4EZSA

Crystal structure of the substrate binding domain of e.coli dnak in complex with metchnikowin (residues 20 to 26)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
218
structure length
218
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural studies of DnaK in complex with proline rich antimicrobial peptides reveal two different peptide binding modes
rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
molecule keywords Chaperone protein DnaK
total genus 65
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezsA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezsA01
4PO2A 3QNJA 4WV7A 4JWDA 4EZWA 3T47A 3OHXM 4H6IA 4JNFA 5TKYA 2WINM 4EZSA 3C7NB 2OP6A 3DQGA 4E81A 3DPOA 4JWEA 4R5GA 4EZTA 1DKYA 4JWCA 4JN4A 4EZUA 4JWIA 3D2FA 4EZQA 1U00A 3D2EA 4R5KA 3L3OM 3T4AG 4B9QA 4F00A 1YUWA 1DG4A 3DPPA 1Q5LA 4EZNA 1BPRA 4EZRA 1CKRA 1DKXA 2QXLA 3DPQA 4JNEA 3T49A 4EZVA 3C7NA 5E84A 4EZYA 3DOBA 4WV5A 2KHOA 4R5JA 4H6HA 4F01A 2V7YA 4HY9A 4FL9A 4EZZA 4EZOA 2QFFA 4EZXA 4R5IA 3T46A 3H0XA 2BPRA 4EZPA 3N8EA 7HSCA 4R5LA 3T48A 4HYBA 1DKZA
chains in the Genus database with same CATH superfamily
4I43A 3DX3A 3EJRA 4EZWA 2WYIA 3C7NB 2F7OA 3LLLA 1W9MA 3D4ZA 2OP6A 2YL6A 2X3VA 4JL9A 4E81A 1HTYA 2ND0A 2OZNB 4HR1A 2OW6A 4R5GA 2RAKA 2YIAA 2X3WA 2F7RA 2Q13A 4JN4A 4WPEA 2PMRA 3L3OM 4F00A 2O0I1 4I1QA 3HAIA 2YIVX 4AZBA 2ELBA 3M3WA 1YWMA 2X5CA 3DX0A 2Z0VA 2QXLA 1UPXA 1WDZA 3Q84A 3T49A 3C7NA 4NQIA 3ER8C 2NCZA 1SU8A 1TQSA 3B53X 3CVRA 3CV5A 4HY9A 2EWFA 4WPCA 2QKWA 4KIKA 2YL5A 4AZCA 4FL9A 3BVWA 3DYTA 3O3NB 4R5IA 3T46A 4DYLA 5KBPA 2GAFD 3O3OB 3SBTB 4G6QA 4AZHA 3OK8A 1QX1A 3OWGA 4PO2A 2D1LA 2D4CA 3BUDA 1ZWWA 4ILGA 1TQTA 4ILHB 4JNFA 4H8SA 3EJTA 4NSWA 4EZSA 2YI9A 3DQGA 3ABHA 1E2UA 3DPOA 4EZTA 2JNSA 4KIKB 2YL9A 3D2FA 3EJUA 1I4DA 1U00A 2C08A 2F18A 3D2EA 3BUQA 3HAJA 4FZSA 4B9QA 1SUFA 2ND1A 2ALWA 4UDYX 2F1AA 2PY6A 3BLBA 4AZGA 4MQDA 1CKRA 1BPRA 3RV1A 3SYVA 2GF4A 2Z0NA 3DDGA 4IWOA 1SU7A 3RPMA 2FYVA 2Q12A 3KAVA 4ATMA 4EZYA 2JNKA 1I49A 2LXYA 