4EZXA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the designer peptide nrlmltg
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
212
structure length
212
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
molecule keywords Chaperone protein DnaK
total genus 64
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezxA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezxA01
4EZYA 3T47A 4EZRA 4WV5A 4B9QA 4HYBA 4JWEA 4JNEA 7HSCA 2WINM 2QFFA 3L3OM 3T49A 4EZTA 3DOBA 4H6HA 4HY9A 3DPPA 3OHXM 3T48A 4JWDA 4EZUA 3C7NB 4FL9A 4EZVA 2V7YA 4WV7A 3D2EA 1BPRA 4R5GA 1DKYA 5TKYA 3N8EA 3T4AG 4F01A 2OP6A 4JWIA 4R5JA 3D2FA 3DPOA 4JWCA 4EZOA 3DQGA 3DPQA 4PO2A 4R5KA 1U00A 4R5IA 4F00A 4E81A 1YUWA 3H0XA 4JNFA 4JN4A 4EZWA 4EZPA 4EZNA 4EZXA 4R5LA 1DKZA 2QXLA 5E84A 3C7NA 4EZQA 3QNJA 4EZSA 2BPRA 1DKXA 1CKRA 4H6IA 4EZZA 1DG4A 1Q5LA 2KHOA 3T46A
chains in the Genus database with same CATH superfamily
4DYLA 4AZCB 5C5BA 2F7PA 5FLEX 2YI9A 4AVMA 4HYBA 3KAVA 7HSCA 2QFFA 4EZTA 4DCNC 1I4DA 3BUPA 3SYVA 4IWQA 2LM0A 4JWDA 4B9QA 3C7NB 1E1DA 2PY6A 2Q12A 3HAIA 4WV7A 3D2EA 1X03A 3SBSA 1BPRA 2OZNB 2YL6A 3BVWA 4FZPA 1OA1A 4H8SA 4R5GA 3LMFA 5TKYA 3EJSA 2OBMA 3EJQA 3HAJA 4FM3A 2OP6A 2YL8A 4HR1A 1ZWWA 3CKDA 3O3OB 3D4YA 4JWCA 5FIGA 4AZ6A 3RV0A 4EZOA 1YUWA 2FICA 3BVXA 1O7DC 4EZXA 1OAOA 1Y2OA 1DKZA 2QXLA 3C7NA 3O3MB 4AZIA 1R5EA 3PLTA 4H6IA 4NQIA 2YIBA 2OW6A 3D50A 3DX2A 2YI8A 4IM3A 4FZOA 2RT6A 3VEAA 3CZNA 3DX0A 3L3PA 2OBLA 3BUBA 1JQKA 2RAJA 3CAZA 3DYTA 3UITA 4EZYA 3BVTA 3CZSA 2JNKA 3OK8A 4UDYX 2F7QA 3DOBA 3ZEDA 2D4CA 4HY9A 3GI7A 3OHXM 2PMRA 3T48A 1SU6A 4EZUA 3I04A 4EZVA 2NCZA 1I49A 1HTYA 3D52A 3DDGA 3LVTA 4AZGA 2YL9A 2X5CA 4AZ5A 2YIAA 4E3CA 3EJRA 1SU7A 3SBTB 2X3WA 2D1LA 4BNEA 3DQGA 3DPQA 3Q84A 4R5KA 4PO2A 4R5IA 4IW0A 4F00A 3H0XA 3QA8A 3QE6A 3VEBA 4EZWA 4EZPA 2C08A 3ACOA 1TQSA 2ZXQA 2ELBA 2ND0A 2EX3B 5C5BB 2Z8YA 4AZCA 2BPRA 1PS3A 2WYHA 4EZZA 3BVVA 1DG4A 3OWGA 2MI7A 1WDZA 2GF4A 2F7OA 3T46A 3ERCC 4ILGA 2F18A 4ILHB 4I43A 1I4LA 1UPXA 1ZYLA 3SOGA 3T47A 2Z0NA 2WYIA 3D4ZA 3BUDA 4IM0A 4JL9A 4JWEA 4KIKA 3RPMA 1GNLA 2EWFA 3EJUA 2YLAA 3T49A 3ZEFA 4FZSA 4I1QA 1TQWA 4MQDA 2YLLA 2V7YA 3D51A 4HR1B 1TQVA 4ILIA 3BLBA 2N3KA 2Q13A 2X3XA 4JLCA 4WPEA 1TQUA 3BUQA 3HAHA 3LLLA 3T4AG 4AZ7A 3N8EA 4JWIA 4R5JA 4G6QA 4ATMA 3B53X 