4EY0A

Structure of tandem sh2 domains from plcgamma1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
243
structure length
234
Chain Sequence
NEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDFGAFVEANPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Integration of the PLCgamma Interaction Domains Critical for Regulatory Mechanisms and Signaling Deregulation.
pubmed doi rcsb
molecule keywords 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase ga
molecule tags Hydrolase
source organism Homo sapiens
total genus 54
structure length 234
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2012-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4ey0A02
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4ey0A01
1LUIA 2Y3AB 2GSBA 3HIZB 1SHBA 5EHPA 1CSYA 2L6KA 2DLYA 1BHHB 2C0OA 3VS5A 5EEQA 5AULA 1O4MA 1LUMA 5DC9A 1BMBA 4L1BB 2CR4A 3BUNB 1Z3KA 1BKMA 1BHFA 4LUDA 3N8MA 2H5KA 3GXXA 4XZ0A 4A4BA 1D4WA 3VRNA 2EO6A 3BUWB 1NRVA 4F5BA 5I6VA 4OHIA 4K45A 1O4GA 1B47A 4EIHA 4P9VA 1YVHA 2LNXA 3OVEA 5CDWA 2LQWA 1A1AA 1O4KA 1O4IA 2OZOA 3NHNA 3VRPA 3VS3A 1O44A 3EACA 3BUXB 3PLFB 2HDVA 1AB2A 1SHDA 1BLJA 4OHDA 3CXLA 2H46E 5AXIA 4JEGA 4FBNA 1OO3A 3BUOB 2MK2A 5KAZA 1JWOA 1X27A 4LUEA 5GJIA 1R1PA 2CI8A 1O49A 1MW4A 1AYDA 2YU7A 3PS5A 3EAZA 1O4BA 1O4DA 1M27A 5J3XA 1O46A 1UUSA 1MILA 3CWGA 1SPSA 5D0JA 1O45A 1K9AA 1Y1UA 4U17A 4K11A 2RVFA 4JGHA 1HCSB 3GQIB 1KSWA 2L3TA 1RQQC 1JU5A 2CS0A 5EG3B 1Y57A 2RORA 1O4OA 3BKBA 1FHSA 3IMDA 1A09A 4E93A 5GJHA 1R1SA 1O4PA 4GWFA 2XP1A 1A1EA 1OPLA 1A1BA 1I3ZA 2DLZA 1AYBA 2MQIA 1H9OA 1YVLA 3QWYA 1O4LA 1IJRA 1R1QA 2GE9A 1BHHA 4A4CA 2JYQA 2ABLA 4QSYA 3M7FA 1O42A 1O4JA 1BF5A 5DF6A 3IN8A 5HKYA 2HCKA 1A07A 2PLEA 1O4AA 3S9KA 3VGOA 4K2RA 3TL0A 3OV1A 1HCTB 2SHPA 2CIAA 1QCFA 1RPYA 3OB2B 2HDXA 1X6CA 3QWXX 2EL8A 2EYZA 4F59A 5EELA 4X6SA 2Y1MA 1LUKA 3IN7A 1A08A 1O4FA 2FCIA 4OHHA 1BFJA 3N84A 4F5AA 3OP0A 1O47A 1O41A 1UURA 1TCEA 3HCKA 3VS1A 3TKZA 2K7AB 1AD5A 3ZNIA 3PJPA 2IUIA 2KK6A 1PICA 4GL9E 1P13A 4OHLA 1JYUA 2EYYA 3KFJA 5DC0B 4OHEA 4FL2A 2ECDA 1FBVA 2C9WA 3IMJA 1CWDL 4NWGA 1KA7A 1F1WA 1FU6A 2VIFA 2FO0A 1O4EA 1IS0A 1GRIA 1KA6A 4E68A 4DGPA 1TZEE 1BG1A 1G83A 3CD3A 2AOBA 2B3OA 2MRKA 2L4KA 1AYCA 1QADA 1O48A 2LCTA 2LNWA 3C7IA 1O4CA 1FYRA 2SRCA 1BLKA 2RSYA 1WQUA 3N7YA 1NZVA 1D4TA 1FBZA 4U1PA 1GHUA 2OQ1A 1XA6A 1O43A 2PNBA 3S8LA 1A81A 2EO3A 2HUWA 