4EZNA

Crystal structure of the substrate binding domain of e.coli dnak in complex with pyrrhocoricin
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
211
structure length
211
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
molecule keywords Chaperone protein DnaK
total genus 60
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4eznA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4eznA01
4H6IA 3T46A 4JN4A 1DKYA 4EZWA 2BPRA 4R5KA 4JWEA 3DQGA 7HSCA 4EZPA 4B9QA 3D2EA 3N8EA 4EZVA 1YUWA 4EZOA 4R5JA 4R5IA 4FL9A 3DPPA 3DPQA 3T49A 4EZNA 4EZYA 1DG4A 4JWIA 4EZSA 2OP6A 4R5GA 1BPRA 2V7YA 4JNFA 3T47A 4F00A 3T48A 4HY9A 3DPOA 2QXLA 3L3OM 3OHXM 4EZUA 3D2FA 4H6HA 4JWCA 5E84A 2WINM 4E81A 4EZTA 4EZXA 4EZRA 1Q5LA 3C7NA 3DOBA 1CKRA 4R5LA 2QFFA 5TKYA 3H0XA 4HYBA 4WV5A 1DKZA 4JWDA 4EZZA 2KHOA 4PO2A 3C7NB 4WV7A 1DKXA 4JNEA 4EZQA 3T4AG 4F01A 3QNJA 1U00A
chains in the Genus database with same CATH superfamily
1GNLA 4JN4A 1DKYA 2JNSA 3BUIA 4R5KA 4WPEA 1R33A 2Q12A 3HAHA 3D2EA 3OWGA 2ALWA 4FM3A 4B9QA 1MJGA 4EZOA 1R5EA 2Z8YA 2FICA 3I01A 4R5JA 3T49A 3SBSA 1GN9A 4EZSA 1E1DA 1HXKA 2YLAA 2Z0NA 2D1LA 4HR1A 3EJSA 2YL8A 3M3WA 4JNFA 2V0OA 2YIAA 3ACOA 4AKVA 4IM0A 1O7DB 4M0MA 2F18A 1GNTA 1SU7A 4AVMA 3D2FA 1WDZA 2GF4A 2WYIA 3PLTA 3VKHA 3BVWA 4I43A 2X3VA 3HAIA 4IWOA 2OBLA 2EWFA 3DYTA 1HTYA 1QWNA 1Y2OA 2KHOA 3D50A 3LVTA 1QX1A 4EZZA 4WV7A 4G6QA 3I2WA 2F1AA 3SBTB 3ZEFA 3DQGA 3QNJA 3BUBA 3G9GA 2C08A 7HSCA 3LLLA 4NSWA 1U00A 3DX0A 3EJUA 3T46A 4ATMA 4EZWA 2BPRA 1E9VA 3BLBA 3EJPA 2YIVX 2X3XA 3ER9B 3N8EA 3D51A 3BVVA 4AZHA 2ND0A 2OO2A 2OZNB 2X5CA 3ER8C 4EZYA 2EX3B 3DPQA 4EZNA 3CAZA 2YI8A 1I4DA 3A98A 4JWIA 3LMFA 3KAWA 2OW6A 4DCNC 1SUFA 4H8SA 3CZNA 3BUPA 4UDYX 4NPHA 5C5BA 3BUDA 3GI7A 4MQDA 4F00A 3VEBA 2RAKA 3DPOA 3QWEA 1TQSA 3L3OM 4HR1B 3RV1A 1TQUA 2FYVA 3T48A 4ILGA 1JQKA 4H6HA 5E84A 1I4LA 3DX4A 1X03A 2EFKA 3I04A 3SYVA 3O3NB 2F1BA 3D4YA 4IWQA 3VEAA 4ILIA 3EJTA 4IM3A 2F7QA 3BVTA 4HYBA 4PO2A 4JWDA 3C7NB 