2MI7A 2GA9D 2YI8A 4R5JA 4F01A 4WV7A 1GN9A 4BNEA 4ILIA 3SBSA 4EZOA 3B51X 2OO2A 3CAZA 4IM3A 4AZIA 2OBMA 1O7DC 4IM2A 4EZXA 3DX4A 2WYHA 4EZPA 3F7WA 1QWUA 3CZSA 3EJQA 1DKZA 4M0MA 3UITA 1OA0A 4AZ7A 2X3XA 1OAOA 3BVUA 3BUIA 3I39X 3QA8A 3QNIA 3EJSA 4NPHA 3CKDA 3D4YA 2Z8YA 3OHXM 4H6IA 5TKYA 2WINM 3T47A 4AKVA 3B52X 2F1BA 3G9GA 3VEAA 4IWQA 3HAHA 3FD9A 4JWEA 1MJGA 2LM0A 4JWCA 4EZUA 4EZQA 3GI7A 4JWIA 1TQUA 5FIGA 3I01A 4R5KA 4FZOA 3O3MB 3CZNA 2YIBA 3T4AG 1HXKA 3PLTA 3DPPA 1E1DA 1O7DB 3A98A 1TQWA 3BVTA 2EFKA 5FLEX 1DKXA 5C5BB 3RV0A 1Q5LA 1TQVA 4JNEA 2EFLA 3DPQA 3D52A 3DX2A 5E84A 4EZVA 1GNLA 1R34A 4AVMA 3ACOA 2Z0OA 1OA1A 2F7PA 3I04A 4H6HA 3SOGA 3KAWA 3BVVA 2YL8A 1ZYLA 3DX1A 3KDRA 2V7YA 4IM0A 2RT6A 2QFFA 3DDFA 4FM3A 4JLCA 4UDXX 3H0XA 2BPRA 4R5LA 2OBLA 4HYBA 2ZXQA 3T48A 4E3CA 5C5BA 3D50A 3QNJA 3ER9B 3QWEA 3BVXA 3I2WA 4JWDA 1X03A 1HWWA 2OW7A 2N3KA 2YKTA 3LMFA 1SU6A 4AZCB 4AZ6A 4AZ5A 1I4TA 2V0OA 3L3PA 1DKYA 3LVTA 1JQKA 4IWPA 1QWNA 2YLAA 4D8JA 1R5EA 1I4LA 1X04A 3D51A 1YUWA 1R33A 1DG4A 3EJPA 3ZEFA 3BUBA 2F7QA 4EZRA 3ERCC 1GNTA 1URUA 2YLLA 3DOBA 4WV5A 1E9VA 2KHOA 4FZPA 2EX3B 3Q0KA 4HR1B 1LQ7A 3ZEDA 4DCNC 4EZZA 2FICA 1Y2OA 2RAJA 3BUPA 3VEBA 3N8EA 1PS3A 3VKHA 3QE6A 7HSCA 2RAIA 4EZNA 4IW0A
chains in the Genus database with same CATH topology
4I43A 4EZWA 3C7NB 1W9MA 2OP6A 4JL9A 4E81A 4HR1A 2ND0A 4R5GA 2YIAA 4JN4A 3L3OM 4F00A 2YIVX 2X5CA 2QXLA 1UPXA 3ER8C 3C7NA 2NCZA 1SU8A 3B53X 4HY9A 2EWFA 4FL9A 4KIKA 3O3NB 4R5IA 3T46A 2GAFD 3O3OB 3SBTB 4G6QA 3OWGA 4PO2A 4ILGA 4ILHB 4JNFA 4EZSA 3DQGA 2YI9A 1E2UA 3DPOA 4EZTA 2JNSA 4KIKB 3D2FA 1U00A 3D2EA 4B9QA 1SUFA 2ND1A 4UDYX 2PY6A 4MQDA 1BPRA 3RV1A 4IWOA 1SU7A 4EZYA 3KAVA 2GA9D 2YI8A 4R5JA 4F01A 1GN9A 4ILIA 4EZOA 3B51X 4IM3A 4EZXA 2OBMA 4IM2A 4EZPA 3F7WA 1DKZA 4M0MA 3UITA 1OA0A 4WV7A 1OAOA 3SBSA 3QA8A 3I39X 4NPHA 3T47A 3OHXM 2Z8YA 4H6IA 5TKYA 2WINM 3B52X 3VEAA 4IWQA 3FD9A 4JWEA 1MJGA 2LM0A 4JWCA 4EZUA 4EZQA 3GI7A 4JWIA 5FIGA 3I01A 4R5KA 3T4AG 3O3MB 2YIBA 3DPPA 1E1DA 3A98A 5FLEX 1Q5LA 1CKRA 3RV0A 