4EZOA

Crystal structure of the substrate binding domain of e.coli dnak in complex with pr-39 (residues 1 to 15)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
211
structure length
211
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
molecule keywords Chaperone protein DnaK
total genus 61
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezoA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezoA01
4B9QA 4R5GA 4R5JA 3D2FA 1BPRA 2OP6A 4HY9A 3N8EA 1DG4A 3DOBA 2KHOA 3OHXM 4R5KA 4EZPA 3DQGA 4EZYA 4HYBA 4JNEA 4WV7A 4JWDA 3C7NB 4EZQA 3T49A 4H6IA 2WINM 3QNJA 4EZRA 4FL9A 4WV5A 4R5LA 7HSCA 1DKYA 4JNFA 2QFFA 3T4AG 4EZOA 1CKRA 4EZWA 1U00A 2QXLA 3D2EA 1DKXA 3DPOA 5TKYA 4EZTA 4EZXA 4EZZA 3T47A 4E81A 1Q5LA 4F00A 1DKZA 2V7YA 4JN4A 3T46A 4PO2A 3DPPA 4R5IA 4EZSA 4F01A 3DPQA 4H6HA 2BPRA 4JWCA 3T48A 4EZUA 4EZVA 3C7NA 4EZNA 4JWIA 5E84A 3L3OM 1YUWA 3H0XA 4JWEA
chains in the Genus database with same CATH superfamily
2OP6A 3N8EA 3EJQA 3EJSA 3D4ZA 4R5KA 4EZPA 3ACOA 5C5BB 3DX3A 1SU7A 4JNEA 3DQGA 4AZIA 3ER9B 3C7NB 3B51X 1LQ7A 3BVXA 3A98A 1R33A 3QWEA 4IWQA 4D8JA 2JNKA 3OK8A 1R5EA 2X3WA 4FM3A 4I1QA 4JNFA 1HTYA 3QA8A 3KAVA 4KIKA 3HAIA 4UDYX 1GNLA 1U00A 1O7DB 2QXLA 3ABHA 3DPOA 3Q84A 4IWOA 3G9GA 4EZTA 2EWFA 4EZZA 1I49A 4IM0A 3I2WA 2X3VA 3T47A 4DCNC 3BUQA 3M3WA 4E3CA 2V7YA 4JN4A 2EX3B 4PO2A 3DPPA 2YIAA 3VKHA 2YL8A 4FZPA 3I39X 2YLAA 2YI9A 4JWCA 2OW7A 2YL6A 4JLCA 4EZVA 3C7NA 1YUWA 3EJTA 4JWIA 4MQDA 3ZEFA 2OBMA 2EFKA 1I4DA 1HXKA 4JWEA 1OA1A 4ILHB 2GF4A 4B9QA 1E9VA 4KIKB 1E1DA 3O3MB 2OBLA 3VEAA 2F7PA 1UPXA 2LXYA 3BVTA 3BUPA 4HYBA 5FLEX 4AZ6A 1MJGA 4JWDA 1TQUA 3LVTA 3DX1A 1OAOA 2YIVX 3DX2A 3HAJA 4AZHA 4EZRA 2JNSA 3SBSA 2QKWA 2ND0A 2QFFA 1CKRA 3KAWA 1E2UA 1ZWWA 3D2EA 2F7QA 2Z0OA 3CZNA 1GNTA 3PLTA 4AZGA 1Q5LA 1URUA 2F1AA 1DKZA 1SU8A 2NCZA 1ZYLA 2Z8YA 2LM0A 4IW0A 3RV1A 2FICA 3RV0A 1X03A 3D52A 3L3PA 4R5IA 3SBTB 4AZBA 2OW6A 2YI8A 3B52X 1TQWA 3DDFA 3HAHA 4AZCB 3EJRA 3DDGA 2BPRA 3D50A 1GN9A 1TQTA 