4EZPA

Crystal structure of the substrate binding domain of e.coli dnak in complex with a3-apo(residues 1 to 20)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
molecule keywords Chaperone protein DnaK
total genus 59
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezpA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezpA01
4H6HA 4EZZA 4EZRA 1Q5LA 2BPRA 4EZVA 3DOBA 7HSCA 3DQGA 3D2EA 2QFFA 4EZWA 3T49A 4JWIA 3D2FA 2QXLA 4JNEA 5TKYA 2V7YA 3H0XA 4WV7A 2KHOA 4JWEA 4H6IA 1DKXA 4HYBA 3QNJA 4FL9A 3DPOA 4JN4A 4WV5A 2OP6A 4JNFA 3N8EA 4EZUA 4EZPA 1U00A 4R5LA 4EZSA 1CKRA 2WINM 3T48A 3C7NA 4PO2A 3L3OM 4EZXA 4B9QA 4E81A 3T46A 3C7NB 4JWDA 1YUWA 4EZTA 1DKZA 4F00A 3DPQA 1DG4A 4R5KA 1BPRA 3T47A 1DKYA 3DPPA 4JWCA 4R5GA 5E84A 4EZNA 3OHXM 4R5IA 3T4AG 4EZYA 4EZQA 4EZOA 4F01A 4R5JA 4HY9A
chains in the Genus database with same CATH superfamily
3BUDA 4EZZA 1R34A 2F7QA 1Q5LA 4EZVA 3O3MB 3F7WA 3DOBA 4EZYA 3DQGA 2JNSA 3EJRA 4EZWA 3EJUA 2Q13A 3DX3A 2YIAA 4KIKB 4UDYX 3UITA 3H0XA 3SBSA 2KHOA 3ACOA 2F1BA 2LM0A 3BLBA 2F7RA 4JNFA 1I4TA 2LXYA 4EZUA 4E3CA 4HR1A 4EZPA 1URUA 2X5CA 3PLTA 3KAVA 3I2WA 3QA8A 2EFLA 2WINM 3RPMA 3T48A 2Z0VA 4ILIA 3C7NA 1R33A 1X04A 3SYVA 2Z0NA 2EX3B 4HY9A 2ELBA 4E81A 2GAFD 2ALWA 4EZTA 3D50A 4M0MA 4KIKA 2X3VA 1I4DA 2F7OA 1GN9A 4NPHA 3CVRA 3OK8A 3ER9B 3D4YA 1O7DB 1PS3A 1OAOA 1Y2OA 2EWFA 2PMRA 3B51X 3OWGA 4R5IA 4AZ7A 4EZOA 1WDZA 2D4CA 3CZSA 2EFKA 1TQTA 2ND1A 2X3WA 3D52A 4H6HA 4WPEA 2D1LA 4F01A 1LQ7A 1SU7A 3VEBA 1ZYLA 3CAZA 3HAIA 2ND0A 2YKTA 7HSCA 2QFFA 2YI8A 4AKVA 4AZGA 2RT6A 1JQKA 2V7YA 3N8EA 3CZNA 4I43A 1R5EA 4H6IA 4FL9A 2YL8A 4AZIA 2OO2A 4ILGA 3EJTA 3DX4A 1U00A 1TQWA 4AZ6A 3KAWA 2FYVA 1CKRA 2O0I1 2YL6A 3DX1A 3CKDA 3BVTA 2F7PA 3L3OM 4FZSA 2OBMA 2RAKA 3CV5A 4I1QA 4B9QA 3T46A 1YUWA 5FLEX 1O7DC 3DPQA 2OW7A 4MQDA 1DKYA 3QNIA 4JWCA 4IWQA 3OHXM 4HR1B 1SUFA 1UPXA 3BUIA 4AZ5A 4BNEA 4FM3A 1OA0A 4NQIA 3RV0A 2Q12A 3VEAA 4R5JA 4DYLA 2FICA 3Q0KA 3O3NB 2Z0OA 3EJQA 3KDRA 