1FU5A 2Y1NA 1NZLA 2AOAA 1BFIA 5EHRA 3UF4A 1LUNA 2ETZA 2IUGA 1JYRA 4JE4A 2K79B 3GXWA 4FL3A 1QG1E 4H1OA 3VRRA 1FMKA 3S8NA 2DM0A 3VRZA 3VRYA 4D8KA 4TZIA 1SPRA 1AOTF 4GPLB 1LCJA 1A1CA 3K2MA 1O4NA 2CBLA 2DX0A 3VRQA 2EU0A 1LKLA 3HHMB 2DVJA 1X0NA 1SHAA 3MXCA 4XZ1A 4P9ZA 1LKKA 4H34A 4NWFA 4WWQA 1CJ1A 1AOUF 1SKJA 1RJAA 3PSKA 5HKZA 1OPKA 1OO4A 3CBLA 1F2FA 2C0IA 2C0TA 2LQNA 5IBMA 2QMSA 1LCKA 3T04A 2IUHA 3BUMB 4K44A 3MXYA 5IBSA 3UYOA 3VS0A 2CI9A 3PFVA 2EKXA 3PSJA 3WA4A 2MRJA 1JYQA 2DCRA 3VS2A 1BM2A 5DC4A 3MAZA 3OB1B 2PNAA 4DGXA 3US4A 2PLDA 3VROA 1CWEA 1O4QA 3S8OA 2MC1A 4M4ZA 2HMHA 2KNOA 2CRHA 2BBUA 5BO4A 2PTKA 3VS4A 2IZVA 2EOBA 1O4HA 3VS6A 3VS7A 2AUGA 5HKWA 1D1ZA 1CSZA 1KC2A 2RMXA 2YSXA 1O4RA 1M61A 4EY0A 1BKLA 2EYVA 2H8HA 4ROJA 3PQZA 1AYAA 1ZFPE
chains in the Genus database with same CATH superfamily
1LUIA 2Y3AB 2GSBA 3HIZB 1SHBA 5EHPA 1CSYA 2L6KA 2DLYA 1BHHB 2C0OA 3VS5A 5EEQA 5AULA 1O4MA 1LUMA 5DC9A 1BMBA 4L1BB 2CR4A 3BUNB 1Z3KA 1BKMA 1BHFA 4LUDA 3N8MA 2H5KA 3GXXA 4XZ0A 4A4BA 1D4WA 3VRNA 2EO6A 3BUWB 1NRVA 4F5BA 5I6VA 4OHIA 4K45A 1O4GA 1B47A 4EIHA 4P9VA 1YVHA 2LNXA 3OVEA 5CDWA 2LQWA 1A1AA 1O4KA 1O4IA 2OZOA 3NHNA 3VRPA 3VS3A 1O44A 3EACA 3BUXB 3PLFB 2HDVA 1AB2A 1SHDA 1BLJA 4OHDA 3CXLA 2H46E 5AXIA 4JEGA 4FBNA 3K2TA 1OO3A 3BUOB 2MK2A 5KAZA 1JWOA 1X27A 4LUEA 5GJIA 1R1PA 2CI8A 1O49A 1MW4A 1AYDA 2YU7A 3PS5A 3EAZA 1O4BA 1O4DA 1M27A 5J3XA 1O46A 1UUSA 1MILA 3CWGA 1SPSA 5D0JA 1O45A 1K9AA 1Y1UA 4U17A 4K11A 2RVFA 4JGHA 1HCSB 3GQIB 1KSWA 2L3TA 1RQQC 1JU5A 2CS0A 5EG3B 1Y57A 2RORA 1O4OA 3BKBA 1FHSA 3IMDA 1A09A 4E93A 5GJHA 1R1SA 1O4PA 4GWFA 2XP1A 1A1EA 1OPLA 1A1BA 1I3ZA 2DLZA 1AYBA 2MQIA 1H9OA 1YVLA 3QWYA 2KGYA 1O4LA 1IJRA 1R1QA 2GE9A 1BHHA 4A4CA 2JYQA 2ABLA 4QSYA 3M7FA 1O42A 1O4JA 1BF5A 5DF6A 3IN8A 5HKYA 2HCKA 1A07A 2PLEA 1O4AA 3S9KA 3VGOA 4K2RA 3TL0A 3OV1A 1HCTB 2SHPA 2CIAA 1QCFA 1RPYA 3OB2B 2HDXA 1X6CA 3QWXX 2EL8A 2EYZA 4F59A 5EELA 4X6SA 2Y1MA 1LUKA 3IN7A 1A08A 1O4FA 2FCIA 4OHHA 1BFJA 3N84A 4F5AA 3OP0A 1O47A 1O41A 1UURA 1TCEA 3HCKA 3VS1A 3TKZA 2K7AB 1AD5A 3ZNIA 3PJPA 2IUIA 2KK6A 1PICA 4GL9E 1P13A 4OHLA 1JYUA 2EYYA 3KFJA 5DC0B 4OHEA 4FL2A 2ECDA 1FBVA 2C9WA 3IMJA 1CWDL 4NWGA 1KA7A 1F1WA 1FU6A 2VIFA 2FO0A 1O4EA 1IS0A 1GRIA 1KA6A 4E68A 4DGPA 1TZEE 1BG1A 1G83A 3CD3A 2AOBA 2B3OA 2MRKA 2L4KA 1AYCA 1QADA 1O48A 2LCTA 2LNWA 3C7IA 1O4CA 1FYRA 2SRCA 1BLKA 2LRAA 2RSYA 1WQUA 3N7YA 1NZVA 