4FZSA 4AZIA 1OA0A 1YWMA 1DKXA 3EJQA 4EZQA 3B53X 3SOGA 2QKWA 3DDGA 4H6IA 2D4CA 2EFLA 4I1QA 4JWEA 4AZBA 2YLLA 1URUA 3L3PA 1SU6A 4DYLA 3DDFA 5FIGA 1YUWA 3H0XA 3DPPA 5FLEX 2WYHA 2Z0VA 2O0I1 2OP6A 4R5GA 1BPRA 3CV5A 3O3MB 4KIKB 4WPCA 4D8JA 3D4ZA 1OA1A 3RV0A 3T47A 4E3CA 4HY9A 4FZPA 2OBMA 2PMRA 2F7RA 3FD9A 3OHXM 4JWCA 4E81A 2WINM 1E2UA 4EZTA 1ZYLA 1LQ7A 1OAOA 3B52X 2YI9A 3C7NA 3DOBA 4UDXX 3QNIA 1O7DC 1I49A 1I4TA 2YKTA 2YIBA 2RAJA 4IM2A 5TKYA 1TQTA 2LXYA 3OK8A 2RAIA 2ND1A 2Z0OA 3BVUA 4JNEA 2MI7A 4IWPA 3T4AG 1TQWA 4IW0A 2LM0A 4AZGA 2YL6A 2JNKA 3Q84A 4JL9A 4R5LA 4NQIA 3BUQA 3CZSA 4AZCB 4BNEA 4EZPA 1QWUA 2PY6A 4EZVA 3QE6A 2GA9D 3KAVA 3Q0KA 4R5IA 3B51X 4AZCA 4FL9A 1X04A 3D52A 4FZOA 1PS3A 1DG4A 2Q13A 3DX2A 4AZ7A 2F7PA 3CVRA 3QA8A 2GAFD 2N3KA 2F7OA 3F7WA 3DX3A 5KBPA 3HAJA 2RT6A 4JLCA 2V7YA 3BVXA 1R34A 2X3WA 4KIKA 2QXLA 5C5BB 4EZUA 1Q5LA 1SU8A 1UPXA 4EZRA 4EZXA 2OW7A 1CKRA 3UITA 4AZ5A 2QFFA 2YL9A 2NCZA 2ZXQA 3DX1A 1DKZA 3KDRA 3O3OB 3RPMA 4AZ6A 3ABHA 4WV5A 3CKDA 3EJRA 2YL5A 1ZWWA 3ZEDA 3I39X 4F01A 1HWWA 3ERCC 1W9MA 2ELBA 4ILHB 1TQVA
chains in the Genus database with same CATH topology
1GNLA 4JN4A 1DKYA 2JNSA 4R5KA 3DQGA 7HSCA 4FM3A 4B9QA 3D2EA 3OWGA 1MJGA 4EZOA 2Z8YA 3I01A 4R5JA 3T49A 3SBSA 1GN9A 4EZSA 1E1DA 4HR1A 4JNFA 2YIAA 4IM0A 4M0MA 1GNTA 1SU7A 3D2FA 3VKHA 4I43A 4IWOA 2OBLA 2EWFA 4EZZA 2KHOA 4WV7A 3SBTB 4G6QA 3ZEFA 3QNJA 1U00A 3T46A 4EZWA 2BPRA 2YIVX 3ER9B 3N8EA 2ND0A 2X5CA 3ER8C 4EZYA 2EX3B 3DPQA 4EZNA 2YI8A 4JWIA 3A98A 3LMFA 3KAWA 1SUFA 4UDYX 4NPHA 3GI7A 4MQDA 4F00A 3VEBA 3RV1A 3DPOA 4HR1B 3T48A 3L3OM 4ILGA 1JQKA 4H6HA 5E84A 4EZRA 3I04A 3VEAA 3O3NB 4ILIA 4IWQA 4IM3A 4HYBA 4PO2A 4JWDA 3C7NB 1OA0A 1DKXA 4EZQA 3B53X 4H6IA 4JWEA 1SU6A 5FIGA 1YUWA 3DPPA 5FLEX 2OP6A 4R5GA 1BPRA 3O3MB 4KIKB 4D8JA 1OA1A 3RV0A 3T47A 4E3CA 4HY9A 2OBMA 3OHXM 4JWCA 4E81A 2WINM 1E2UA 4EZTA 1ZYLA 3B52X 1OAOA 3C7NA 2YI9A 3DOBA 4UDXX 5TKYA 4IM2A 2YIBA 2ND1A 4JNEA 4IWPA 3T4AG 4IW0A 2LM0A 4JL9A 4R5LA 4EZPA 2PY6A 