4EZUA

Crystal structure of the substrate binding domain of e.coli dnak in complex with pr-bombesin in space group i222
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
216
structure length
216
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural studies of DnaK in complex with proline rich antimicrobial peptides reveal two different peptide binding modes
rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
molecule keywords Chaperone protein DnaK
total genus 69
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezuA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezuA01
3OHXM 4EZQA 4WV5A 3DPOA 4EZRA 3T46A 4H6IA 4R5JA 2KHOA 4EZVA 4JWDA 3T4AG 4JWCA 3DPQA 3C7NB 5E84A 1DKXA 4E81A 4HY9A 4H6HA 4R5KA 3D2EA 4EZOA 4F01A 2BPRA 3DQGA 1CKRA 2V7YA 4EZTA 3D2FA 3H0XA 2QXLA 3QNJA 4JNFA 4EZZA 2WINM 4JNEA 1BPRA 3L3OM 2QFFA 4EZWA 4WV7A 1U00A 7HSCA 4JWEA 4B9QA 4EZSA 4EZXA 4PO2A 1YUWA 5TKYA 2OP6A 4JN4A 4F00A 4HYBA 4JWIA 4R5GA 4EZPA 4R5IA 3T49A 4EZNA 4EZYA 4EZUA 4FL9A 3T48A 4R5LA 1DKZA 1Q5LA 3DOBA 3DPPA 3C7NA 3T47A 3N8EA 1DG4A 1DKYA
chains in the Genus database with same CATH superfamily
3SYVA 4IW0A 1QX1A 3DPOA 3DYTA 1TQWA 3LVTA 1TQUA 2GAFD 2KHOA 2OW7A 4JWDA 2OBMA 4H8SA 4FZOA 3EJTA 3B53X 5E84A 4EZOA 2X3WA 2BPRA 4F01A 1OA0A 3H0XA 2QXLA 2YIAA 3QE6A 4JNFA 3EJUA 3I04A 4UDXX 2QFFA 1U00A 3HAJA 1I49A 3M3WA 4AVMA 4EZSA 3PLTA 4DCNC 3B52X 1YUWA 2EFLA 5TKYA 2F7RA 2Q12A 1PS3A 2FICA 4F00A 2OP6A 2ND1A 3BLBA 1UPXA 2MI7A 2FYVA 1QWUA 1QWNA 2EFKA 4IWQA 2OW6A 2WYIA 1E9VA 1I4DA 4EZUA 4AZ6A 2GA9D 2OBLA 4HR1A 4KIKA 2GF4A 4E3CA 5C5BA 4EZXA 4FM3A 2F7PA 1SU8A 4AZIA 4WV5A 3BVUA 2Z0OA 3BUIA 3DDFA 4AZCA 4EZRA 3RV0A 4JLCA 4AZHA 2D1LA 2EWFA 3ZEDA 3T4AG 3HAHA 2LM0A 2RAIA 3C7NB 1DKXA 3FD9A 4H6HA 4R5KA 3DQGA 4AZCB 4BNEA 1CKRA 3D52A 3OWGA 1MJGA 4HR1B 4ATMA 1TQSA 2YIVX 3KAVA 3DX0A 4JNEA 3RV1A 4I43A 1SUFA 1X03A 4NQIA 4B9QA 4NPHA 3O3OB 1O7DC 3Q0KA 1SU6A 2OZNB 3BVXA 1E1DA 3BVVA 4JWIA 4JN4A 5FIGA 4AZGA 4R5IA 2F7OA 2Z0NA 4EZNA 3CZSA 3DX3A 3G9GA 