1D4TA 1FBZA 4U1PA 1GHUA 2OQ1A 1XA6A 1O43A 2PNBA 3S8LA 1A81A 2EO3A 2HUWA 1FU5A 2Y1NA 1NZLA 2AOAA 1BFIA 5EHRA 3UF4A 1LUNA 2ETZA 2IUGA 1JYRA 4JE4A 2K79B 3GXWA 4FL3A 1QG1E 4H1OA 3VRRA 1FMKA 3S8NA 2DM0A 3VRZA 3VRYA 4D8KA 4TZIA 1SPRA 1AOTF 4GPLB 1LCJA 1A1CA 3K2MA 1O4NA 2CBLA 2DX0A 3VRQA 2EU0A 1LKLA 3HHMB 3LYVA 2DVJA 1X0NA 1SHAA 3MXCA 4XZ1A 4P9ZA 1LKKA 4H34A 4NWFA 4WWQA 1CJ1A 1AOUF 1SKJA 1RJAA 3PSKA 5HKZA 1OPKA 1OO4A 3CBLA 1F2FA 2C0IA 2C0TA 2LQNA 5IBMA 2QMSA 1LCKA 3T04A 2IUHA 3BUMB 4K44A 3MXYA 5IBSA 3UYOA 3VS0A 2CI9A 3PFVA 2EKXA 3PSJA 3WA4A 2MRJA 1JYQA 2DCRA 3VS2A 1BM2A 5DC4A 3MAZA 3OB1B 2PNAA 4DGXA 3US4A 2PLDA 3VROA 1CWEA 1O4QA 3S8OA 2MC1A 4M4ZA 2HMHA 2KNOA 2CRHA 2BBUA 5BO4A 2PTKA 3VS4A 2IZVA 2EOBA 1O4HA 3VS6A 3VS7A 2AUGA 5HKWA 1D1ZA 1CSZA 1KC2A 2RMXA 2YSXA 1O4RA 1M61A 4EY0A 1BKLA 2EYVA 2H8HA 4ROJA 3PQZA 1AYAA 1ZFPE
chains in the Genus database with same CATH topology
1LUIA 2Y3AB 2GSBA 3HIZB 1SHBA 5EHPA 1CSYA 2L6KA 2DLYA 1BHHB 2C0OA 3VS5A 5EEQA 5AULA 1O4MA 1LUMA 5DC9A 1BMBA 4L1BB 2CR4A 3BUNB 1Z3KA 1BKMA 1BHFA 4LUDA 3N8MA 2H5KA 3GXXA 4XZ0A 4A4BA 1D4WA 3VRNA 2EO6A 3BUWB 1NRVA 4F5BA 5I6VA 4OHIA 4K45A 1O4GA 1B47A 4EIHA 4P9VA 1YVHA 2LNXA 3OVEA 5CDWA 2LQWA 1A1AA 1O4KA 1O4IA 2OZOA 3NHNA 3VRPA 3VS3A 1O44A 3EACA 3BUXB 3PLFB 2HDVA 1AB2A 1SHDA 1BLJA 4OHDA 3CXLA 2H46E 5AXIA 4JEGA 4FBNA 1OO3A 3BUOB 2MK2A 5KAZA 1JWOA 1X27A 4LUEA 5GJIA 1R1PA 2CI8A 1O49A 1MW4A 1AYDA 2YU7A 3PS5A 3EAZA 1O4BA 1O4DA 1M27A 5J3XA 1O46A 1UUSA 1MILA 3CWGA 1SPSA 5D0JA 1O45A 1K9AA 1Y1UA 4U17A 4K11A 2RVFA 4JGHA 1HCSB 3GQIB 1KSWA 2L3TA 1RQQC 1JU5A 2CS0A 5EG3B 1Y57A 2RORA 1O4OA 3BKBA 1FHSA 3IMDA 1A09A 4E93A 5GJHA 1R1SA 1O4PA 4GWFA 2XP1A 1A1EA 1OPLA 1A1BA 1I3ZA 2DLZA 1AYBA 2MQIA 1H9OA 1YVLA 3QWYA 1O4LA 1IJRA 1R1QA 2GE9A 1BHHA 4A4CA 2JYQA 2ABLA 4QSYA 3M7FA 1O42A 1O4JA 1BF5A 5DF6A 3IN8A 5HKYA 2HCKA 1A07A 2PLEA 1O4AA 3S9KA 3VGOA 4K2RA 3TL0A 3OV1A 1HCTB 2SHPA 2CIAA 1QCFA 1RPYA 3OB2B 2HDXA 1X6CA 3QWXX 2EL8A 2EYZA 4F59A 5EELA 4X6SA 2Y1MA 1LUKA 3IN7A 1A08A 1O4FA 2FCIA 4OHHA 1BFJA 3N84A 4F5AA 3OP0A 1O47A 1O41A 1UURA 1TCEA 3HCKA 3VS1A 3TKZA 2K7AB 1AD5A 3ZNIA 3PJPA 2IUIA 2KK6A 1PICA 4GL9E 1P13A 4OHLA 1JYUA 2EYYA 3KFJA 5DC0B 4OHEA 4FL2A 2ECDA 1FBVA 2C9WA 3IMJA 1CWDL 4NWGA 1KA7A 1F1WA 1FU6A 2VIFA 2FO0A 1O4EA 1IS0A 1GRIA 1KA6A 4E68A 4DGPA 1TZEE 1BG1A 1G83A 3CD3A 2AOBA 2B3OA 2MRKA 2L4KA 1AYCA 1QADA 1O48A 