4EZVA 2GA9D 3KAVA 4R5IA 3B51X 4FL9A 1DG4A 3QA8A 2GAFD 2N3KA 3F7WA 2RT6A 4JLCA 2V7YA 4KIKA 2QXLA 4EZUA 1Q5LA 1SU8A 1UPXA 4EZXA 1CKRA 3UITA 2QFFA 3H0XA 2NCZA 3KDRA 4WV5A 1DKZA 3O3OB 3ZEDA 3I39X 4F01A 3ERCC 1W9MA 3FD9A 4ILHB 1E9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H6I A;  3T46 A;  4JN4 A;  1DKY A;  4EZW A;  2BPR A;  4R5K A;  4JWE A;  3DQG A;  7HSC A;  4EZP A;  4B9Q A;  3D2E A;  3N8E A;  4EZV A;  1YUW A;  4EZO A;  4R5J A;  4R5I A;  4FL9 A;  3DPP A;  3DPQ A;  3T49 A;  4EZN A;  4EZY A;  1DG4 A;  4JWI A;  4EZS A;  2OP6 A;  4R5G A;  1BPR A;  2V7Y A;  4JNF A;  3T47 A;  4F00 A;  3T48 A;  4HY9 A;  3DPO A;  2QXL A;  3L3O M;  3OHX M;  4EZU A;  3D2F A;  4H6H A;  4JWC A;  5E84 A;  2WIN M;  4E81 A;  4EZT A;  4EZX A;  4EZR A;  1Q5L A;  3C7N A;  3DOB A;  1CKR A;  4R5L A;  2QFF A;  5TKY A;  3H0X A;  4HYB A;  4WV5 A;  1DKZ A;  4JWD A;  4EZZ A;  2KHO A;  4PO2 A;  3C7N B;  4WV7 A;  1DKX A;  4JNE A;  4EZQ A;  3T4A G;  4F01 A;  3QNJ A;  1U00 A; 
#chains in the Genus database with same CATH topology
 1GNL A;  4JN4 A;  1DKY A;  2JNS A;  3BUI A;  4R5K A;  4WPE A;  1R33 A;  2Q12 A;  3HAH A;  3D2E A;  3OWG A;  2ALW A;  4FM3 A;  4B9Q A;  1MJG A;  4EZO A;  1R5E A;  2Z8Y A;  2FIC A;  3I01 A;  4R5J A;  3T49 A;  3SBS A;  1GN9 A;  4EZS A;  1E1D A;  1HXK A;  2YLA A;  2Z0N A;  2D1L A;  4HR1 A;  3EJS A;  2YL8 A;  3M3W A;  4JNF A;  2V0O A;  2YIA A;  3ACO A;  4AKV A;  4IM0 A;  1O7D B;  4M0M A;  2F18 A;  1GNT A;  1SU7 A;  4AVM A;  3D2F A;  1WDZ A;  2GF4 A;  2WYI A;  3PLT A;  3VKH A;  3BVW A;  4I43 A;  2X3V A;  3HAI A;  4IWO A;  2OBL A;  2EWF A;  3DYT A;  1HTY A;  1QWN A;  1Y2O A;  2KHO A;  3D50 A;  3LVT A;  1QX1 A;  4EZZ A;  4WV7 A;  4G6Q A;  3I2W A;  2F1A A;  3SBT B;  3ZEF A;  3DQG A;  3QNJ A;  3BUB A;  3G9G A;  2C08 A;  7HSC A;  3LLL A;  4NSW A;  1U00 A;  3DX0 A;  3EJU A;  3T46 A;  4ATM A;  4EZW A;  2BPR A;  1E9V A;  3BLB A;  3EJP A;  2YIV X;  2X3X A;  3ER9 B;  3N8E A;  3D51 A;  3BVV A;  4AZH