1DKXA 4JNEA 3DPQA 4EZVA 5E84A 1GNLA 1OA1A 3I04A 4H6HA 2V7YA 3KAWA 3KDRA 1ZYLA 4IM0A 2RT6A 2QFFA 4FM3A 4JLCA 4UDXX 3H0XA 2BPRA 4R5LA 2OBLA 4HYBA 3T48A 4E3CA 3ER9B 3QNJA 4JWDA 2N3KA 3LMFA 1SU6A 4IWPA 1DKYA 1JQKA 4D8JA 1YUWA 1DG4A 3ZEFA 4EZRA 3ERCC 1GNTA 3DOBA 4WV5A 1E9VA 2KHOA 2EX3B 4HR1B 3ZEDA 4EZZA 3VEBA 3N8EA 3VKHA 7HSCA 3T49A 4EZNA 4IW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PO2 A;  3QNJ A;  4WV7 A;  4JWD A;  4EZW A;  3T47 A;  3OHX M;  4H6I A;  4JNF A;  5TKY A;  2WIN M;  4EZS A;  3C7N B;  2OP6 A;  3DQG A;  4E81 A;  3DPO A;  4JWE A;  4R5G A;  4EZT A;  1DKY A;  4JWC A;  4JN4 A;  4EZU A;  4JWI A;  3D2F A;  4EZQ A;  1U00 A;  3D2E A;  4R5K A;  3L3O M;  3T4A G;  4B9Q A;  4F00 A;  1YUW A;  1DG4 A;  3DPP A;  1Q5L A;  4EZN A;  1BPR A;  4EZR A;  1CKR A;  1DKX A;  2QXL A;  3DPQ A;  4JNE A;  3T49 A;  4EZV A;  3C7N A;  5E84 A;  4EZY A;  3DOB A;  4WV5 A;  2KHO A;  4R5J A;  4H6H A;  4F01 A;  2V7Y A;  4HY9 A;  4FL9 A;  4EZZ A;  4EZO A;  2QFF A;  4EZX A;  4R5I A;  3T46 A;  3H0X A;  2BPR A;  4EZP A;  3N8E A;  7HSC A;  4R5L A;  3T48 A;  4HYB A;  1DKZ A; 
#chains in the Genus database with same CATH topology
 4I43 A;  3DX3 A;  3EJR A;  4EZW A;  2WYI A;  3C7N B;  2F7O A;  3LLL A;  1W9M A;  3D4Z A;  2OP6 A;  2YL6 A;  2X3V A;  4JL9 A;  4E81 A;  1HTY A;  2ND0 A;  2OZN B;  4HR1 A;  2OW6 A;  4R5G A;  2RAK A;  2YIA A;  2X3W A;  2F7R A;  2Q13 A;  4JN4 A;  4WPE A;  2PMR A;  3L3O M;  4F00 A;  2O0I 1;  4I1Q A;  3HAI A;  2YIV X;  4AZB A;  2ELB A;  3M3W A;  1YWM A;  2X5C A;  3DX0 A;  2Z0V A;  2QXL A;  1UPX A;  1WDZ A;  3Q84 A;  3T49 A;  3C7N A;  4NQI A;  3ER8 C;  2NCZ A;  1SU8 A;  1TQS A;  3B53 X;  3CVR A;  3CV5 A;  4HY9 A;  2EWF A;  4WPC A;  2QKW A;  4KIK A;  2YL5 A;  4AZC A;  4FL9 A;  3BVW A;  3DYT A;  3O3N B;  4R5I A;  3T46 A;  4DYL A;  5KBP A;  2GAF D;  3O3O B;  3SBT B;  4G6Q A;  4AZH A;  3OK8 A;  1QX1 A;  3OWG A;  4PO2 A;  2D1L A;  2D4C A;  3BUD A;  1ZWW A;  4ILG A;  1TQT A;  4ILH B;  4JNF A;  4H8S A;  3EJT A;  4NSW A;  