1U00A 3O3NB 3RV1A 2OW7A 3QWEA 3G9GA 1E9VA 2O0I1 2V0OA 3ABHA 4JN4A 1HWWA 2RAKA 5E84A 4IWPA 1HXKA 3QNJA 1R34A 4WPCA 3M3WA 1DKXA 1CKRA 1OA0A 3DDFA 4AKVA 4NPHA 1Q5LA 3CVRA 2KHOA 3B51X 2YKTA 4F01A 3EJPA 3DX3A 1QWNA 3I2WA 1SU8A 3KDRA 4EZRA 4WV5A 1URUA 2FYVA 1TQTA 2LXYA 1GNTA 3F7WA 2WINM 1QX1A 2GAFD 3L3OM 2Z0VA 4JNEA 1SUFA 4H6HA 3DPPA 4AZBA 3ER8C 1O7DB 2OO2A 3I01A 4FL9A 1W9MA 3BVUA 2JNSA 1I4TA 1YWMA 1DKYA 3DX1A 1X04A 3I39X 4UDXX 5KBPA 3KAWA 4D8JA 4IWOA 2RAIA 2ND1A 3FD9A 4AZHA 4NSWA 1R33A 1QWUA 2ALWA 2QKWA 3D2FA 3DPOA 3B52X 2F1AA 3CV5A 3DX4A 4M0MA 3ER9B 1E2UA 1GN9A 3A98A 2YL5A 4E81A 4JNFA 2YIVX 2X3VA 3EJTA 3BUIA 4EZNA 4R5LA 3VKHA 2GA9D 3QNIA 2F1BA 2F7RA 2EFKA 2EFLA 3Q0KA 4IM2A 4EZQA 4EZSA 1LQ7A 4KIKB 1MJGA 2Z0OA
chains in the Genus database with same CATH topology
5FLEX 2YI9A 4HYBA 3KAVA 7HSCA 2QFFA 4EZTA 4IWQA 2LM0A 4JWDA 3C7NB 1E1DA 2PY6A 3ZEFA 4WV7A 3D2EA 1BPRA 4R5GA 5TKYA 1OA1A 3LMFA 2OBMA 4FM3A 2OP6A 4HR1A 3O3OB 4JWCA 4EZOA 5FIGA 3RV0A 1YUWA 4EZXA 1OAOA 1DKZA 2QXLA 3C7NA 3O3MB 4H6IA 2YIBA 3SBSA 4IM3A 3VEAA 2YI8A 2RT6A 2OBLA 4EZYA 1JQKA 3UITA 4UDYX 3DOBA 3ZEDA 4HY9A 3GI7A 3OHXM 3T48A 1SU6A 4EZUA 3I04A 4EZVA 2NCZA 2X5CA 2YIAA 4E3CA 1SU7A 3SBTB 3DQGA 3DPQA 4PO2A 4R5KA 4R5IA 4IW0A 4F00A 3H0XA 3QA8A 3VEBA 4EZWA 4EZPA 2ND0A 2EX3B 2BPRA 2Z8YA 4EZZA 1DG4A 3OWGA 4ILGA 3T46A 3ERCC 4ILHB 4I43A 1ZYLA 1UPXA 3T47A 4IM0A 4JL9A 4B9QA 4JWEA 4KIKA 1GNLA 2EWFA 3T49A 4MQDA 2V7YA 4HR1B 4ILIA 2N3KA 4JLCA 3N8EA 3T4AG 4JWIA 4R5JA 4G6QA 3B53X 1U00A 3O3NB 3RV1A 1E9VA 4JN4A 5E84A 4IWPA 3QNJA 1DKXA 1CKRA 1OA0A 1Q5LA 2KHOA 3B51X 4F01A 3KDRA 1SU8A 4EZRA 4WV5A 3F7WA 4JNEA 4NPHA 1GNTA 2WINM 2GAFD 3L3OM 1SUFA 4H6HA 3DPPA 3ER8C 3I01A 4FL9A 1W9MA 2JNSA 1DKYA 3I39X 4D8JA 4UDXX 3KAWA 4IWOA 2ND1A 3FD9A 3D2FA 3DPOA 3B52X 4M0MA 3ER9B 1E2UA 1GN9A 3A98A 4E81A 4JNFA 2YIVX 4EZNA 4R5LA 3VKHA 2GA9D 4EZQA 4IM2A 4EZSA 4KIKB 1MJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZY A;  3T47 A;  4EZR A;  4WV5 A;  4B9Q A;  4HYB A;  4JWE A;  4JNE A;  7HSC A;  2WIN M;  2QFF A;  3L3O M;  3T49 A;  4EZT A;  3DOB A;  4H6H A;  4HY9 A;  3DPP A;  3OHX M;  3T48 A;  4JWD A;  4EZU A;  3C7N B;  4FL9 A;  4EZV A;  2V7Y A;  4WV7 A;  3D2E A;  1BPR A;  4R5G A;  1DKY A;  5TKY A;  3N8E A;  3T4A G;  4F01 A;  2OP6 A;  4JWI A;  4R5J A;  