4EZTA

Crystal structure of the substrate binding domain of e.coli dnak in complex with heliocin (residues 14 to 21)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
217
structure length
217
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
molecule keywords Chaperone protein DnaK
total genus 65
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4eztA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4eztA01
2V7YA 3DOBA 4R5IA 4EZWA 4EZNA 3T47A 2OP6A 4F00A 4EZSA 3D2EA 3DPPA 4WV7A 1DKYA 4JWDA 4R5JA 3T4AG 3T49A 3D2FA 1YUWA 2WINM 4EZTA 4JN4A 1BPRA 4R5LA 4EZPA 4EZZA 3C7NA 1CKRA 4JWEA 4R5KA 4EZVA 4H6HA 4JNFA 1DKZA 4EZRA 3L3OM 2KHOA 1U00A 4E81A 5TKYA 4F01A 3H0XA 7HSCA 4EZUA 4H6IA 1DKXA 4R5GA 4FL9A 3DPQA 4HYBA 1DG4A 3DPOA 4JNEA 3T48A 2BPRA 3DQGA 4JWCA 3OHXM 4EZXA 1Q5LA 4EZOA 4WV5A 4HY9A 3T46A 5E84A 2QFFA 3QNJA 4JWIA 4B9QA 4EZYA 3C7NB 3N8EA 4EZQA 4PO2A 2QXLA
chains in the Genus database with same CATH superfamily
1URUA 3ACOA 4R5IA 3D51A 2YLLA 2X5CA 4EZNA 1JQKA 3OK8A 3CV5A 3OWGA 3VKHA 4IWOA 3M3WA 4WV7A 3T4AG 3D2FA 1I49A 2WINM 4AZHA 1YUWA 1BPRA 2GA9D 4EZZA 3C7NA 3D52A 1CKRA 3BUPA 3EJQA 2ND1A 3QWEA 4UDYX 2PMRA 4BNEA 2RT6A 2F7PA 3H0XA 1DKZA 3KDRA 3QNIA 2ZXQA 2OZNB 3HAJA 4F01A 5TKYA 2YI8A 3F7WA 2EX3B 1R5EA 2F7RA 3KAVA 2JNSA 3O3NB 4H6IA 4IM2A 5C5BA 4G6QA 1OAOA 3DX1A 3BVVA 3DPOA 3ZEFA 4AZCA 4JNEA 2YKTA 4HR1B 3DDGA 3LMFA 1GNTA 2YIVX 2YI9A 3CVRA 4JWCA 2OW6A 2QFFA 2GAFD 2YL8A 2ALWA 4JWIA 1I4LA 2PY6A 2LM0A 4FZOA 4UDXX 3UITA 3N8EA 4DYLA 1W9MA 2WYIA 2QXLA 3SBSA 1UPXA 4H8SA 3SOGA 3VEBA 4EZSA 3CZSA 4FM3A 3DPPA 3I2WA 2ND0A 3BUIA 3I39X 4JWDA 4R5JA 4FZSA 4AZGA 4I1QA 4EZTA 4ILGA 4ILHB 4MQDA 4AKVA 3LVTA 1X04A 3B51X 2D4CA 4FZPA 4AVMA 4E3CA 4EZQA 1R33A 4E81A 4AZIA 4IWPA 1Y2OA 2OO2A 4AZ7A 3BVWA 4R5GA 2YL9A 4HYBA 3BVUA 2Q13A 3T48A 2Z0OA 2BPRA 5FLEX 4EZOA 1SU8A 2OBLA 3EJRA 2Q12A 4HY9A 4KIKB 1QWNA 4I43A 3KAWA 2X3WA 1TQVA 4AZ5A 4PO2A 3ERCC 2F18A 4AZCB 3SYVA 3DOBA 1O7DB 1PS3A 3HAIA 4EZWA 2C08A 