 5A7FA 4GQBA 1YJXA 3WQRA 3ZWQA 1OJLA 3ZHOA 1A9SA 1WM1A 2M2IA 2QMEA 4GPBA 3OIDA 1KQFA 2X2OA 2XYVA 5D3QA 1F06A 2BIFA 5CHEA 3P45A 1ZR2A 1K63A 3H7IA 3ROGA 4CV3A 2EIXA 2PRZA 1ADBA 2WEKA 1GPUA 2Z1NA 2FPXA 2XHEA 2Z09A 2ZTLA 2HIAA 1AF4A 4HQFA 4Q3LA 1FMCA 3BCHA 8ATCA 1YRAA 2VCEA 1OFVA 4KNVA 4TN1A 1XJWA 3IAM1 4M1WA 2VXCA 1FFEA 2QENA 1BFDA 1U0NA 3BA1A 1Z62A 1OA0A 4J03A 4MRNA 1WDWB 3AG5A 3BWVA 3NCTA 2OESA 3TG2A 2PBRA 2XUKA 4EK9A 4HS9A 3E5MA 4QOIA 5JAQA 3O0DA 4EI7A 5CDSA 2H00A 3DOJA 3QVLA 4YCAA 2YTZA 1VG8A 1NVTA 2I3ZA 2JIZD 2RGAA 1DBWA 3SOZA 4Q21A 5KYYB 2C3PA 1F2TB 4J2OA 1JEQA 1E1NA 1P7WA 3QNMA 2JLAA 3MCTA 4IIGA 2I1VB 1E1CA 1FLDA 1TFRA 1AC5A 3NDIA 1M0TA 4GYWA 3SFTA 4M0PA 4IWYA 3FE2A 1N6OA 3KKKA 4C7MA 2Q1SA 2WIJA 1ZOIA 4HWTA 5EXXA 1L1EA 4U2GA 2PZLA 1KO4A 3OE7D 3SE7A 2P9GA 2C3UA 2G63A 5H82A 4H7EA 4I9GA 1PYOA 2HMYB 1ZFNA 1GPMA 4EB3A 3KEOA 1O03A 4EHIA 3FMOB 3ICEA 2R5NA 3CG0A 3DEIA 1TGYA 4QOFA 4XB2A 4D8XA 4QGGA 2Q7DA 3WJ7A 1NX6A 2C1XA 2V5VA 2VJAA 1AQIA 3A2NA 5TSDA 3L6UA 3WLHA 4ANFA 2VYND 4NDNE 1G0NA 3AESA 3DWFA 3QENA 1ZGGA 1G21A 3ULKA 5EL0A 2IEYA 5JALA 5JEDA 1R9GA 4Y67A 2MJLA 1KEVA 4PFJA 1M1NA 2DBYA 4D0RA 1I9CA 3FBGA 1ZIYA 3KUKA 3WIEA 4LHWA 2QF7A 4WZAA 2IKQA 2XIQA 4IZOA 1NUQA 3JWHA 1NXWA 4Z9AA 2OV4A 3EISA 3QVKA 1AN0A 2O3QA 2PDAA 3VOTA 3H1FA 4DQ0A 3VOBA 4N39A 3RJZA 4YT4A 1HNWB 2JFYA 1U9CA 4R4JA 1F38A 1SM4A 4TXHA 1JA0A 4G5HA 4NXNB 5C35A 3IAHA 1WW8A 2YMLA 3KPVA 3LLMA 3ZJ4A 3CF0A 3FLAA 1E5XA 2VEOA 4C7KA 4WOCA 1IAVA 1GKUB 1J8QA 5JNRA 1HURA 2RKWA 1UDXA 2V65A 2R8OA 3M4XA 3EFHA 4PZDA 5CW2A 2OPHA 2NV0A 3ELUA 3I1FA 2NUPB 1Q1BA 2PBFA 3WWZA 3DC2A 4G0OA 3W2EA 1AKMA 4UULA 1AKWA 3BJZA 3JTEA 1TC1A 1D03A 3GRFA 4L76A 3RU9A 4D9JA 4RVNA 4GUDA 1V11B 3H11A 3VR2A 4D9MA 1VE1A 1D8AA 3BWYA 4M9CA 2QM0A 3HZHA 1YRQA 5EOVA 3V42A 4HPJB 2NU9A 3F6BX 3K05A 3A6GA 4UE2A 1R27A 5DW0A 3TNJA 5IAJA 2ZCJA 1JMYA 4BVKA 1NVGA 1EEHA 2OMKA 3BH7A 4ZD6A 4BNDA 1RJFA 3COZA 1DBRA 