4EZS A;  2YI9 A;  3DQG A;  3ABH A;  1E2U A;  3DPO A;  4EZT A;  2JNS A;  4KIK B;  2YL9 A;  3D2F A;  3EJU A;  1I4D A;  1U00 A;  2C08 A;  2F18 A;  3D2E A;  3BUQ A;  3HAJ A;  4FZS A;  4B9Q A;  1SUF A;  2ND1 A;  2ALW A;  4UDY X;  2F1A A;  2PY6 A;  3BLB A;  4AZG A;  4MQD A;  1CKR A;  1BPR A;  3RV1 A;  3SYV A;  2GF4 A;  2Z0N A;  3DDG A;  4IWO A;  1SU7 A;  3RPM A;  2FYV A;  2Q12 A;  3KAV A;  4ATM A;  4EZY A;  2JNK A;  1I49 A;  2LXY A;  2MI7 A;  2GA9 D;  2YI8 A;  4R5J A;  4F01 A;  4WV7 A;  1GN9 A;  4BNE A;  4ILI A;  3SBS A;  4EZO A;  3B51 X;  2OO2 A;  3CAZ A;  4IM3 A;  4AZI A;  2OBM A;  1O7D C;  4IM2 A;  4EZX A;  3DX4 A;  2WYH A;  4EZP A;  3F7W A;  1QWU A;  3CZS A;  3EJQ A;  1DKZ A;  4M0M A;  3UIT A;  1OA0 A;  4AZ7 A;  2X3X A;  1OAO A;  3BVU A;  3BUI A;  3I39 X;  3QA8 A;  3QNI A;  3EJS A;  4NPH A;  3CKD A;  3D4Y A;  2Z8Y A;  3OHX M;  4H6I A;  5TKY A;  2WIN M;  3T47 A;  4AKV A;  3B52 X;  2F1B A;  3G9G A;  3VEA A;  4IWQ A;  3HAH A;  3FD9 A;  4JWE A;  1MJG A;  2LM0 A;  4JWC A;  4EZU A;  4EZQ A;  3GI7 A;  4JWI A;  1TQU A;  5FIG A;  3I01 A;  4R5K A;  4FZO A;  3O3M B;  3CZN A;  2YIB A;  3T4A G;  1HXK A;  3PLT A;  3DPP A;  1E1D A;  1O7D B;  3A98 A;  1TQW A;  3BVT A;  2EFK A;  5FLE X;  1DKX A;  5C5B B;  3RV0 A;  1Q5L A;  1TQV A;  4JNE A;  2EFL A;  3DPQ A;  3D52 A;  3DX2 A;  5E84 A;  4EZV A;  1GNL A;  1R34 A;  4AVM A;  3ACO A;  2Z0O A;  1OA1 A;  2F7P A;  3I04 A;  4H6H A;  3SOG A;  3KAW A;  3BVV A;  2YL8 A;  1ZYL A;  3DX1 A;  3KDR A;  2V7Y A;  4IM0 A;  2RT6 A;  2QFF A;  3DDF A;  4FM3 A;  4JLC A;  4UDX X;  3H0X A;  2BPR A;  4R5L A;  2OBL A;  4HYB A;  2ZXQ A;  3T48 A;  4E3C A;  5C5B A;  3D50 A;  3QNJ A;  3ER9 B;  3QWE A;  3BVX A;  3I2W A;  4JWD A;  1X03 A;  1HWW A;  2OW7 A;  2N3K A;  2YKT A;  3LMF A;  1SU6 A;  4AZC B;  4AZ6 A;  4AZ5 A;  1I4T A;  2V0O A;  3L3P A;  1DKY A;  3LVT A;  1JQK A;  4IWP A;  1QWN A;  2YLA A;  4D8J A;  1R5E A;  1I4L A;  1X04 A;  3D51 A;  1YUW A;  1R33 A;  1DG4 A;  3EJP A;  3ZEF A;  3BUB A;  2F7Q A;  4EZR A;  3ERC C;  1GNT A;  1URU A;  2YLL A;  3DOB A;  4WV5 A;  1E9V A;  2KHO A;  4FZP A;  2EX3 B;  3Q0K A;  4HR1 B;  1LQ7 A;  3ZED A;  4DCN C;  4EZZ A;  2FIC A;  1Y2O A;  2RAJ A;  3BUP A;  3VEB A;  3N8E A;  1PS3 A;  3VKH A;  3QE6 A;  7HSC A;  2RAI A;  4EZN A;  4IW0 A; 