3T47A 2OP6A 4WV5A 2RAKA 3BUBA 3D50A 3D2EA 2EFLA 3QA8A 1ZWWA 1DKYA 4WPEA 2NCZA 3DX4A 3T49A 1SU7A 4ATMA 3EJTA 4M0MA 4AZBA 3CAZA 1QWUA 4IWQA 2V0OA 4NPHA 4EZPA 3D4ZA 5KBPA 4JWEA 3VEAA 2YL6A 4EZRA 3B52X 2RAJA 3RPMA 1LQ7A 3FD9A 3G9GA 3I01A 3O3OB 4JNFA 1HXKA 2X3VA 1SU6A 3Q0KA 1E2UA 1E1DA 3HAHA 2JNKA 3ABHA 2F1AA 2RAIA 4FL9A 2YIAA 1SUFA 3DPQA 1DG4A 3A98A 1TQSA 1YWMA 2X3XA 3CKDA 2EFKA 3BUQA 3O3MB 2D1LA 2FICA 3D4YA 1HWWA 3OHXM 2FYVA 3ER8C 3QNJA 1R34A 3EJPA 4IM3A 1OA1A 4NSWA 4NQIA 3B53X 3BUDA 3BVXA 3LLLA 2Z0VA 2QKWA 4JLCA 2V7YA 4D8JA 4IW0A 4WPCA 4F00A 1E9VA 3DX0A 1X03A 3L3PA 2YL5A 3DDFA 5C5BB 2OW7A 3Q84A 4JN4A 4JL9A 4R5LA 3ZEDA 3SBTB 3BLBA 2F1BA 3EJUA 2OBMA 3BVTA 3PLTA 1I4DA 4R5KA 4ILIA 4EZVA 2Z8YA 2MI7A 1TQWA 4H6HA 4HR1A 3RV0A 3ER9B 3DYTA 2KHOA 1U00A 3GI7A 3L3OM 4DCNC 1WDZA 7HSCA 4EZUA 1DKXA 1O7DC 3QE6A 3DX2A 4AZ6A 1TQTA 1QX1A 2YLAA 2WYHA 2N3KA 3EJSA 5FIGA 3DQGA 2F7QA 1TQUA 1OA0A 1MJGA 2F7OA 2Z0NA 2YIBA 3CZNA 3I04A 3T46A 4EZXA 1ZYLA 4IM0A 5E84A 1Q5LA 1HTYA 4B9QA 2LXYA 2O0I1 1GN9A 1I4TA 2ELBA 4KIKA 3RV1A 1GNLA 2EWFA 4EZYA 3C7NB 2GF4A 3DX3A
chains in the Genus database with same CATH topology
4R5IA 2X5CA 4EZNA 1JQKA 3OWGA 3VKHA 4IWOA 4WV7A 3T4AG 3D2FA 1YUWA 2WINM 1BPRA 2GA9D 4EZZA 3C7NA 1CKRA 2ND1A 4UDYX 2RT6A 1DKZA 3KDRA 4EZRA 4F01A 5TKYA 2YI8A 3F7WA 2EX3B 3KAVA 3O3NB 3H0XA 2JNSA 4H6IA 4IM2A 4G6QA 1OAOA 3DPOA 3ZEFA 4JNEA 4HR1B 3LMFA 4JWCA 1GNTA 2YIVX 2YI9A 2QFFA 2GAFD 4JWIA 3UITA 2PY6A 4UDXX 2LM0A 3N8EA 1W9MA 2QXLA 3SBSA 1UPXA 3VEBA 4EZSA 4FM3A 3DPPA 4JWDA 2ND0A 3I39X 4R5JA 4EZTA 4ILGA 4ILHB 4MQDA 3B51X 4E3CA 4E81A 4IWPA 4R5GA 4HYBA 3T48A 2BPRA 5FLEX 4EZOA 1SU8A 2OBLA 4HY9A 4KIKB 3KAWA 4PO2A 3ERCC 3DOBA 4EZWA 2OP6A 3T47A 3D2EA 3QA8A 1DKYA 2NCZA 3T49A 1SU7A 4M0MA 4I43A 4IWQA 4NPHA 4EZPA 3VEAA 4JWEA 3B52X 3FD9A 3I01A 3O3OB 4JNFA 1SU6A 1E2UA 1E1DA 4FL9A 2YIAA 1SUFA 3DPQA 3A98A 3O3MB 3OHXM 3ER8C 3QNJA 4IM3A 1OA1A 3B53X 4JLCA 2V7YA 4D8JA 4IW0A 4F00A 1E9VA 4JN4A 4JL9A 4R5LA 3ZEDA 3SBTB 2OBMA 