1Y2OA 2N3KA 1YWMA 3BVWA 4I1QA 3DX1A 2WYHA 2Z0VA 1TQVA 3A98A 3QA8A 4KIKB 3BUQA 3GI7A 1I4LA 3I01A 3D50A 3OK8A 4IWOA 2YL8A 1DG4A 3BVTA 1HXKA 1OA1A 3DDGA 3OHXM 2X5CA 3O3NB 3QWEA 3KAWA 4IM2A 4R5JA 3ACOA 3T46A 2PMRA 3UITA 2PY6A 1E2UA 2F1AA 2X3VA 2RT6A 3DPQA 4JL9A 4UDYX 4HY9A 5C5BB 1O7DB 2YKTA 3EJQA 3ERCC 2Z8YA 1GNTA 3D4ZA 3DX2A 2OO2A 3O3MB 1HWWA 4IWPA 4AKVA 4EZTA 5KBPA 1BPRA 2V7YA 2WINM 4M0MA 3SBTB 4D8JA 1R5EA 2JNSA 4IM0A 2O0I1 2NCZA 3D4YA 3CV5A 4AZBA 4AZ5A 1WDZA 3VEBA 2QKWA 4FZPA 3CAZA 1TQTA 1R33A 3QNIA 4R5GA 4EZPA 1HTYA 3T49A 4EZYA 1JQKA 2EX3B 2YI9A 2LXYA 3EJPA 1URUA 3Q84A 4ILGA 3BUDA 1GNLA 2RAKA 3L3PA 2ZXQA 3SOGA 1DKZA 2F18A 4EZQA 3BUBA 2ELBA 4ILIA 1DKYA 2F7QA 3CKDA 3I39X 4H6IA 4EZVA 3F7WA 1GN9A 2V0OA 3ER9B 4IM3A 4JWCA 3LMFA 3ABHA 4E81A 3D2EA 5FLEX 3I2WA 2JNKA 4DYLA 2D4CA 3D51A 4AZ7A 1W9MA 2RAJA 3D2FA 3EJRA 1X04A 3QNJA 4G6QA 4FZSA 4EZZA 4WPEA 4NSWA 2YIBA 3L3OM 1R34A 1OAOA 4EZWA 1LQ7A 2F1BA 4WV7A 2YI8A 7HSCA 3BUPA 4JWEA 1SU7A 4PO2A 3VEAA 3LLLA 4MQDA 3KDRA 3SBSA 1ZYLA 2ND0A 3CZNA 4HYBA 2C08A 4ILHB 3RPMA 1ZWWA 3ER8C 1I4TA 2YL9A 2YL6A 3EJSA 2ALWA 2Q13A 2YLLA 3VKHA 3DX4A 4FL9A 3HAIA 3CVRA 3T48A 4R5LA 2YLAA 3B51X 3ZEFA 1Q5LA 2YL5A 3DOBA 3DPPA 3C7NA 3T47A 3N8EA 2X3XA 4WPCA
chains in the Genus database with same CATH topology
4IW0A 3DPOA 2GAFD 2KHOA 4JWDA 2OBMA 3B53X 5E84A 4EZOA 2BPRA 4F01A 1OA0A 3H0XA 2QXLA 2YIAA 4JNFA 3I04A 4UDXX 2QFFA 1U00A 4EZSA 3B52X 1YUWA 5TKYA 2OP6A 4F00A 2ND1A 1UPXA 4IWQA 4EZUA 1E9VA 2GA9D 2OBLA 4HR1A 4KIKA 4E3CA 4EZXA 4FM3A 1SU8A 4WV5A 4EZRA 3RV0A 4JLCA 3ZEDA 2EWFA 3T4AG 2LM0A 3C7NB 1DKXA 3FD9A 4H6HA 4R5KA 3DQGA 1CKRA 3OWGA 1MJGA 4HR1B 2YIVX 4JNEA 3KAVA 3RV1A 4I43A 1SUFA 4B9QA 4NPHA 3O3OB 1SU6A 5FIGA 4JN4A 1E1DA 4JWIA 4R5IA 4EZNA 2N3KA 3QA8A 3A98A 4KIKB 3GI7A 3I01A 4IWOA 1DG4A 1OA1A 3OHXM 4EZQA 2X5CA 3O3NB 3KAWA 4IM2A 4R5JA 3T46A 3UITA 2PY6A 1E2UA 3DPQA 2RT6A 4JL9A 4UDYX 4HY9A 3ERCC 2Z8YA 1GNTA 3O3MB 4EZTA 4IWPA 3SBTB 1BPRA 2WINM 4M0MA 4D8JA 2JNSA 4IM0A 2NCZA 3VEBA 4R5GA 4EZPA 3T49A 4EZYA 