2Q12A 3OWGA 5C5BA 3BUBA 3UITA 1I4LA 2MI7A 4R5GA 4R5JA 3D2FA 2N3KA 3VEBA 2YLLA 3DOBA 2KHOA 3SYVA 4NQIA 3ER8C 2F7RA 4WPCA 4ILIA 4AZ5A 1W9MA 2GA9D 2F1BA 4WV7A 3KDRA 1X04A 4EZQA 5KBPA 1QWUA 2ELBA 2RT6A 3CZSA 3BVVA 3QNIA 2WINM 2WYIA 5FIGA 3T49A 4FL9A 4R5LA 4DYLA 3LLLA 1DKYA 1JQKA 2F18A 4NSWA 3SOGA 4NPHA 3T4AG 3CV5A 1R34A 2Z0NA 3BVWA 1DKXA 1SU6A 5TKYA 2RAIA 1PS3A 4H8SA 3I04A 4F00A 1QWNA 2YKTA 3QE6A 3CKDA 3O3OB 3EJPA 3Q0KA 4IM3A 4EZSA 4JL9A 4H6HA 3CVRA 2OZNB 1HWWA 2RAKA 2ND1A 3DX0A 3ZEDA 3H0XA 2ALWA 5E84A 3L3OM 2RAJA 3CAZA 3O3NB 4BNEA 4I43A 1TQSA 4AVMA 4AZ7A 2X5CA 3D51A 3BVUA 2YL5A 1QX1A 4FZSA 3BUDA 4HY9A 1BPRA 1DG4A 1OA0A 1SUFA 3OHXM 3EJUA 3GI7A 3I01A 4HR1B 4EZYA 2YIBA 3F7WA 1I4TA 2Q13A 1O7DC 2GAFD 3RPMA 2D4CA 2F7OA 2V0OA 2ZXQA 2Z0VA 3QNJA 3D4YA 4H6IA 4WV5A 4HR1A 3FD9A 7HSCA 3BUIA 4EZOA 4AKVA 4EZWA 2PY6A 3BLBA 4EZXA 4IWPA 4ATMA 2O0I1 3ERCC 2C08A 4E81A 2PMRA 4AZCA 4G6QA 2YL9A 2EFLA 3DYTA 3B53X 4FZOA 4IM2A 2OO2A 3DX4A 3T46A 1YWMA 4F01A 3DPQA 4ILGA 4WPEA 3LMFA 1WDZA 3T48A 4EZUA 4EZNA 2WYHA 2FYVA 1TQVA 4M0MA 2D1LA 2X3XA 1Y2OA 4UDXX
chains in the Genus database with same CATH topology
2OP6A 3N8EA 4R5KA 4EZPA 3DQGA 1SU7A 4JNEA 3ER9B 3C7NB 3B51X 3A98A 4IWQA 4D8JA 4FM3A 4UDYX 4JNFA 4KIKA 3QA8A 3KAVA 3ZEDA 3VKHA 1GNLA 1U00A 2QXLA 4IWOA 3DPOA 4EZTA 2EWFA 4EZZA 3T47A 4IM0A 4E3CA 2V7YA 4JN4A 2EX3B 4PO2A 3DPPA 2YIAA 3I39X 2YI9A 4JWCA 4JLCA 4EZVA 3C7NA 1YUWA 4JWIA 4MQDA 3ZEFA 2OBMA 4JWEA 1OA1A 4ILHB 4B9QA 1E9VA 4KIKB 1E1DA 3O3MB 2OBLA 3VEAA 1UPXA 5FLEX 4HYBA 1MJGA 4JWDA 1OAOA 2YIVX 4EZRA 2JNSA 3SBSA 2ND0A 2QFFA 1CKRA 3KAWA 1E2UA 3D2EA 1GNTA 1Q5LA 1DKZA 1SU8A 2NCZA 1ZYLA 2Z8YA 2LM0A 4IW0A 3RV1A 3RV0A 3SBTB 4R5IA 2YI8A 3B52X 2BPRA 1GN9A 3OWGA 3UITA 4R5GA 4R5JA 3D2FA 2N3KA 3VEBA 3DOBA 2KHOA 3ER8C 4ILIA 1W9MA 2GA9D 4WV7A 3KDRA 4EZQA 2RT6A 5FIGA 3T49A 4FL9A 2WINM 4R5LA 1DKYA 1JQKA 3T4AG 4NPHA 1SU6A 1DKXA 5TKYA 3I04A 4F00A 3O3OB 4IM3A 4EZSA 4JL9A 4H6HA 2ND1A 3H0XA 5E84A 3L3OM 3O3NB 4I43A 2X5CA 