A;  2ND0 A;  2OO2 A;  2OZN B;  2X5C A;  3ER8 C;  4EZY A;  2EX3 B;  3DPQ A;  4EZN A;  3CAZ A;  2YI8 A;  1I4D A;  3A98 A;  4JWI A;  3LMF A;  3KAW A;  2OW6 A;  4DCN C;  1SUF A;  4H8S A;  3CZN A;  3BUP A;  4UDY X;  4NPH A;  5C5B A;  3BUD A;  3GI7 A;  4MQD A;  4F00 A;  3VEB A;  2RAK A;  3DPO A;  3QWE A;  1TQS A;  3L3O M;  4HR1 B;  3RV1 A;  1TQU A;  2FYV A;  3T48 A;  4ILG A;  1JQK A;  4H6H A;  5E84 A;  1I4L A;  3DX4 A;  1X03 A;  2EFK A;  3I04 A;  3SYV A;  3O3N B;  2F1B A;  3D4Y A;  4IWQ A;  3VEA A;  4ILI A;  3EJT A;  4IM3 A;  2F7Q A;  3BVT A;  4HYB A;  4PO2 A;  4JWD A;  3C7N B;  4FZS A;  4AZI A;  1OA0 A;  1YWM A;  1DKX A;  3EJQ A;  4EZQ A;  3B53 X;  3SOG A;  2QKW A;  3DDG A;  4H6I A;  2D4C A;  2EFL A;  4I1Q A;  4JWE A;  4AZB A;  2YLL A;  1URU A;  3L3P A;  1SU6 A;  4DYL A;  3DDF A;  5FIG A;  1YUW A;  3H0X A;  3DPP A;  5FLE X;  2WYH A;  2Z0V A;  2O0I 1;  2OP6 A;  4R5G A;  1BPR A;  3CV5 A;  3O3M B;  4KIK B;  4WPC A;  4D8J A;  3D4Z A;  1OA1 A;  3RV0 A;  3T47 A;  4E3C A;  4HY9 A;  4FZP A;  2OBM A;  2PMR A;  2F7R A;  3FD9 A;  3OHX M;  4JWC A;  4E81 A;  2WIN M;  1E2U A;  4EZT A;  1ZYL A;  1LQ7 A;  1OAO A;  3B52 X;  2YI9 A;  3C7N A;  3DOB A;  4UDX X;  3QNI A;  1O7D C;  1I49 A;  1I4T A;  2YKT A;  2YIB A;  2RAJ A;  4IM2 A;  5TKY A;  1TQT A;  2LXY A;  3OK8 A;  2RAI A;  2ND1 A;  2Z0O A;  3BVU A;  4JNE A;  2MI7 A;  4IWP A;  3T4A G;  1TQW A;  4IW0 A;  2LM0 A;  4AZG A;  2YL6 A;  2JNK A;  3Q84 A;  4JL9 A;  4R5L A;  4NQI A;  3BUQ A;  3CZS A;  4AZC B;  4BNE A;  4EZP A;  1QWU A;  2PY6 A;  4EZV A;  3QE6 A;  2GA9 D;  3KAV A;  3Q0K A;  4R5I A;  3B51 X;  4AZC A;  4FL9 A;  1X04 A;  3D52 A;  4FZO A;  1PS3 A;  1DG4 A;  2Q13 A;  3DX2 A;  4AZ7 A;  2F7P A;  3CVR A;  3QA8 A;  2GAF D;  2N3K A;  2F7O A;  3F7W A;  3DX3 A;  5KBP A;  3HAJ A;  2RT6 A;  4JLC A;  2V7Y A;  3BVX A;  1R34 A;  2X3W A;  4KIK A;  2QXL A;  5C5B B;  4EZU A;  1Q5L A;  1SU8 A;  1UPX A;  4EZR A;  4EZX A;  2OW7 A;  1CKR A;  3UIT A;  4AZ5 A;  2QFF A;  2YL9 A;  2NCZ A;  2ZXQ A;  3DX1 A;  1DKZ A;  3KDR A;  3O3O B;  3RPM A;  4AZ6 A;  3ABH A;  4WV5 A;  3CKD A;  3EJR A;  2YL5 A;  1ZWW A;  3ZED A;  3I39 X;  4F01 A;  1HWW A;  3ERC C;  1W9M A;  2ELB A;  4ILH B;  1TQV A; 