1QWUA 3RV1A 3D4ZA 3D2EA 2GF4A 5KBPA 3DDGA 3BVWA 4JWIA 2QXLA 2OZNB 5FIGA 3T49A 3FD9A 4IWOA 2YIVX 4WV7A 3LLLA 1DKXA 3QNJA 5C5BA 3ER8C 3LVTA 4AZBA 4R5LA 3BVUA 1GNLA 4IM2A 1I4LA 2GA9D 2WYIA 3ERCC 3EJSA 4ILHB 1W9MA 2YI9A 2WYHA 4EZXA 3GI7A 1E9VA 3O3OB 2OBLA 3L3PA 3LMFA 3QE6A 3QWEA 2C08A 4AZCB 3C7NB 2F18A 3SBTB 4UDXX 4AZCA 4F00A 1I49A 1DG4A 4AZHA 1BPRA 3T47A 4R5GA 1X03A 5E84A 3ZEDA 4H8SA 3DDFA 2PY6A 2QKWA 3ZEFA 2X3XA 3BUPA 1TQVA 1GNTA 2YLLA 2YL9A 1HXKA 2V0OA 4EZRA 1TQSA 1MJGA 2OW6A 2Z8YA 3BUQA 3G9GA 2BPRA 4IWPA 4JL9A 2RAJA 2YIBA 3ABHA 3BVVA 3D2FA 3DYTA 4JNEA 3I39X 5TKYA 3I01A 4JWEA 4IW0A 4HYBA 5C5BB 3VKHA 3DPOA 4JN4A 1OA1A 1SU6A 3HAHA 3SOGA 3BVXA 2OP6A 3D51A 4WV5A 2F1AA 1SU8A 4ATMA 2YL5A 4DCNC 4AVMA 4EZSA 1HWWA 3A98A 4PO2A 4IM0A 3Q84A 3B53X 3I04A 3EJPA 1ZWWA 2JNKA 4FZOA 4JWDA 2N3KA 4FZPA 4WPCA 2MI7A 1DKZA 1QX1A 3BUBA 3DX2A 4D8JA 4R5KA 4G6QA 4NSWA 3B52X 3DPPA 4EZNA 4IM3A 4JLCA 3DX0A 1TQUA 3M3WA 2YLAA 3T4AG 1HTYA 1E2UA 1E1DA 4EZQA 3HAJA 1YWMA 2NCZA 2ZXQA 1QWNA 2RAIA
chains in the Genus database with same CATH topology
4EZZA 1Q5LA 3DOBA 4EZVA 3O3MB 3F7WA 3DQGA 2JNSA 4EZWA 3SBSA 2YIAA 4KIKB 4UDYX 3UITA 3H0XA 2KHOA 2LM0A 4JNFA 3N8EA 4EZUA 4EZPA 4E3CA 4HR1A 2X5CA 3KAVA 4ILIA 3QA8A 2WINM 3T48A 3C7NA 2EX3B 4E81A 2GAFD 4EZTA 4M0MA 4KIKA 1GN9A 4NPHA 3ER9B 3B51X 2EWFA 1OAOA 3OWGA 4R5IA 4EZOA 2ND1A 4H6HA 4F01A 1SU7A 1ZYLA 7HSCA 2ND0A 2QFFA 2YI8A 2RT6A 1JQKA 2V7YA 4I43A 4H6IA 4FL9A 4ILGA 1U00A 3KAWA 1CKRA 3L3OM 2OBMA 4B9QA 3T46A 1YUWA 5FLEX 3DPQA 4MQDA 1DKYA 4JWCA 4IWQA 3OHXM 4HR1B 1SUFA 1UPXA 4FM3A 1OA0A 3RV0A 3VEAA 4R5JA 3O3NB 3KDRA 3RV1A 3D2EA 3T49A 4JWIA 5FIGA 2QXLA 3FD9A 4IWOA 2YIVX 4WV7A 1DKXA 3QNJA 3ER8C 4R5LA 1GNLA 4IM2A 2GA9D 3ERCC 4ILHB 1W9MA 2YI9A 4EZXA 3GI7A 1E9VA 3O3OB 2OBLA 3LMFA 3C7NB 3SBTB 4UDXX 4F00A 1DG4A 1BPRA 3T47A 4R5GA 5E84A 3ZEDA 3ZEFA 2PY6A 1GNTA 2BPRA 4EZRA 1MJGA 2Z8YA 4IWPA 4JL9A 3D2FA 2YIBA 4JNEA 5TKYA 3I39X 3I01A 4JWEA 4IW0A 4HYBA 3VKHA 3DPOA 