1BPRA 1DG4A 4HY9A 1OA0A 1SUFA 3OHXM 3GI7A 3I01A 4HR1B 4EZYA 2YIBA 3F7WA 2GAFD 4H6IA 3QNJA 4WV5A 4HR1A 3FD9A 7HSCA 4EZOA 4EZWA 2PY6A 4EZXA 4IWPA 3ERCC 4E81A 4G6QA 3B53X 4IM2A 3T46A 4F01A 3DPQA 4ILGA 3LMFA 3T48A 4EZUA 4EZNA 4M0MA 4UDXX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9Q A;  4R5G A;  4R5J A;  3D2F A;  1BPR A;  2OP6 A;  4HY9 A;  3N8E A;  1DG4 A;  3DOB A;  2KHO A;  3OHX M;  4R5K A;  4EZP A;  3DQG A;  4EZY A;  4HYB A;  4JNE A;  4WV7 A;  4JWD A;  3C7N B;  4EZQ A;  3T49 A;  4H6I A;  2WIN M;  3QNJ A;  4EZR A;  4FL9 A;  4WV5 A;  4R5L A;  7HSC A;  1DKY A;  4JNF A;  2QFF A;  3T4A G;  4EZO A;  1CKR A;  4EZW A;  1U00 A;  2QXL A;  3D2E A;  1DKX A;  3DPO A;  5TKY A;  4EZT A;  4EZX A;  4EZZ A;  3T47 A;  4E81 A;  1Q5L A;  4F00 A;  1DKZ A;  2V7Y A;  4JN4 A;  3T46 A;  4PO2 A;  3DPP A;  4R5I A;  4EZS A;  4F01 A;  3DPQ A;  4H6H A;  2BPR A;  4JWC A;  3T48 A;  4EZU A;  4EZV A;  3C7N A;  4EZN A;  4JWI A;  5E84 A;  3L3O M;  1YUW A;  3H0X A;  4JWE A; 
#chains in the Genus database with same CATH topology
 2OP6 A;  3N8E A;  3EJQ A;  3EJS A;  3D4Z A;  4R5K A;  4EZP A;  3ACO A;  5C5B B;  3DX3 A;  1SU7 A;  4JNE A;  3DQG A;  4AZI A;  3ER9 B;  3C7N B;  3B51 X;  1LQ7 A;  3BVX A;  3A98 A;  1R33 A;  3QWE A;  4IWQ A;  4D8J A;  2JNK A;  3OK8 A;  1R5E A;  2X3W A;  4FM3 A;  4I1Q A;  4JNF A;  1HTY A;  3QA8 A;  3KAV A;  4KIK A;  3HAI A;  4UDY X;  1GNL A;  1U00 A;  1O7D B;  2QXL A;  3ABH A;  3DPO A;  3Q84 A;  4IWO A;  3G9G A;  4EZT A;  2EWF A;  4EZZ A;  1I49 A;  4IM0 A;  3I2W A;  2X3V A;  3T47 A;  4DCN C;  3BUQ A;  3M3W A;  4E3C A;  2V7Y A;  4JN4 A;  2EX3 B;  4PO2 A;  3DPP A;  2YIA A;  3VKH A;  2YL8 A;  4FZP A;  3I39 X;  2YLA A;  2YI9 A;  4JWC A;  2OW7 A;  2YL6 A;  4JLC A;  4EZV A;  3C7N A;  1YUW A;  3EJT A;  4JWI A;  4MQD A;  3ZEF A;  2OBM A;  2EFK A;  1I4D A;  1HXK A;  4JWE A;  1OA1 A;  4ILH B;  2GF4 A;  4B9Q A;  1E9V A;  4KIK B;  1E1D A;  3O3M B;  2OBL A;  3VEA A;  2F7P A;  1UPX A;  2LXY A;  