2LCTA 2LNWA 3C7IA 1O4CA 1FYRA 2SRCA 1BLKA 2RSYA 1WQUA 3N7YA 1NZVA 1D4TA 1FBZA 4U1PA 1GHUA 2OQ1A 1XA6A 1O43A 2PNBA 3S8LA 1A81A 2EO3A 2HUWA 1FU5A 2Y1NA 1NZLA 2AOAA 1BFIA 5EHRA 3UF4A 1LUNA 2ETZA 2IUGA 1JYRA 4JE4A 2K79B 3GXWA 4FL3A 1QG1E 4H1OA 3VRRA 1FMKA 3S8NA 2DM0A 3VRZA 3VRYA 4D8KA 4TZIA 1SPRA 1AOTF 4GPLB 1LCJA 1A1CA 3K2MA 1O4NA 2CBLA 2DX0A 3VRQA 2EU0A 1LKLA 3HHMB 2DVJA 1X0NA 1SHAA 3MXCA 4XZ1A 4P9ZA 1LKKA 4H34A 4NWFA 4WWQA 1CJ1A 1AOUF 1SKJA 1RJAA 3PSKA 5HKZA 1OPKA 1OO4A 3CBLA 1F2FA 2C0IA 2C0TA 2LQNA 5IBMA 2QMSA 1LCKA 3T04A 2IUHA 3BUMB 4K44A 3MXYA 5IBSA 3UYOA 3VS0A 2CI9A 3PFVA 2EKXA 3PSJA 3WA4A 2MRJA 1JYQA 2DCRA 3VS2A 1BM2A 5DC4A 3MAZA 3OB1B 2PNAA 4DGXA 3US4A 2PLDA 3VROA 1CWEA 1O4QA 3S8OA 2MC1A 4M4ZA 2HMHA 2KNOA 2CRHA 2BBUA 5BO4A 2PTKA 3VS4A 2IZVA 2EOBA 1O4HA 3VS6A 3VS7A 2AUGA 5HKWA 1D1ZA 1CSZA 1KC2A 2RMXA 2YSXA 1O4RA 1M61A 4EY0A 1BKLA 2EYVA 2H8HA 4ROJA 3PQZA 1AYAA 1ZFPE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LUI A;  2Y3A B;  2GSB A;  3HIZ B;  1SHB A;  5EHP A;  1CSY A;  2L6K A;  2DLY A;  1BHH B;  2C0O A;  3VS5 A;  5EEQ A;  5AUL A;  1O4M A;  1LUM A;  5DC9 A;  1BMB A;  4L1B B;  2CR4 A;  3BUN B;  1Z3K A;  1BKM A;  1BHF A;  4LUD A;  3N8M A;  2H5K A;  3GXX A;  4XZ0 A;  4A4B A;  1D4W A;  3VRN A;  2EO6 A;  3BUW B;  1NRV A;  4F5B A;  5I6V A;  4OHI A;  4K45 A;  1O4G A;  1B47 A;  4EIH A;  4P9V A;  1YVH A;  2LNX A;  3OVE A;  5CDW A;  2LQW A;  1A1A A;  1O4K A;  1O4I A;  2OZO A;  3NHN A;  3VRP A;  3VS3 A;  1O44 A;  3EAC A;  3BUX B;  3PLF B;  2HDV A;  1AB2 A;  1SHD A;  1BLJ A;  4OHD A;  3CXL A;  2H46 E;  5AXI A;  4JEG A;  4FBN A;  1OO3 A;  3BUO B;  2MK2 A;  5KAZ A;  1JWO A;  1X27 A;  4LUE A;  5GJI A;  1R1P A;  2CI8 A;  1O49 A;  1MW4 A;  1AYD A;  2YU7 A;  3PS5 A;  3EAZ A;  1O4B A;  1O4D A;  1M27 A;  5J3X A;  1O46 A;  1UUS A;  1MIL A;  3CWG A;  1SPS A;  5D0J A;  1O45 A;  1K9A A;  1Y1U A;  4U17 A;  4K11 A;  2RVF A;  4JGH A;  1HCS B;  3GQI B;  1KSW A;  2L3T A;  1RQQ C;  1JU5 A;  2CS0 A;  5EG3 B;  1Y57 A;  2ROR A;  1O4O A;  3BKB A;  1FHS A;  3IMD A;  1A09 A;  4E93 A;  5GJH A;  1R1S A;  1O4P A;  4GWF A;  2XP1 A;  1A1E A;  1OPL A;  1A1B A;  1I3Z A;  2DLZ A;  1AYB A;  2MQI A;  1H9O A;  1YVL A;  3QWY A;  1O4L A;  1IJR A;  1R1Q A;  2GE9 A;  1BHH A;  4A4C A;  2JYQ A;  2ABL A;  4QSY A;  3M7F A;  1O42 A;  1O4J A;  1BF5 A;  5DF6 A;  3IN8 A;  5HKY A;  2HCK A;  