#chains in the Genus database with same CATH homology
 4I43 A;  4EZW A;  3C7N B;  1W9M A;  2OP6 A;  4JL9 A;  4E81 A;  4HR1 A;  2ND0 A;  4R5G A;  2YIA A;  4JN4 A;  3L3O M;  4F00 A;  2YIV X;  2X5C A;  2QXL A;  1UPX A;  3ER8 C;  3C7N A;  2NCZ A;  1SU8 A;  3B53 X;  4HY9 A;  2EWF A;  4FL9 A;  4KIK A;  3O3N B;  4R5I A;  3T46 A;  2GAF D;  3O3O B;  3SBT B;  4G6Q A;  3OWG A;  4PO2 A;  4ILG A;  4ILH B;  4JNF A;  4EZS A;  3DQG A;  2YI9 A;  1E2U A;  3DPO A;  4EZT A;  2JNS A;  4KIK B;  3D2F A;  1U00 A;  3D2E A;  4B9Q A;  1SUF A;  2ND1 A;  4UDY X;  2PY6 A;  4MQD A;  1BPR A;  3RV1 A;  4IWO A;  1SU7 A;  4EZY A;  3KAV A;  2GA9 D;  2YI8 A;  4R5J A;  4F01 A;  1GN9 A;  4ILI A;  4EZO A;  3B51 X;  4IM3 A;  4EZX A;  2OBM A;  4IM2 A;  4EZP A;  3F7W A;  1DKZ A;  4M0M A;  3UIT A;  1OA0 A;  4WV7 A;  1OAO A;  3SBS A;  3QA8 A;  3I39 X;  4NPH A;  3T47 A;  3OHX M;  2Z8Y A;  4H6I A;  5TKY A;  2WIN M;  3B52 X;  3VEA A;  4IWQ A;  3FD9 A;  4JWE A;  1MJG A;  2LM0 A;  4JWC A;  4EZU A;  4EZQ A;  3GI7 A;  4JWI A;  5FIG A;  3I01 A;  4R5K A;  3T4A G;  3O3M B;  2YIB A;  3DPP A;  1E1D A;  3A98 A;  5FLE X;  1Q5L A;  1CKR A;  3RV0 A;  1DKX A;  4JNE A;  3DPQ A;  4EZV A;  5E84 A;  1GNL A;  1OA1 A;  3I04 A;  4H6H A;  2V7Y A;  3KAW A;  3KDR A;  1ZYL A;  4IM0 A;  2RT6 A;  2QFF A;  4FM3 A;  4JLC A;  4UDX X;  3H0X A;  2BPR A;  4R5L A;  2OBL A;  4HYB A;  3T48 A;  4E3C A;  3ER9 B;  3QNJ A;  4JWD A;  2N3K A;  3LMF A;  1SU6 A;  4IWP A;  1DKY A;  1JQK A;  4D8J A;  1YUW A;  1DG4 A;  3ZEF A;  4EZR A;  3ERC C;  1GNT A;  3DOB A;  4WV5 A;  1E9V A;  2KHO A;  2EX3 B;  4HR1 B;  3ZED A;  4EZZ A;  3VEB A;  3N8E A;  3VKH A;  7HSC A;  3T49 A;  4EZN A;  4IW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...