#chains in the Genus database with same CATH homology
 1GNL A;  4JN4 A;  1DKY A;  2JNS A;  4R5K A;  3DQG A;  7HSC A;  4FM3 A;  4B9Q A;  3D2E A;  3OWG A;  1MJG A;  4EZO A;  2Z8Y A;  3I01 A;  4R5J A;  3T49 A;  3SBS A;  1GN9 A;  4EZS A;  1E1D A;  4HR1 A;  4JNF A;  2YIA A;  4IM0 A;  4M0M A;  1GNT A;  1SU7 A;  3D2F A;  3VKH A;  4I43 A;  4IWO A;  2OBL A;  2EWF A;  4EZZ A;  2KHO A;  4WV7 A;  3SBT B;  4G6Q A;  3ZEF A;  3QNJ A;  1U00 A;  3T46 A;  4EZW A;  2BPR A;  2YIV X;  3ER9 B;  3N8E A;  2ND0 A;  2X5C A;  3ER8 C;  4EZY A;  2EX3 B;  3DPQ A;  4EZN A;  2YI8 A;  4JWI A;  3A98 A;  3LMF A;  3KAW A;  1SUF A;  4UDY X;  4NPH A;  3GI7 A;  4MQD A;  4F00 A;  3VEB A;  3RV1 A;  3DPO A;  4HR1 B;  3T48 A;  3L3O M;  4ILG A;  1JQK A;  4H6H A;  5E84 A;  4EZR A;  3I04 A;  3VEA A;  3O3N B;  4ILI A;  4IWQ A;  4IM3 A;  4HYB A;  4PO2 A;  4JWD A;  3C7N B;  1OA0 A;  1DKX A;  4EZQ A;  3B53 X;  4H6I A;  4JWE A;  1SU6 A;  5FIG A;  1YUW A;  3DPP A;  5FLE X;  2OP6 A;  4R5G A;  1BPR A;  3O3M B;  4KIK B;  4D8J A;  1OA1 A;  3RV0 A;  3T47 A;  4E3C A;  4HY9 A;  2OBM A;  3OHX M;  4JWC A;  4E81 A;  2WIN M;  1E2U A;  4EZT A;  1ZYL A;  3B52 X;  1OAO A;  3C7N A;  2YI9 A;  3DOB A;  4UDX X;  5TKY A;  4IM2 A;  2YIB A;  2ND1 A;  4JNE A;  4IWP A;  3T4A G;  4IW0 A;  2LM0 A;  4JL9 A;  4R5L A;  4EZP A;  2PY6 A;  4EZV A;  2GA9 D;  3KAV A;  4R5I A;  3B51 X;  4FL9 A;  1DG4 A;  3QA8 A;  2GAF D;  2N3K A;  3F7W A;  2RT6 A;  4JLC A;  2V7Y A;  4KIK A;  2QXL A;  4EZU A;  1Q5L A;  1SU8 A;  1UPX A;  4EZX A;  1CKR A;  3UIT A;  2QFF A;  3H0X A;  2NCZ A;  3KDR A;  4WV5 A;  1DKZ A;  3O3O B;  3ZED A;  3I39 X;  4F01 A;  3ERC C;  1W9M A;  3FD9 A;  4ILH B;  1E9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...