3BVT A;  3BUP A;  4HYB A;  5FLE X;  4AZ6 A;  1MJG A;  4JWD A;  1TQU A;  3LVT A;  3DX1 A;  1OAO A;  2YIV X;  3DX2 A;  3HAJ A;  4AZH A;  4EZR A;  2JNS A;  3SBS A;  2QKW A;  2ND0 A;  2QFF A;  1CKR A;  3KAW A;  1E2U A;  1ZWW A;  3D2E A;  2F7Q A;  2Z0O A;  3CZN A;  1GNT A;  3PLT A;  4AZG A;  1Q5L A;  1URU A;  2F1A A;  1DKZ A;  1SU8 A;  2NCZ A;  1ZYL A;  2Z8Y A;  2LM0 A;  4IW0 A;  3RV1 A;  2FIC A;  3RV0 A;  1X03 A;  3D52 A;  3L3P A;  4R5I A;  3SBT B;  4AZB A;  2OW6 A;  2YI8 A;  3B52 X;  1TQW A;  3DDF A;  3HAH A;  4AZC B;  3EJR A;  3DDG A;  2BPR A;  3D50 A;  1GN9 A;  1TQT A;  2Q12 A;  3OWG A;  5C5B A;  3BUB A;  3UIT A;  1I4L A;  2MI7 A;  4R5G A;  4R5J A;  3D2F A;  2N3K A;  3VEB A;  2YLL A;  3DOB A;  2KHO A;  3SYV A;  4NQI A;  3ER8 C;  2F7R A;  4WPC A;  4ILI A;  4AZ5 A;  1W9M A;  2GA9 D;  2F1B A;  4WV7 A;  3KDR A;  1X04 A;  4EZQ A;  5KBP A;  1QWU A;  2ELB A;  2RT6 A;  3CZS A;  3BVV A;  3QNI A;  2WIN M;  2WYI A;  5FIG A;  3T49 A;  4FL9 A;  4R5L A;  4DYL A;  3LLL A;  1DKY A;  1JQK A;  2F18 A;  4NSW A;  3SOG A;  4NPH A;  3T4A G;  3CV5 A;  1R34 A;  2Z0N A;  3BVW A;  1DKX A;  1SU6 A;  5TKY A;  2RAI A;  1PS3 A;  4H8S A;  3I04 A;  4F00 A;  1QWN A;  2YKT A;  3QE6 A;  3CKD A;  3O3O B;  3EJP A;  3Q0K A;  4IM3 A;  4EZS A;  4JL9 A;  4H6H A;  3CVR A;  2OZN B;  1HWW A;  2RAK A;  2ND1 A;  3DX0 A;  3ZED A;  3H0X A;  2ALW A;  5E84 A;  3L3O M;  2RAJ A;  3CAZ A;  3O3N B;  4BNE A;  4I43 A;  1TQS A;  4AVM A;  4AZ7 A;  2X5C A;  3D51 A;  3BVU A;  2YL5 A;  1QX1 A;  4FZS A;  3BUD A;  4HY9 A;  1BPR A;  1DG4 A;  1OA0 A;  1SUF A;  3OHX M;  3EJU A;  3GI7 A;  3I01 A;  4HR1 B;  4EZY A;  2YIB A;  3F7W A;  1I4T A;  2Q13 A;  1O7D C;  2GAF D;  3RPM A;  2D4C A;  2F7O A;  2V0O A;  2ZXQ A;  2Z0V A;  3QNJ A;  3D4Y A;  4H6I A;  4WV5 A;  4HR1 A;  3FD9 A;  7HSC A;  3BUI A;  4EZO A;  4AKV A;  4EZW A;  2PY6 A;  3BLB A;  4EZX A;  4IWP A;  4ATM A;  2O0I 1;  3ERC C;  2C08 A;  4E81 A;  2PMR A;  4AZC A;  4G6Q A;  2YL9 A;  2EFL A;  3DYT A;  3B53 X;  4FZO A;  4IM2 A;  2OO2 A;  3DX4 A;  3T46 A;  1YWM A;  4F01 A;  3DPQ A;  4ILG A;  4WPE A;  3LMF A;  1WDZ A;  3T48 A;  4EZU A;  4EZN A;  2WYH A;  2FYV A;  1TQV A;  4M0M A;  2D1L A;  2X3X A;  1Y2O A;  4UDX X; 