4R5KA 4ILIA 4EZVA 2Z8YA 4H6HA 3RV0A 4HR1A 3ER9B 3GI7A 2KHOA 1U00A 3L3OM 7HSCA 4EZUA 1DKXA 2N3KA 5FIGA 3DQGA 3I04A 1OA0A 1MJGA 1DG4A 2YIBA 4EZXA 1Q5LA 4WV5A 3T46A 1ZYLA 4IM0A 5E84A 4B9QA 4KIKA 1GN9A 3RV1A 4EZYA 3C7NB 4EZQA 1GNLA 2EWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V7Y A;  3DOB A;  4R5I A;  4EZW A;  4EZN A;  3T47 A;  2OP6 A;  4F00 A;  4EZS A;  3D2E A;  3DPP A;  4WV7 A;  1DKY A;  4JWD A;  4R5J A;  3T4A G;  3T49 A;  3D2F A;  1YUW A;  2WIN M;  4EZT A;  4JN4 A;  1BPR A;  4R5L A;  4EZP A;  4EZZ A;  3C7N A;  1CKR A;  4JWE A;  4R5K A;  4EZV A;  4H6H A;  4JNF A;  1DKZ A;  4EZR A;  3L3O M;  2KHO A;  1U00 A;  4E81 A;  5TKY A;  4F01 A;  3H0X A;  7HSC A;  4EZU A;  4H6I A;  1DKX A;  4R5G A;  4FL9 A;  3DPQ A;  4HYB A;  1DG4 A;  3DPO A;  4JNE A;  3T48 A;  2BPR A;  3DQG A;  4JWC A;  3OHX M;  4EZX A;  1Q5L A;  4EZO A;  4WV5 A;  4HY9 A;  3T46 A;  5E84 A;  2QFF A;  3QNJ A;  4JWI A;  4B9Q A;  4EZY A;  3C7N B;  3N8E A;  4EZQ A;  4PO2 A;  2QXL A; 
#chains in the Genus database with same CATH topology
 1URU A;  3ACO A;  4R5I A;  3D51 A;  2YLL A;  2X5C A;  4EZN A;  1JQK A;  3OK8 A;  3CV5 A;  3OWG A;  3VKH A;  4IWO A;  3M3W A;  4WV7 A;  3T4A G;  3D2F A;  1I49 A;  2WIN M;  4AZH A;  1YUW A;  1BPR A;  2GA9 D;  4EZZ A;  3C7N A;  3D52 A;  1CKR A;  3BUP A;  3EJQ A;  2ND1 A;  3QWE A;  4UDY X;  2PMR A;  4BNE A;  2RT6 A;  2F7P A;  3H0X A;  1DKZ A;  3KDR A;  3QNI A;  2ZXQ A;  2OZN B;  3HAJ A;  4F01 A;  5TKY A;  2YI8 A;  3F7W A;  2EX3 B;  1R5E A;  2F7R A;  3KAV A;  2JNS A;  3O3N B;  4H6I A;  4IM2 A;  5C5B A;  4G6Q A;  1OAO A;  3DX1 A;  3BVV A;  3DPO A;  3ZEF A;  4AZC A;  4JNE A;  2YKT A;  4HR1 B;  3DDG A;  3LMF A;  1GNT A;  2YIV X;  2YI9 A;  3CVR A;  4JWC A;  2OW6 A;  2QFF A;  2GAF D;  2YL8 A;  2ALW A;  4JWI A;  1I4L A;  2PY6 A;  2LM0 A;  4FZO A;  4UDX X;  3UIT A;  3N8E A;  4DYL A;  1W9M A;  2WYI A;  2QXL A;  3SBS A;  1UPX A;  4H8S A;  3SOG A;  3VEB A;  4EZS A;  3CZS A;  4FM3 A;  3DPP