4JN4A 1OA1A 1SU6A 4WV5A 2OP6A 1SU8A 4EZSA 3A98A 4PO2A 4IM0A 3B53X 3I04A 4JWDA 2N3KA 1DKZA 4D8JA 4R5KA 4G6QA 3B52X 3DPPA 4EZNA 4IM3A 4JLCA 3T4AG 4EZYA 4EZQA 1E2UA 1E1DA 3VEBA 2NCZA 4HY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H6H A;  4EZZ A;  4EZR A;  1Q5L A;  2BPR A;  4EZV A;  3DOB A;  7HSC A;  3DQG A;  3D2E A;  2QFF A;  4EZW A;  3T49 A;  4JWI A;  3D2F A;  2QXL A;  4JNE A;  5TKY A;  2V7Y A;  3H0X A;  4WV7 A;  2KHO A;  4JWE A;  4H6I A;  1DKX A;  4HYB A;  3QNJ A;  4FL9 A;  3DPO A;  4JN4 A;  4WV5 A;  2OP6 A;  4JNF A;  3N8E A;  4EZU A;  4EZP A;  1U00 A;  4R5L A;  4EZS A;  1CKR A;  2WIN M;  3T48 A;  3C7N A;  4PO2 A;  3L3O M;  4EZX A;  4B9Q A;  4E81 A;  3T46 A;  3C7N B;  4JWD A;  1YUW A;  4EZT A;  1DKZ A;  4F00 A;  3DPQ A;  1DG4 A;  4R5K A;  1BPR A;  3T47 A;  1DKY A;  3DPP A;  4JWC A;  4R5G A;  5E84 A;  4EZN A;  3OHX M;  4R5I A;  3T4A G;  4EZY A;  4EZQ A;  4EZO A;  4F01 A;  4R5J A;  4HY9 A; 
#chains in the Genus database with same CATH topology
 3BUD A;  4EZZ A;  1R34 A;  2F7Q A;  1Q5L A;  4EZV A;  3O3M B;  3F7W A;  3DOB A;  4EZY A;  3DQG A;  2JNS A;  3EJR A;  4EZW A;  3EJU A;  2Q13 A;  3DX3 A;  2YIA A;  4KIK B;  4UDY X;  3UIT A;  3H0X A;  3SBS A;  2KHO A;  3ACO A;  2F1B A;  2LM0 A;  3BLB A;  2F7R A;  4JNF A;  1I4T A;  2LXY A;  4EZU A;  4E3C A;  4HR1 A;  4EZP A;  1URU A;  2X5C A;  3PLT A;  3KAV A;  3I2W A;  3QA8 A;  2EFL A;  2WIN M;  3RPM A;  3T48 A;  2Z0V A;  4ILI A;  3C7N A;  1R33 A;  1X04 A;  3SYV A;  2Z0N A;  2EX3 B;  4HY9 A;  2ELB A;  4E81 A;  2GAF D;  2ALW A;  4EZT A;  3D50 A;  4M0M A;  4KIK A;  2X3V A;  1I4D A;  2F7O A;  1GN9 A;  4NPH A;  3CVR A;  3OK8 A;  3ER9 B;  3D4Y A;  1O7D B;  1PS3 A;  1OAO A;  1Y2O A;  2EWF A;  2PMR A;  3B51 X;  3OWG A;  4R5I A;  4AZ7 A;  4EZO A;  1WDZ A;  2D4C A;  3CZS A;  2EFK A;  1TQT A;  2ND1 A;  2X3W A;  3D52 A;  4H6H A;  4WPE A;  2D1L A;  4F01 A;  1LQ7 A;  1SU7 A;  3VEB A;  1ZYL A;  3CAZ A;  3HAI A;  2ND0 A;  2YKT