3D2F A;  3DPO A;  4JWC A;  4EZO A;  3DQG A;  3DPQ A;  4PO2 A;  4R5K A;  1U00 A;  4R5I A;  4F00 A;  4E81 A;  1YUW A;  3H0X A;  4JNF A;  4JN4 A;  4EZW A;  4EZP A;  4EZN A;  4EZX A;  4R5L A;  1DKZ A;  2QXL A;  5E84 A;  3C7N A;  4EZQ A;  3QNJ A;  4EZS A;  2BPR A;  1DKX A;  1CKR A;  4H6I A;  4EZZ A;  1DG4 A;  1Q5L A;  2KHO A;  3T46 A; 
#chains in the Genus database with same CATH topology
 4DYL A;  4AZC B;  5C5B A;  2F7P A;  5FLE X;  2YI9 A;  4AVM A;  4HYB A;  3KAV A;  7HSC A;  2QFF A;  4EZT A;  4DCN C;  1I4D A;  3BUP A;  3SYV A;  4IWQ A;  2LM0 A;  4JWD A;  4B9Q A;  3C7N B;  1E1D A;  2PY6 A;  2Q12 A;  3HAI A;  4WV7 A;  3D2E A;  1X03 A;  3SBS A;  1BPR A;  2OZN B;  2YL6 A;  3BVW A;  4FZP A;  1OA1 A;  4H8S A;  4R5G A;  3LMF A;  5TKY A;  3EJS A;  2OBM A;  3EJQ A;  3HAJ A;  4FM3 A;  2OP6 A;  2YL8 A;  4HR1 A;  1ZWW A;  3CKD A;  3O3O B;  3D4Y A;  4JWC A;  5FIG A;  4AZ6 A;  3RV0 A;  4EZO A;  1YUW A;  2FIC A;  3BVX A;  1O7D C;  4EZX A;  1OAO A;  1Y2O A;  1DKZ A;  2QXL A;  3C7N A;  3O3M B;  4AZI A;  1R5E A;  3PLT A;  4H6I A;  4NQI A;  2YIB A;  2OW6 A;  3D50 A;  3DX2 A;  2YI8 A;  4IM3 A;  4FZO A;  2RT6 A;  3VEA A;  3CZN A;  3DX0 A;  3L3P A;  2OBL A;  3BUB A;  1JQK A;  2RAJ A;  3CAZ A;  3DYT A;  3UIT A;  4EZY A;  3BVT A;  3CZS A;  2JNK A;  3OK8 A;  4UDY X;  2F7Q A;  3DOB A;  3ZED A;  2D4C A;  4HY9 A;  3GI7 A;  3OHX M;  2PMR A;  3T48 A;  1SU6 A;  4EZU A;  3I04 A;  4EZV A;  2NCZ A;  1I49 A;  1HTY A;  3D52 A;  3DDG A;  3LVT A;  4AZG A;  2YL9 A;  2X5C A;  4AZ5 A;  2YIA A;  4E3C A;  3EJR A;  1SU7 A;  3SBT B;  2X3W A;  2D1L A;  4BNE A;  3DQG A;  3DPQ A;  3Q84 A;  4R5K A;  4PO2 A;  4R5I A;  4IW0 A;  4F00 A;  3H0X A;  3QA8 A;  3QE6 A;  3VEB A;  4EZW A;  4EZP A;  2C08 A;  3ACO A;  1TQS A;  2ZXQ A;  2ELB A;  2ND0 A;  2EX3 B;  5C5B B;  2Z8Y A;  4AZC A;  2BPR A;  1PS3 A;  2WYH A;  4EZZ A;  3BVV A;  1DG4 A;  3OWG A;  2MI7 A;  1WDZ A;  2GF4 A;  2F7O A;  3T46 A;  3ERC C;  4ILG A;  2F18 A;  4ILH B;  4I43 A;  1I4L A;  1UPX A;  1ZYL A;  3SOG A;  3T47 A;  2Z0N A;  2WYI A;  3D4Z A;  3BUD A;  4IM0 A;  4JL9 A;  4JWE A;  4KIK A;  3RPM A;  1GNL A;  2EWF A;  3EJU A;  2YLA A;  3T49 A;  3ZEF A;  4FZS A;  4I1Q A;  1TQW A;  4MQD A;  2YLL A;  2V7Y A;  3D51 A;  4HR1 B;  1TQV A;  4ILI A;  3BLB A;  2N3K A;  2Q13 