#chains in the Genus database with same CATH homology
 2OP6 A;  3N8E A;  4R5K A;  4EZP A;  3DQG A;  1SU7 A;  4JNE A;  3ER9 B;  3C7N B;  3B51 X;  3A98 A;  4IWQ A;  4D8J A;  4FM3 A;  4UDY X;  4JNF A;  4KIK A;  3QA8 A;  3KAV A;  3ZED A;  3VKH A;  1GNL A;  1U00 A;  2QXL A;  4IWO A;  3DPO A;  4EZT A;  2EWF A;  4EZZ A;  3T47 A;  4IM0 A;  4E3C A;  2V7Y A;  4JN4 A;  2EX3 B;  4PO2 A;  3DPP A;  2YIA A;  3I39 X;  2YI9 A;  4JWC A;  4JLC A;  4EZV A;  3C7N A;  1YUW A;  4JWI A;  4MQD A;  3ZEF A;  2OBM A;  4JWE A;  1OA1 A;  4ILH B;  4B9Q A;  1E9V A;  4KIK B;  1E1D A;  3O3M B;  2OBL A;  3VEA A;  1UPX A;  5FLE X;  4HYB A;  1MJG A;  4JWD A;  1OAO A;  2YIV X;  4EZR A;  2JNS A;  3SBS A;  2ND0 A;  2QFF A;  1CKR A;  3KAW A;  1E2U A;  3D2E A;  1GNT A;  1Q5L A;  1DKZ A;  1SU8 A;  2NCZ A;  1ZYL A;  2Z8Y A;  2LM0 A;  4IW0 A;  3RV1 A;  3RV0 A;  3SBT B;  4R5I A;  2YI8 A;  3B52 X;  2BPR A;  1GN9 A;  3OWG A;  3UIT A;  4R5G A;  4R5J A;  3D2F A;  2N3K A;  3VEB A;  3DOB A;  2KHO A;  3ER8 C;  4ILI A;  1W9M A;  2GA9 D;  4WV7 A;  3KDR A;  4EZQ A;  2RT6 A;  5FIG A;  3T49 A;  4FL9 A;  2WIN M;  4R5L A;  1DKY A;  1JQK A;  3T4A G;  4NPH A;  1SU6 A;  1DKX A;  5TKY A;  3I04 A;  4F00 A;  3O3O B;  4IM3 A;  4EZS A;  4JL9 A;  4H6H A;  2ND1 A;  3H0X A;  5E84 A;  3L3O M;  3O3N B;  4I43 A;  2X5C A;  1BPR A;  1DG4 A;  4HY9 A;  1OA0 A;  1SUF A;  3OHX M;  3GI7 A;  3I01 A;  4HR1 B;  4EZY A;  2YIB A;  3F7W A;  2GAF D;  4H6I A;  3QNJ A;  4WV5 A;  4HR1 A;  3FD9 A;  7HSC A;  4EZO A;  4EZW A;  2PY6 A;  4EZX A;  4IWP A;  3ERC C;  4E81 A;  4G6Q A;  3B53 X;  4IM2 A;  3T46 A;  4F01 A;  3DPQ A;  4ILG A;  3LMF A;  3T48 A;  4EZU A;  4EZN A;  4M0M A;  4UDX X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...