3MQ4A 2PZMA 5CXSA 2JKZA 4AZWA 4D9HA 5IT9A 1CWUA 3PJRA 3BKXA 4MYUA 2C95A 3C3DA 2Z0MA 3AJ9A 4KO2S 4PQFA 1RAFA 1UZMA 1QQ7A 1YNOA 2RAFA 2YCBA 1V7PC 2CXXA 4AQYB 1UK7A 5JWRA 3AVXA 5SZJA 4MAFA 2ATEA 4Q05A 1Y3AA 3ZXSA 3RHSA 1M1YB 4G25A 3R5TA 3OZUA 2NO1A 1N0HA 1TJNA 4H15A 4R01A 5DDIP 1OC4A 1SOVA 4D99A 4TLAA 1KYWA 1PHRA 4ACBA 4FGSA 1EBFA 1I5OA 1NLFA 2YCLA 1AB6A 3DXYA 1JJAA 3H99A 1VKNA 3ITKA 1SHZA 2IHTA 5H8WA 4EUEA 1E64A 1USGA 1IN4A 2YYZA 2Y71A 4KN8A 4X95A 1DMRA 4DNFA 1GNTA 3BZBA 3OOSA 4K28A 4LDJA 3DC7A 4DZRA 1OB2A 6NULA 2WLSA 2QNRA 2TSYB 2MSKA 1CJSA 5J2UB 1PJQA 5I9LA 3ZCRA 3AUUA 3OPYA 4BQNA 3W8DA 3LTEA 3T4UA 1LPBB 2P9QA 2PLAA 2X3UA 1WZNA 3PEEA 3TOZA 4F12A 4RO0A 3VU0A 3GRUA 3TTXA 3DM5A 3UUEA 1P77A 1TU3A 4GU5A 1VBMA 3D5EA 4UPEA 3NYWA 5HWSA 3PX2A 1XQWA 2QX7A 5BR4A 1HETA 3RJMA 3HVKA 1IN7A 3WYFA 5IC6A 2QTVB 2QWXA 3DWEX 1U7DA 5EUBA 4KBFA 4RJTA 3NKFA 1GNPA 1NVEA 2ZU6A 3CVOA 3ZX5A 1UXOA 1E94E 3QXGA 2HA3A 1SU7A 3IOEA 4EVSA 3KYIB 4RFSA 1Z0UA 2DQKA 5KC9A 2RJNA 4C7VA 1ZHOA 3TR5A 3QSYA 3JWPA 1B15A 1FCJA 1RYNA 3UGQA 4LI3X 4RKWA 3DE7X 1W34A 1Y5IA 2QD4A 3N76A 4UDXX 2CJWA 4U6SA 4WIAA 5EZYB 3MQFA 5A4IS 4GPZA 1SKMA 3FHTA 4ZCSA 4G5GA 3DLPX 1H5NA 4M9RA 1RE0A 4MPDA 1EHIA 3D8TA 4CW7A 1YZLA 3IVMA 3W5DA 1COWD 2YHIA 1GIAA 2LP4Y 3OY2A 4IYRA 2YMPA 2EQ5A 1VHQA 3D2LA 5DMXA 3VO8A 3DYIA 1FYDA 4PIPA 1GHTA 2Z30A 1KEPA 1FVHA 2FGKA 3CZAA 4TYYA 5IBQA 3P9XA 4BKRA 3LPLA 4LHZA 4OGGA 4IWNA 5I9NA 2ZCVA 2IWRA 4YDQA 4Q7JB 4Y8VA 1XRPA 4ZYVA 2G6BA 1A9TA 4YP1A 1DXHA 4NZOA 3LY5A 3FUXA 2CDAA 2W22A 2OM6A 4M1SA 3AT1A 4X54A 4ATNA 3PXDA 5EUCA 2XBMA 2FZCA 3TTUA 2B1IA 3ZJTA 3L40A 5HM6A 1CCWA 2EQAA 3CF4A 3UNXA 1BGXT 3QBEA 3OTOB 1R00A 2HU5A 2P69A 1VE6A 1MMFB 1NRXA 2EBFX 4KCGA 4EKYA 5DHRA 2XRFA 1B23P 2PGJA 2AJBA 2TMYA 4I14A 4L4XA 3L7AA 5AK5A 3AHEA 2ZRMA 1X92A 1MJGM 1N4DA 3GWGA 1YH3A 4ITRC 4JUAA 4X1OA 2JCGA 5DGHA 4EATA 1K5DA 5TXGA 3O1IC 2C4HA 3TQSA 4II2A 3VDNB 2FN3A 1IHPA 4JD5A 