1A07 A;  2PLE A;  1O4A A;  3S9K A;  3VGO A;  4K2R A;  3TL0 A;  3OV1 A;  1HCT B;  2SHP A;  2CIA A;  1QCF A;  1RPY A;  3OB2 B;  2HDX A;  1X6C A;  3QWX X;  2EL8 A;  2EYZ A;  4F59 A;  5EEL A;  4X6S A;  2Y1M A;  1LUK A;  3IN7 A;  1A08 A;  1O4F A;  2FCI A;  4OHH A;  1BFJ A;  3N84 A;  4F5A A;  3OP0 A;  1O47 A;  1O41 A;  1UUR A;  1TCE A;  3HCK A;  3VS1 A;  3TKZ A;  2K7A B;  1AD5 A;  3ZNI A;  3PJP A;  2IUI A;  2KK6 A;  1PIC A;  4GL9 E;  1P13 A;  4OHL A;  1JYU A;  2EYY A;  3KFJ A;  5DC0 B;  4OHE A;  4FL2 A;  2ECD A;  1FBV A;  2C9W A;  3IMJ A;  1CWD L;  4NWG A;  1KA7 A;  1F1W A;  1FU6 A;  2VIF A;  2FO0 A;  1O4E A;  1IS0 A;  1GRI A;  1KA6 A;  4E68 A;  4DGP A;  1TZE E;  1BG1 A;  1G83 A;  3CD3 A;  2AOB A;  2B3O A;  2MRK A;  2L4K A;  1AYC A;  1QAD A;  1O48 A;  2LCT A;  2LNW A;  3C7I A;  1O4C A;  1FYR A;  2SRC A;  1BLK A;  2RSY A;  1WQU A;  3N7Y A;  1NZV A;  1D4T A;  1FBZ A;  4U1P A;  1GHU A;  2OQ1 A;  1XA6 A;  1O43 A;  2PNB A;  3S8L A;  1A81 A;  2EO3 A;  2HUW A;  1FU5 A;  2Y1N A;  1NZL A;  2AOA A;  1BFI A;  5EHR A;  3UF4 A;  1LUN A;  2ETZ A;  2IUG A;  1JYR A;  4JE4 A;  2K79 B;  3GXW A;  4FL3 A;  1QG1 E;  4H1O A;  3VRR A;  1FMK A;  3S8N A;  2DM0 A;  3VRZ A;  3VRY A;  4D8K A;  4TZI A;  1SPR A;  1AOT F;  4GPL B;  1LCJ A;  1A1C A;  3K2M A;  1O4N A;  2CBL A;  2DX0 A;  3VRQ A;  2EU0 A;  1LKL A;  3HHM B;  2DVJ A;  1X0N A;  1SHA A;  3MXC A;  4XZ1 A;  4P9Z A;  1LKK A;  4H34 A;  4NWF A;  4WWQ A;  1CJ1 A;  1AOU F;  1SKJ A;  1RJA A;  3PSK A;  5HKZ A;  1OPK A;  1OO4 A;  3CBL A;  1F2F A;  2C0I A;  2C0T A;  2LQN A;  5IBM A;  2QMS A;  1LCK A;  3T04 A;  2IUH A;  3BUM B;  4K44 A;  3MXY A;  5IBS A;  3UYO A;  3VS0 A;  2CI9 A;  3PFV A;  2EKX A;  3PSJ A;  3WA4 A;  2MRJ A;  1JYQ A;  2DCR A;  3VS2 A;  1BM2 A;  5DC4 A;  3MAZ A;  3OB1 B;  2PNA A;  4DGX A;  3US4 A;  2PLD A;  3VRO A;  1CWE A;  1O4Q A;  3S8O A;  2MC1 A;  4M4Z A;  2HMH A;  2KNO A;  2CRH A;  2BBU A;  5BO4 A;  2PTK A;  3VS4 A;  2IZV A;  2EOB A;  1O4H A;  3VS6 A;  3VS7 A;  2AUG A;  5HKW A;  1D1Z A;  1CSZ A;  1KC2 A;  2RMX A;  2YSX A;  1O4R A;  1M61 A;  4EY0 A;  1BKL A;  2EYV A;  2H8H A;  4ROJ A;  3PQZ A;  1AYA A;  1ZFP E; 
#chains in the Genus database with same CATH topology