1JQKA 2EX3B 2YI9A 4ILGA 1GNLA 1DKZA 4ILIA 1DKYA 3I39X 4H6IA 4EZVA 3F7WA 1GN9A 3ER9B 4IM3A 4JWCA 3LMFA 4E81A 3D2EA 5FLEX 2V7YA 1W9MA 3D2FA 4G6QA 3QNJA 4EZZA 2YIBA 3L3OM 1OAOA 4EZWA 4WV7A 2YI8A 7HSCA 4JWEA 3VEAA 1SU7A 4PO2A 4MQDA 3KDRA 3SBSA 1ZYLA 2ND0A 4HYBA 4ILHB 3ER8C 3VKHA 4FL9A 3T48A 4R5LA 3B51X 3ZEFA 1Q5LA 3DOBA 3DPPA 3C7NA 3T47A 3N8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OHX M;  4EZQ A;  4WV5 A;  3DPO A;  4EZR A;  3T46 A;  4H6I A;  4R5J A;  2KHO A;  4EZV A;  4JWD A;  3T4A G;  4JWC A;  3DPQ A;  3C7N B;  5E84 A;  1DKX A;  4E81 A;  4HY9 A;  4H6H A;  4R5K A;  3D2E A;  4EZO A;  4F01 A;  2BPR A;  3DQG A;  1CKR A;  2V7Y A;  4EZT A;  3D2F A;  3H0X A;  2QXL A;  3QNJ A;  4JNF A;  4EZZ A;  2WIN M;  4JNE A;  1BPR A;  3L3O M;  2QFF A;  4EZW A;  4WV7 A;  1U00 A;  7HSC A;  4JWE A;  4B9Q A;  4EZS A;  4EZX A;  4PO2 A;  1YUW A;  5TKY A;  2OP6 A;  4JN4 A;  4F00 A;  4HYB A;  4JWI A;  4R5G A;  4EZP A;  4R5I A;  3T49 A;  4EZN A;  4EZY A;  4EZU A;  4FL9 A;  3T48 A;  4R5L A;  1DKZ A;  1Q5L A;  3DOB A;  3DPP A;  3C7N A;  3T47 A;  3N8E A;  1DG4 A;  1DKY A; 
#chains in the Genus database with same CATH topology
 3SYV A;  4IW0 A;  1QX1 A;  3DPO A;  3DYT A;  1TQW A;  3LVT A;  1TQU A;  2GAF D;  2KHO A;  2OW7 A;  4JWD A;  2OBM A;  4H8S A;  4FZO A;  3EJT A;  3B53 X;  5E84 A;  4EZO A;  2X3W A;  2BPR A;  4F01 A;  1OA0 A;  3H0X A;  2QXL A;  2YIA A;  3QE6 A;  4JNF A;  3EJU A;  3I04 A;  4UDX X;  2QFF A;  1U00 A;  3HAJ A;  1I49 A;  3M3W A;  4AVM A;  4EZS A;  3PLT A;  4DCN C;  3B52 X;  1YUW A;  2EFL A;  5TKY A;  2F7R A;  2Q12 A;  1PS3 A;  2FIC A;  4F00 A;  2OP6 A;  2ND1 A;  3BLB A;  1UPX A;  2MI7 A;  2FYV A;  1QWU A;  1QWN A;  2EFK A;  4IWQ A;  2OW6 A;  2WYI A;  1E9V A;  1I4D A;  4EZU A;  4AZ6 A;  2GA9 D;  2OBL A;  4HR1 A;  4KIK A;  2GF4 A;  4E3C A;  5C5B A;  4EZX A;  4FM3 A;  2F7P A;  1SU8 A;  4AZI A;  4WV5 A;  3BVU A;  2Z0O A;  3BUI A;  3DDF A;  4AZC A;  4EZR A;  3RV0 A;  4JLC A;  4AZH A;  2D1L A;  2EWF A;  3ZED A;  3T4A G;  