A;  7HSC A;  2QFF A;  2YI8 A;  4AKV A;  4AZG A;  2RT6 A;  1JQK A;  2V7Y A;  3N8E A;  3CZN A;  4I43 A;  1R5E A;  4H6I A;  4FL9 A;  2YL8 A;  4AZI A;  2OO2 A;  4ILG A;  3EJT A;  3DX4 A;  1U00 A;  1TQW A;  4AZ6 A;  3KAW A;  2FYV A;  1CKR A;  2O0I 1;  2YL6 A;  3DX1 A;  3CKD A;  3BVT A;  2F7P A;  3L3O M;  4FZS A;  2OBM A;  2RAK A;  3CV5 A;  4I1Q A;  4B9Q A;  3T46 A;  1YUW A;  5FLE X;  1O7D C;  3DPQ A;  2OW7 A;  4MQD A;  1DKY A;  3QNI A;  4JWC A;  4IWQ A;  3OHX M;  4HR1 B;  1SUF A;  1UPX A;  3BUI A;  4AZ5 A;  4BNE A;  4FM3 A;  1OA0 A;  4NQI A;  3RV0 A;  2Q12 A;  3VEA A;  4R5J A;  4DYL A;  2FIC A;  3Q0K A;  3O3N B;  2Z0O A;  3EJQ A;  3KDR A;  1QWU A;  3RV1 A;  3D4Z A;  3D2E A;  2GF4 A;  5KBP A;  3DDG A;  3BVW A;  4JWI A;  2QXL A;  2OZN B;  5FIG A;  3T49 A;  3FD9 A;  4IWO A;  2YIV X;  4WV7 A;  3LLL A;  1DKX A;  3QNJ A;  5C5B A;  3ER8 C;  3LVT A;  4AZB A;  4R5L A;  3BVU A;  1GNL A;  4IM2 A;  1I4L A;  2GA9 D;  2WYI A;  3ERC C;  3EJS A;  4ILH B;  1W9M A;  2YI9 A;  2WYH A;  4EZX A;  3GI7 A;  1E9V A;  3O3O B;  2OBL A;  3L3P A;  3LMF A;  3QE6 A;  3QWE A;  2C08 A;  4AZC B;  3C7N B;  2F18 A;  3SBT B;  4UDX X;  4AZC A;  4F00 A;  1I49 A;  1DG4 A;  4AZH A;  1BPR A;  3T47 A;  4R5G A;  1X03 A;  5E84 A;  3ZED A;  4H8S A;  3DDF A;  2PY6 A;  2QKW A;  3ZEF A;  2X3X A;  3BUP A;  1TQV A;  1GNT A;  2YLL A;  2YL9 A;  1HXK A;  2V0O A;  4EZR A;  1TQS A;  1MJG A;  2OW6 A;  2Z8Y A;  3BUQ A;  3G9G A;  2BPR A;  4IWP A;  4JL9 A;  2RAJ A;  2YIB A;  3ABH A;  3BVV A;  3D2F A;  3DYT A;  4JNE A;  3I39 X;  5TKY A;  3I01 A;  4JWE A;  4IW0 A;  4HYB A;  5C5B B;  3VKH A;  3DPO A;  4JN4 A;  1OA1 A;  1SU6 A;  3HAH A;  3SOG A;  3BVX A;  2OP6 A;  3D51 A;  4WV5 A;  2F1A A;  1SU8 A;  4ATM A;  2YL5 A;  4DCN C;  4AVM A;  4EZS A;  1HWW A;  3A98 A;  4PO2 A;  4IM0 A;  3Q84 A;  3B53 X;  3I04 A;  3EJP A;  1ZWW A;  2JNK A;  4FZO A;  4JWD A;  2N3K A;  4FZP A;  4WPC A;  2MI7 A;  1DKZ A;  1QX1 A;  3BUB A;  3DX2 A;  4D8J A;  4R5K A;  4G6Q A;  4NSW A;  3B52 X;  3DPP A;  4EZN A;  4IM3 A;  4JLC A;  3DX0 A;  1TQU A;  3M3W A;  2YLA A;  3T4A G;  1HTY A;  1E2U A;  1E1D A;  4EZQ A;  3HAJ A;  1YWM A;  2NCZ A;  2ZXQ A;  1QWN A;  2RAI A; 