 1LUI A;  2Y3A B;  2GSB A;  3HIZ B;  1SHB A;  5EHP A;  1CSY A;  2L6K A;  2DLY A;  1BHH B;  2C0O A;  3VS5 A;  5EEQ A;  5AUL A;  1O4M A;  1LUM A;  5DC9 A;  1BMB A;  4L1B B;  2CR4 A;  3BUN B;  1Z3K A;  1BKM A;  1BHF A;  4LUD A;  3N8M A;  2H5K A;  3GXX A;  4XZ0 A;  4A4B A;  1D4W A;  3VRN A;  2EO6 A;  3BUW B;  1NRV A;  4F5B A;  5I6V A;  4OHI A;  4K45 A;  1O4G A;  1B47 A;  4EIH A;  4P9V A;  1YVH A;  2LNX A;  3OVE A;  5CDW A;  2LQW A;  1A1A A;  1O4K A;  1O4I A;  2OZO A;  3NHN A;  3VRP A;  3VS3 A;  1O44 A;  3EAC A;  3BUX B;  3PLF B;  2HDV A;  1AB2 A;  1SHD A;  1BLJ A;  4OHD A;  3CXL A;  2H46 E;  5AXI A;  4JEG A;  4FBN A;  3K2T A;  1OO3 A;  3BUO B;  2MK2 A;  5KAZ A;  1JWO A;  1X27 A;  4LUE A;  5GJI A;  1R1P A;  2CI8 A;  1O49 A;  1MW4 A;  1AYD A;  2YU7 A;  3PS5 A;  3EAZ A;  1O4B A;  1O4D A;  1M27 A;  5J3X A;  1O46 A;  1UUS A;  1MIL A;  3CWG A;  1SPS A;  5D0J A;  1O45 A;  1K9A A;  1Y1U A;  4U17 A;  4K11 A;  2RVF A;  4JGH A;  1HCS B;  3GQI B;  1KSW A;  2L3T A;  1RQQ C;  1JU5 A;  2CS0 A;  5EG3 B;  1Y57 A;  2ROR A;  1O4O A;  3BKB A;  1FHS A;  3IMD A;  1A09 A;  4E93 A;  5GJH A;  1R1S A;  1O4P A;  4GWF A;  2XP1 A;  1A1E A;  1OPL A;  1A1B A;  1I3Z A;  2DLZ A;  1AYB A;  2MQI A;  1H9O A;  1YVL A;  3QWY A;  2KGY A;  1O4L A;  1IJR A;  1R1Q A;  2GE9 A;  1BHH A;  4A4C A;  2JYQ A;  2ABL A;  4QSY A;  3M7F A;  1O42 A;  1O4J A;  1BF5 A;  5DF6 A;  3IN8 A;  5HKY A;  2HCK A;  1A07 A;  2PLE A;  1O4A A;  3S9K A;  3VGO A;  4K2R A;  3TL0 A;  3OV1 A;  1HCT B;  2SHP A;  2CIA A;  1QCF A;  1RPY A;  3OB2 B;  2HDX A;  1X6C A;  3QWX X;  2EL8 A;  2EYZ A;  4F59 A;  5EEL A;  4X6S A;  2Y1M A;  1LUK A;  3IN7 A;  1A08 A;  1O4F A;  2FCI A;  4OHH A;  1BFJ A;  3N84 A;  4F5A A;  3OP0 A;  1O47 A;  1O41 A;  1UUR A;  1TCE A;  3HCK A;  3VS1 A;  3TKZ A;  2K7A B;  1AD5 A;  3ZNI A;  3PJP A;  2IUI A;  2KK6 A;  1PIC A;  4GL9 E;  1P13 A;  4OHL A;  1JYU A;  2EYY A;  3KFJ A;  5DC0 B;  4OHE A;  4FL2 A;  2ECD A;  1FBV A;  2C9W A;  3IMJ A;  1CWD L;  4NWG A;  1KA7 A;  1F1W A;  1FU6 A;  2VIF A;  2FO0 A;  1O4E A;  1IS0 A;  1GRI A;  1KA6 A;  4E68 A;  4DGP A;  1TZE E;  1BG1 A;  1G83 A;  3CD3 A;  2AOB A;  2B3O A;  2MRK A;  2L4K A;  1AYC A;  1QAD A;  1O48 A;  2LCT A;  2LNW A;  3C7I A;  1O4C A;  1FYR A;  2SRC A;  1BLK A;  2LRA A;  2RSY A;  1WQU A;  3N7Y A;  1NZV A;  1D4T A;  1FBZ A;  4U1P A;  1GHU A;  2OQ1 A;  1XA6 A;  1O43 A;  2PNB A;  3S8L A;  1A81 A;  2EO3 A;  2HUW A;  1FU5 A;  2Y1N A;  1NZL A;  2AOA A;  1BFI A;  5EHR A;  3UF4 A;  1LUN A;  2ETZ A;  2IUG A;  1JYR