3HAH A;  2LM0 A;  2RAI A;  3C7N B;  1DKX A;  3FD9 A;  4H6H A;  4R5K A;  3DQG A;  4AZC B;  4BNE A;  1CKR A;  3D52 A;  3OWG A;  1MJG A;  4HR1 B;  4ATM A;  1TQS A;  2YIV X;  3KAV A;  3DX0 A;  4JNE A;  3RV1 A;  4I43 A;  1SUF A;  1X03 A;  4NQI A;  4B9Q A;  4NPH A;  3O3O B;  1O7D C;  3Q0K A;  1SU6 A;  2OZN B;  3BVX A;  1E1D A;  3BVV A;  4JWI A;  4JN4 A;  5FIG A;  4AZG A;  4R5I A;  2F7O A;  2Z0N A;  4EZN A;  3CZS A;  3DX3 A;  3G9G A;  1Y2O A;  2N3K A;  1YWM A;  3BVW A;  4I1Q A;  3DX1 A;  2WYH A;  2Z0V A;  1TQV A;  3A98 A;  3QA8 A;  4KIK B;  3BUQ A;  3GI7 A;  1I4L A;  3I01 A;  3D50 A;  3OK8 A;  4IWO A;  2YL8 A;  1DG4 A;  3BVT A;  1HXK A;  1OA1 A;  3DDG A;  3OHX M;  2X5C A;  3O3N B;  3QWE A;  3KAW A;  4IM2 A;  4R5J A;  3ACO A;  3T46 A;  2PMR A;  3UIT A;  2PY6 A;  1E2U A;  2F1A A;  2X3V A;  2RT6 A;  3DPQ A;  4JL9 A;  4UDY X;  4HY9 A;  5C5B B;  1O7D B;  2YKT A;  3EJQ A;  3ERC C;  2Z8Y A;  1GNT A;  3D4Z A;  3DX2 A;  2OO2 A;  3O3M B;  1HWW A;  4IWP A;  4AKV A;  4EZT A;  5KBP A;  1BPR A;  2V7Y A;  2WIN M;  4M0M A;  3SBT B;  4D8J A;  1R5E A;  2JNS A;  4IM0 A;  2O0I 1;  2NCZ A;  3D4Y A;  3CV5 A;  4AZB A;  4AZ5 A;  1WDZ A;  3VEB A;  2QKW A;  4FZP A;  3CAZ A;  1TQT A;  1R33 A;  3QNI A;  4R5G A;  4EZP A;  1HTY A;  3T49 A;  4EZY A;  1JQK A;  2EX3 B;  2YI9 A;  2LXY A;  3EJP A;  1URU A;  3Q84 A;  4ILG A;  3BUD A;  1GNL A;  2RAK A;  3L3P A;  2ZXQ A;  3SOG A;  1DKZ A;  2F18 A;  4EZQ A;  3BUB A;  2ELB A;  4ILI A;  1DKY A;  2F7Q A;  3CKD A;  3I39 X;  4H6I A;  4EZV A;  3F7W A;  1GN9 A;  2V0O A;  3ER9 B;  4IM3 A;  4JWC A;  3LMF A;  3ABH A;  4E81 A;  3D2E A;  5FLE X;  3I2W A;  2JNK A;  4DYL A;  2D4C A;  3D51 A;  4AZ7 A;  1W9M A;  2RAJ A;  3D2F A;  3EJR A;  1X04 A;  3QNJ A;  4G6Q A;  4FZS A;  4EZZ A;  4WPE A;  4NSW A;  2YIB A;  3L3O M;  1R34 A;  1OAO A;  4EZW A;  1LQ7 A;  2F1B A;  4WV7 A;  2YI8 A;  7HSC A;  3BUP A;  4JWE A;  1SU7 A;  4PO2 A;  3VEA A;  3LLL A;  4MQD A;  3KDR A;  3SBS A;  1ZYL A;  2ND0 A;  3CZN A;  4HYB A;  2C08 A;  4ILH B;  3RPM A;  1ZWW A;  3ER8 C;  1I4T A;  2YL9 A;  2YL6 A;  3EJS A;  2ALW A;  2Q13 A;  2YLL A;  3VKH A;  3DX4 A;  4FL9 A;  3HAI A;  3CVR A;  3T48 A;  4R5L A;  2YLA A;  3B51 X;  3ZEF A;  1Q5L A;  2YL5 A;  3DOB A;  3DPP A;  3C7N A;  3T47 A;  3N8E A;  2X3X A;  4WPC A; 