A;  3I2W A;  2ND0 A;  3BUI A;  3I39 X;  4JWD A;  4R5J A;  4FZS A;  4AZG A;  4I1Q A;  4EZT A;  4ILG A;  4ILH B;  4MQD A;  4AKV A;  3LVT A;  1X04 A;  3B51 X;  2D4C A;  4FZP A;  4AVM A;  4E3C A;  4EZQ A;  1R33 A;  4E81 A;  4AZI A;  4IWP A;  1Y2O A;  2OO2 A;  4AZ7 A;  3BVW A;  4R5G A;  2YL9 A;  4HYB A;  3BVU A;  2Q13 A;  3T48 A;  2Z0O A;  2BPR A;  5FLE X;  4EZO A;  1SU8 A;  2OBL A;  3EJR A;  2Q12 A;  4HY9 A;  4KIK B;  1QWN A;  4I43 A;  3KAW A;  2X3W A;  1TQV A;  4AZ5 A;  4PO2 A;  3ERC C;  2F18 A;  4AZC B;  3SYV A;  3DOB A;  1O7D B;  1PS3 A;  3HAI A;  4EZW A;  2C08 A;  3T47 A;  2OP6 A;  4WV5 A;  2RAK A;  3BUB A;  3D50 A;  3D2E A;  2EFL A;  3QA8 A;  1ZWW A;  1DKY A;  4WPE A;  2NCZ A;  3DX4 A;  3T49 A;  1SU7 A;  4ATM A;  3EJT A;  4M0M A;  4AZB A;  3CAZ A;  1QWU A;  4IWQ A;  2V0O A;  4NPH A;  4EZP A;  3D4Z A;  5KBP A;  4JWE A;  3VEA A;  2YL6 A;  4EZR A;  3B52 X;  2RAJ A;  3RPM A;  1LQ7 A;  3FD9 A;  3G9G A;  3I01 A;  3O3O B;  4JNF A;  1HXK A;  2X3V A;  1SU6 A;  3Q0K A;  1E2U A;  1E1D A;  3HAH A;  2JNK A;  3ABH A;  2F1A A;  2RAI A;  4FL9 A;  2YIA A;  1SUF A;  3DPQ A;  1DG4 A;  3A98 A;  1TQS A;  1YWM A;  2X3X A;  3CKD A;  2EFK A;  3BUQ A;  3O3M B;  2D1L A;  2FIC A;  3D4Y A;  1HWW A;  3OHX M;  2FYV A;  3ER8 C;  3QNJ A;  1R34 A;  3EJP A;  4IM3 A;  1OA1 A;  4NSW A;  4NQI A;  3B53 X;  3BUD A;  3BVX A;  3LLL A;  2Z0V A;  2QKW A;  4JLC A;  2V7Y A;  4D8J A;  4IW0 A;  4WPC A;  4F00 A;  1E9V A;  3DX0 A;  1X03 A;  3L3P A;  2YL5 A;  3DDF A;  5C5B B;  2OW7 A;  3Q84 A;  4JN4 A;  4JL9 A;  4R5L A;  3ZED A;  3SBT B;  3BLB A;  2F1B A;  3EJU A;  2OBM A;  3BVT A;  3PLT A;  1I4D A;  4R5K A;  4ILI A;  4EZV A;  2Z8Y A;  2MI7 A;  1TQW A;  4H6H A;  4HR1 A;  3RV0 A;  3ER9 B;  3DYT A;  2KHO A;  1U00 A;  3GI7 A;  3L3O M;  4DCN C;  1WDZ A;  7HSC A;  4EZU A;  1DKX A;  1O7D C;  3QE6 A;  3DX2 A;  4AZ6 A;  1TQT A;  1QX1 A;  2YLA A;  2WYH A;  2N3K A;  3EJS A;  5FIG A;  3DQG A;  2F7Q A;  1TQU A;  1OA0 A;  1MJG A;  2F7O A;  2Z0N A;  2YIB A;  3CZN A;  3I04 A;  3T46 A;  4EZX A;  1ZYL A;  4IM0 A;  5E84 A;  1Q5L A;  1HTY A;  4B9Q A;  2LXY A;  2O0I 1;  1GN9 A;  1I4T A;  2ELB A;  4KIK A;  3RV1 A;  1GNL A;  2EWF A;  4EZY A;  3C7N B;  2GF4 A;  3DX3 A; 