A;  4JE4 A;  2K79 B;  3GXW A;  4FL3 A;  1QG1 E;  4H1O A;  3VRR A;  1FMK A;  3S8N A;  2DM0 A;  3VRZ A;  3VRY A;  4D8K A;  4TZI A;  1SPR A;  1AOT F;  4GPL B;  1LCJ A;  1A1C A;  3K2M A;  1O4N A;  2CBL A;  2DX0 A;  3VRQ A;  2EU0 A;  1LKL A;  3HHM B;  3LYV A;  2DVJ A;  1X0N A;  1SHA A;  3MXC A;  4XZ1 A;  4P9Z A;  1LKK A;  4H34 A;  4NWF A;  4WWQ A;  1CJ1 A;  1AOU F;  1SKJ A;  1RJA A;  3PSK A;  5HKZ A;  1OPK A;  1OO4 A;  3CBL A;  1F2F A;  2C0I A;  2C0T A;  2LQN A;  5IBM A;  2QMS A;  1LCK A;  3T04 A;  2IUH A;  3BUM B;  4K44 A;  3MXY A;  5IBS A;  3UYO A;  3VS0 A;  2CI9 A;  3PFV A;  2EKX A;  3PSJ A;  3WA4 A;  2MRJ A;  1JYQ A;  2DCR A;  3VS2 A;  1BM2 A;  5DC4 A;  3MAZ A;  3OB1 B;  2PNA A;  4DGX A;  3US4 A;  2PLD A;  3VRO A;  1CWE A;  1O4Q A;  3S8O A;  2MC1 A;  4M4Z A;  2HMH A;  2KNO A;  2CRH A;  2BBU A;  5BO4 A;  2PTK A;  3VS4 A;  2IZV A;  2EOB A;  1O4H A;  3VS6 A;  3VS7 A;  2AUG A;  5HKW A;  1D1Z A;  1CSZ A;  1KC2 A;  2RMX A;  2YSX A;  1O4R A;  1M61 A;  4EY0 A;  1BKL A;  2EYV A;  2H8H A;  4ROJ A;  3PQZ A;  1AYA A;  1ZFP E; 
#chains in the Genus database with same CATH homology
 1LUI A;  2Y3A B;  2GSB A;  3HIZ B;  1SHB A;  5EHP A;  1CSY A;  2L6K A;  2DLY A;  1BHH B;  2C0O A;  3VS5 A;  5EEQ A;  5AUL A;  1O4M A;  1LUM A;  5DC9 A;  1BMB A;  4L1B B;  2CR4 A;  3BUN B;  1Z3K A;  1BKM A;  1BHF A;  4LUD A;  3N8M A;  2H5K A;  3GXX A;  4XZ0 A;  4A4B A;  1D4W A;  3VRN A;  2EO6 A;  3BUW B;  1NRV A;  4F5B A;  5I6V A;  4OHI A;  4K45 A;  1O4G A;  1B47 A;  4EIH A;  4P9V A;  1YVH A;  2LNX A;  3OVE A;  5CDW A;  2LQW A;  1A1A A;  1O4K A;  1O4I A;  2OZO A;  3NHN A;  3VRP A;  3VS3 A;  1O44 A;  3EAC A;  3BUX B;  3PLF B;  2HDV A;  1AB2 A;  1SHD A;  1BLJ A;  4OHD A;  3CXL A;  2H46 E;  5AXI A;  4JEG A;  4FBN A;  1OO3 A;  3BUO B;  2MK2 A;  5KAZ A;  1JWO A;  1X27 A;  4LUE A;  5GJI A;  1R1P A;  2CI8 A;  1O49 A;  1MW4 A;  1AYD A;  2YU7 A;  3PS5 A;  3EAZ A;  1O4B A;  1O4D A;  1M27 A;  5J3X A;  1O46 A;  1UUS A;  1MIL A;  3CWG A;  1SPS A;  5D0J A;  1O45 A;  1K9A A;  1Y1U A;  4U17 A;  4K11 A;  2RVF A;  4JGH A;  1HCS B;  3GQI B;  1KSW A;  2L3T A;  1RQQ C;  1JU5 A;  2CS0 A;  5EG3 B;  1Y57 A;  2ROR A;  1O4O A;  3BKB A;  1FHS A;  3IMD A;  1A09 A;  4E93 A;  5GJH A;  1R1S A;  1O4P A;  4GWF A;  2XP1 A;  1A1E A;  1OPL A;  1A1B A;  1I3Z A;  2DLZ A;  1AYB A;  2MQI A;  1H9O A;  1YVL A;  3QWY A;  