#chains in the Genus database with same CATH homology
 4IW0 A;  3DPO A;  2GAF D;  2KHO A;  4JWD A;  2OBM A;  3B53 X;  5E84 A;  4EZO A;  2BPR A;  4F01 A;  1OA0 A;  3H0X A;  2QXL A;  2YIA A;  4JNF A;  3I04 A;  4UDX X;  2QFF A;  1U00 A;  4EZS A;  3B52 X;  1YUW A;  5TKY A;  2OP6 A;  4F00 A;  2ND1 A;  1UPX A;  4IWQ A;  4EZU A;  1E9V A;  2GA9 D;  2OBL A;  4HR1 A;  4KIK A;  4E3C A;  4EZX A;  4FM3 A;  1SU8 A;  4WV5 A;  4EZR A;  3RV0 A;  4JLC A;  3ZED A;  2EWF A;  3T4A G;  2LM0 A;  3C7N B;  1DKX A;  3FD9 A;  4H6H A;  4R5K A;  3DQG A;  1CKR A;  3OWG A;  1MJG A;  4HR1 B;  2YIV X;  4JNE A;  3KAV A;  3RV1 A;  4I43 A;  1SUF A;  4B9Q A;  4NPH A;  3O3O B;  1SU6 A;  5FIG A;  4JN4 A;  1E1D A;  4JWI A;  4R5I A;  4EZN A;  2N3K A;  3QA8 A;  3A98 A;  4KIK B;  3GI7 A;  3I01 A;  4IWO A;  1DG4 A;  1OA1 A;  3OHX M;  4EZQ A;  2X5C A;  3O3N B;  3KAW A;  4IM2 A;  4R5J A;  3T46 A;  3UIT A;  2PY6 A;  1E2U A;  3DPQ A;  2RT6 A;  4JL9 A;  4UDY X;  4HY9 A;  3ERC C;  2Z8Y A;  1GNT A;  3O3M B;  4EZT A;  4IWP A;  3SBT B;  1BPR A;  2WIN M;  4M0M A;  4D8J A;  2JNS A;  4IM0 A;  2NCZ A;  3VEB A;  4R5G A;  4EZP A;  3T49 A;  4EZY A;  1JQK A;  2EX3 B;  2YI9 A;  4ILG A;  1GNL A;  1DKZ A;  4ILI A;  1DKY A;  3I39 X;  4H6I A;  4EZV A;  3F7W A;  1GN9 A;  3ER9 B;  4IM3 A;  4JWC A;  3LMF A;  4E81 A;  3D2E A;  5FLE X;  2V7Y A;  1W9M A;  3D2F A;  4G6Q A;  3QNJ A;  4EZZ A;  2YIB A;  3L3O M;  1OAO A;  4EZW A;  4WV7 A;  2YI8 A;  7HSC A;  4JWE A;  3VEA A;  1SU7 A;  4PO2 A;  4MQD A;  3KDR A;  3SBS A;  1ZYL A;  2ND0 A;  4HYB A;  4ILH B;  3ER8 C;  3VKH A;  4FL9 A;  3T48 A;  4R5L A;  3B51 X;  3ZEF A;  1Q5L A;  3DOB A;  3DPP A;  3C7N A;  3T47 A;  3N8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...