#chains in the Genus database with same CATH homology
 4R5I A;  2X5C A;  4EZN A;  1JQK A;  3OWG A;  3VKH A;  4IWO A;  4WV7 A;  3T4A G;  3D2F A;  1YUW A;  2WIN M;  1BPR A;  2GA9 D;  4EZZ A;  3C7N A;  1CKR A;  2ND1 A;  4UDY X;  2RT6 A;  1DKZ A;  3KDR A;  4EZR A;  4F01 A;  5TKY A;  2YI8 A;  3F7W A;  2EX3 B;  3KAV A;  3O3N B;  3H0X A;  2JNS A;  4H6I A;  4IM2 A;  4G6Q A;  1OAO A;  3DPO A;  3ZEF A;  4JNE A;  4HR1 B;  3LMF A;  4JWC A;  1GNT A;  2YIV X;  2YI9 A;  2QFF A;  2GAF D;  4JWI A;  3UIT A;  2PY6 A;  4UDX X;  2LM0 A;  3N8E A;  1W9M A;  2QXL A;  3SBS A;  1UPX A;  3VEB A;  4EZS A;  4FM3 A;  3DPP A;  4JWD A;  2ND0 A;  3I39 X;  4R5J A;  4EZT A;  4ILG A;  4ILH B;  4MQD A;  3B51 X;  4E3C A;  4E81 A;  4IWP A;  4R5G A;  4HYB A;  3T48 A;  2BPR A;  5FLE X;  4EZO A;  1SU8 A;  2OBL A;  4HY9 A;  4KIK B;  3KAW A;  4PO2 A;  3ERC C;  3DOB A;  4EZW A;  2OP6 A;  3T47 A;  3D2E A;  3QA8 A;  1DKY A;  2NCZ A;  3T49 A;  1SU7 A;  4M0M A;  4I43 A;  4IWQ A;  4NPH A;  4EZP A;  3VEA A;  4JWE A;  3B52 X;  3FD9 A;  3I01 A;  3O3O B;  4JNF A;  1SU6 A;  1E2U A;  1E1D A;  4FL9 A;  2YIA A;  1SUF A;  3DPQ A;  3A98 A;  3O3M B;  3OHX M;  3ER8 C;  3QNJ A;  4IM3 A;  1OA1 A;  3B53 X;  4JLC A;  2V7Y A;  4D8J A;  4IW0 A;  4F00 A;  1E9V A;  4JN4 A;  4JL9 A;  4R5L A;  3ZED A;  3SBT B;  2OBM A;  4R5K A;  4ILI A;  4EZV A;  2Z8Y A;  4H6H A;  3RV0 A;  4HR1 A;  3ER9 B;  3GI7 A;  2KHO A;  1U00 A;  3L3O M;  7HSC A;  4EZU A;  1DKX A;  2N3K A;  5FIG A;  3DQG A;  3I04 A;  1OA0 A;  1MJG A;  1DG4 A;  2YIB A;  4EZX A;  1Q5L A;  4WV5 A;  3T46 A;  1ZYL A;  4IM0 A;  5E84 A;  4B9Q A;  4KIK A;  1GN9 A;  3RV1 A;  4EZY A;  3C7N B;  4EZQ A;  1GNL A;  2EWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...