2XNDD 4LV8B 4HQNA 4UAUA 4HZIA 3AOEA 3THRA 1QRTA 3AVQA 3KU1A 2LIVA 2C78A 1S2MA 2NQ8A 3DMTA 3GU3A 1N5IA 4MUIA 4UUNA 5J63A 5LXTF 1OMOA 2HI0A 1YONA 3L7YA 3MRXA 5TS3A 1WNTA 3U61B 2FSHA 3RUIA 2R6GA 4B3RB 5DKFA 2BE7A 1CRZA 3KWMA 4JJ4A 3NOQA 3HRHA 4BQFA 3DKVA 1JNXX 1W0KA 4OMCA 5GWXA 3E7XA 3FBTA 1DNPA 2LKCA 3ZY4A 2IOFA 3NGMA 1ECJA 2QAGC 3DMDA 3B6JA 5IASA 5ALUA 2DR2A 3JALB 1XCOA 3UAWA 3DZFA 3KQNA 2JAPA 3M6LA 4X0EA 1QTIA 3SF8B 1JAIA 1PBNA 2ZSDA 4I5EA 1OWOA 1NKSA 4YRJA 3ZWVA 5ITSA 3ADCA 4XYEA 4BU1A 1K8RA 5EZQA 4YGXB 5IUNC 1YS4A 2GDZA 3EIEA 4RPGA 3TQFA 3ZK8A 4MDEA 1DAOA 1SCDA 3DXZA 3EIWA 1ZOLA 1GEEA 3GO4A 4M1OA 2AN9A 4XCVA 3RK0A 4BMSA 3CNBA 1MT0A 1N6LA 2ODBA 4P4TA 4NULA 3FTCA 4HNTA 3ONEA 1GQOA 2UXCB 2OFOA 2GCEA 1JDBB 1OWLA 3FHJA 5ER6A 2J59A 1XZMA 4QTYA 5GINE 2VUIB 2HW8A 1SB9A 3KVOA 4QJ5A 2XRYA 1GGFA 3HEBA 4Z6KA 1QB8A 5T4FA 1DP4A 5K9ZA 1FS5A 2PR2A 5BSGA 3L8FA 3N6VA 2ZJ2A 3PXUA 4ZRMA 4EMBA 2Z95A 3T7KA 3N70A 3BE8A 1YJCA 1HT2E 1AG9A 3BIOA 1A4RA 1XLWA 1YULA 4NBVA 4PBRA 4QOSA 2ORED 3V1NA 4JC4A 3BDIA 1O94C 2QQGA 1P1IA 3WGUA 3CEPB 5I3ZA 3IUJA 1L8AA 3C6KA 2IP4A 3A11A 3C41J 1IOLA 3C85A 4EDHA 4ESHA 4A6EA 1YTLA 4DV0B 5E6RB 4CG3A 3GJ0A 4AC9A 2QV7A 4KYTA 1JHXA 2CB9A 2J41A 3R0VA 1GFSA 1UKEA 1R5JA 1Z6ZA 2CXOA 1SVLA 2JAUA 2JAOA 2YYAA 4LJAA 4KWHA 3WYDA 1AJEA 4Q4AB 5A03A 2OGTA 3INTA 4Y2SA 3HCBA 3I5AA 4S1WA 4TT3D 3HRKA 5T5QA 3DOOA 5LIRA 1C3VA 1EI9A 2C0PA 2GEDA 3C70A 1UBFA 4MVXA 1PK7A 2H4JA 4C0SA 8ADHA 4L4RA 3KEMA 5BN5A 2R6JA 5CRIA 1IN5A 2IZ7A 1Z2CA 3B48A 3ZS9A 3H6HA 3ZY6A 4MW6A 3NFYA 5ERYA 5GM2A 1QH0A 1SOUA 1B74A 1KTIA 3P0IA 3MJCA 4ZVOA 5FO0A 5LMCA 2IYPA 2Z1DA 1IEWA 3G7NA 3MWDA 2V6FA 4FMDF 2XADA 4TKVA 1KMMA 2D0IA 1Q84A 3FCUB 3K9CA 4LYFA 5IVHA 5A1JA 2VHWA 4E5UA 3WQSB 2VDQB 4TVBA 2NUTA 3EQ9A 4KIFA 4MYTA 5DIZA 2JBAB 1V3TA 1LBIA 1JHUA 3WWCA 1I6LA 4FLFA 5ENDA 4X7MA 2H52A 4G4IA 4MWTA 4X7PA 4DC1A 1P2FA 4B85A 4KREA 4LGVA 2MOKA 3UHOA 1MAAA 2Z5VA 4A0QA