1O4L A;  1IJR A;  1R1Q A;  2GE9 A;  1BHH A;  4A4C A;  2JYQ A;  2ABL A;  4QSY A;  3M7F A;  1O42 A;  1O4J A;  1BF5 A;  5DF6 A;  3IN8 A;  5HKY A;  2HCK A;  1A07 A;  2PLE A;  1O4A A;  3S9K A;  3VGO A;  4K2R A;  3TL0 A;  3OV1 A;  1HCT B;  2SHP A;  2CIA A;  1QCF A;  1RPY A;  3OB2 B;  2HDX A;  1X6C A;  3QWX X;  2EL8 A;  2EYZ A;  4F59 A;  5EEL A;  4X6S A;  2Y1M A;  1LUK A;  3IN7 A;  1A08 A;  1O4F A;  2FCI A;  4OHH A;  1BFJ A;  3N84 A;  4F5A A;  3OP0 A;  1O47 A;  1O41 A;  1UUR A;  1TCE A;  3HCK A;  3VS1 A;  3TKZ A;  2K7A B;  1AD5 A;  3ZNI A;  3PJP A;  2IUI A;  2KK6 A;  1PIC A;  4GL9 E;  1P13 A;  4OHL A;  1JYU A;  2EYY A;  3KFJ A;  5DC0 B;  4OHE A;  4FL2 A;  2ECD A;  1FBV A;  2C9W A;  3IMJ A;  1CWD L;  4NWG A;  1KA7 A;  1F1W A;  1FU6 A;  2VIF A;  2FO0 A;  1O4E A;  1IS0 A;  1GRI A;  1KA6 A;  4E68 A;  4DGP A;  1TZE E;  1BG1 A;  1G83 A;  3CD3 A;  2AOB A;  2B3O A;  2MRK A;  2L4K A;  1AYC A;  1QAD A;  1O48 A;  2LCT A;  2LNW A;  3C7I A;  1O4C A;  1FYR A;  2SRC A;  1BLK A;  2RSY A;  1WQU A;  3N7Y A;  1NZV A;  1D4T A;  1FBZ A;  4U1P A;  1GHU A;  2OQ1 A;  1XA6 A;  1O43 A;  2PNB A;  3S8L A;  1A81 A;  2EO3 A;  2HUW A;  1FU5 A;  2Y1N A;  1NZL A;  2AOA A;  1BFI A;  5EHR A;  3UF4 A;  1LUN A;  2ETZ A;  2IUG A;  1JYR A;  4JE4 A;  2K79 B;  3GXW A;  4FL3 A;  1QG1 E;  4H1O A;  3VRR A;  1FMK A;  3S8N A;  2DM0 A;  3VRZ A;  3VRY A;  4D8K A;  4TZI A;  1SPR A;  1AOT F;  4GPL B;  1LCJ A;  1A1C A;  3K2M A;  1O4N A;  2CBL A;  2DX0 A;  3VRQ A;  2EU0 A;  1LKL A;  3HHM B;  2DVJ A;  1X0N A;  1SHA A;  3MXC A;  4XZ1 A;  4P9Z A;  1LKK A;  4H34 A;  4NWF A;  4WWQ A;  1CJ1 A;  1AOU F;  1SKJ A;  1RJA A;  3PSK A;  5HKZ A;  1OPK A;  1OO4 A;  3CBL A;  1F2F A;  2C0I A;  2C0T A;  2LQN A;  5IBM A;  2QMS A;  1LCK A;  3T04 A;  2IUH A;  3BUM B;  4K44 A;  3MXY A;  5IBS A;  3UYO A;  3VS0 A;  2CI9 A;  3PFV A;  2EKX A;  3PSJ A;  3WA4 A;  2MRJ A;  1JYQ A;  2DCR A;  3VS2 A;  1BM2 A;  5DC4 A;  3MAZ A;  3OB1 B;  2PNA A;  4DGX A;  3US4 A;  2PLD A;  3VRO A;  1CWE A;  1O4Q A;  3S8O A;  2MC1 A;  4M4Z A;  2HMH A;  2KNO A;  2CRH A;  2BBU A;  5BO4 A;  2PTK A;  3VS4 A;  2IZV A;  2EOB A;  1O4H A;  3VS6 A;  3VS7 A;  2AUG A;  5HKW A;  1D1Z A;  1CSZ A;  1KC2 A;  2RMX A;  2YSX A;  1O4R A;  1M61 A;  4EY0 A;  1BKL A;  2EYV A;  2H8H A;  4ROJ A;  3PQZ A;  1AYA A;  1ZFP E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...