#chains in the Genus database with same CATH homology
 4EZZ A;  1Q5L A;  3DOB A;  4EZV A;  3O3M B;  3F7W A;  3DQG A;  2JNS A;  4EZW A;  3SBS A;  2YIA A;  4KIK B;  4UDY X;  3UIT A;  3H0X A;  2KHO A;  2LM0 A;  4JNF A;  3N8E A;  4EZU A;  4EZP A;  4E3C A;  4HR1 A;  2X5C A;  3KAV A;  4ILI A;  3QA8 A;  2WIN M;  3T48 A;  3C7N A;  2EX3 B;  4E81 A;  2GAF D;  4EZT A;  4M0M A;  4KIK A;  1GN9 A;  4NPH A;  3ER9 B;  3B51 X;  2EWF A;  1OAO A;  3OWG A;  4R5I A;  4EZO A;  2ND1 A;  4H6H A;  4F01 A;  1SU7 A;  1ZYL A;  7HSC A;  2ND0 A;  2QFF A;  2YI8 A;  2RT6 A;  1JQK A;  2V7Y A;  4I43 A;  4H6I A;  4FL9 A;  4ILG A;  1U00 A;  3KAW A;  1CKR A;  3L3O M;  2OBM A;  4B9Q A;  3T46 A;  1YUW A;  5FLE X;  3DPQ A;  4MQD A;  1DKY A;  4JWC A;  4IWQ A;  3OHX M;  4HR1 B;  1SUF A;  1UPX A;  4FM3 A;  1OA0 A;  3RV0 A;  3VEA A;  4R5J A;  3O3N B;  3KDR A;  3RV1 A;  3D2E A;  3T49 A;  4JWI A;  5FIG A;  2QXL A;  3FD9 A;  4IWO A;  2YIV X;  4WV7 A;  1DKX A;  3QNJ A;  3ER8 C;  4R5L A;  1GNL A;  4IM2 A;  2GA9 D;  3ERC C;  4ILH B;  1W9M A;  2YI9 A;  4EZX A;  3GI7 A;  1E9V A;  3O3O B;  2OBL A;  3LMF A;  3C7N B;  3SBT B;  4UDX X;  4F00 A;  1DG4 A;  1BPR A;  3T47 A;  4R5G A;  5E84 A;  3ZED A;  3ZEF A;  2PY6 A;  1GNT A;  2BPR A;  4EZR A;  1MJG A;  2Z8Y A;  4IWP A;  4JL9 A;  3D2F A;  2YIB A;  4JNE A;  5TKY A;  3I39 X;  3I01 A;  4JWE A;  4IW0 A;  4HYB A;  3VKH A;  3DPO A;  4JN4 A;  1OA1 A;  1SU6 A;  4WV5 A;  2OP6 A;  1SU8 A;  4EZS A;  3A98 A;  4PO2 A;  4IM0 A;  3B53 X;  3I04 A;  4JWD A;  2N3K A;  1DKZ A;  4D8J A;  4R5K A;  4G6Q A;  3B52 X;  3DPP A;  4EZN A;  4IM3 A;  4JLC A;  3T4A G;  4EZY A;  4EZQ A;  1E2U A;  1E1D A;  3VEB A;  2NCZ A;  4HY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...