A;  2X3X A;  4JLC A;  4WPE A;  1TQU A;  3BUQ A;  3HAH A;  3LLL A;  3T4A G;  4AZ7 A;  3N8E A;  4JWI A;  4R5J A;  4G6Q A;  4ATM A;  3B53 X;  1U00 A;  3O3N B;  3RV1 A;  2OW7 A;  3QWE A;  3G9G A;  1E9V A;  2O0I 1;  2V0O A;  3ABH A;  4JN4 A;  1HWW A;  2RAK A;  5E84 A;  4IWP A;  1HXK A;  3QNJ A;  1R34 A;  4WPC A;  3M3W A;  1DKX A;  1CKR A;  1OA0 A;  3DDF A;  4AKV A;  4NPH A;  1Q5L A;  3CVR A;  2KHO A;  3B51 X;  2YKT A;  4F01 A;  3EJP A;  3DX3 A;  1QWN A;  3I2W A;  1SU8 A;  3KDR A;  4EZR A;  4WV5 A;  1URU A;  2FYV A;  1TQT A;  2LXY A;  1GNT A;  3F7W A;  2WIN M;  1QX1 A;  2GAF D;  3L3O M;  2Z0V A;  4JNE A;  1SUF A;  4H6H A;  3DPP A;  4AZB A;  3ER8 C;  1O7D B;  2OO2 A;  3I01 A;  4FL9 A;  1W9M A;  3BVU A;  2JNS A;  1I4T A;  1YWM A;  1DKY A;  3DX1 A;  1X04 A;  3I39 X;  4UDX X;  5KBP A;  3KAW A;  4D8J A;  4IWO A;  2RAI A;  2ND1 A;  3FD9 A;  4AZH A;  4NSW A;  1R33 A;  1QWU A;  2ALW A;  2QKW A;  3D2F A;  3DPO A;  3B52 X;  2F1A A;  3CV5 A;  3DX4 A;  4M0M A;  3ER9 B;  1E2U A;  1GN9 A;  3A98 A;  2YL5 A;  4E81 A;  4JNF A;  2YIV X;  2X3V A;  3EJT A;  3BUI A;  4EZN A;  4R5L A;  3VKH A;  2GA9 D;  3QNI A;  2F1B A;  2F7R A;  2EFK A;  2EFL A;  3Q0K A;  4IM2 A;  4EZQ A;  4EZS A;  1LQ7 A;  4KIK B;  1MJG A;  2Z0O A; 
#chains in the Genus database with same CATH homology
 5FLE X;  2YI9 A;  4HYB A;  3KAV A;  7HSC A;  2QFF A;  4EZT A;  4IWQ A;  2LM0 A;  4JWD A;  3C7N B;  1E1D A;  2PY6 A;  3ZEF A;  4WV7 A;  3D2E A;  1BPR A;  4R5G A;  5TKY A;  1OA1 A;  3LMF A;  2OBM A;  4FM3 A;  2OP6 A;  4HR1 A;  3O3O B;  4JWC A;  4EZO A;  5FIG A;  3RV0 A;  1YUW A;  4EZX A;  1OAO A;  1DKZ A;  2QXL A;  3C7N A;  3O3M B;  4H6I A;  2YIB A;  3SBS A;  4IM3 A;  3VEA A;  2YI8 A;  2RT6 A;  2OBL A;  4EZY A;  1JQK A;  3UIT A;  4UDY X;  3DOB A;  3ZED A;  4HY9 A;  3GI7 A;  3OHX M;  3T48 A;  1SU6 A;  4EZU A;  3I04 A;  4EZV A;  2NCZ A;  2X5C A;  2YIA A;  4E3C A;  1SU7 A;  3SBT B;  3DQG A;  3DPQ A;  4PO2 A;  4R5K A;  4R5I A;  4IW0 A;  4F00 A;  3H0X A;  3QA8 A;  3VEB A;  4EZW A;  4EZP A;  2ND0 A;  2EX3 B;  2BPR A;  2Z8Y A;  4EZZ A;  1DG4 A;  3OWG A;  4ILG A;  3T46 A;  3ERC C;  4ILH B;  4I43 A;  1ZYL A;  1UPX A;  3T47 A;  4IM0 A;  4JL9 A;  4B9Q A;  4JWE A;  4KIK A;  1GNL A;  2EWF A;  3T49 A;  4MQD A;  2V7Y A;  4HR1 B;  4ILI A;  2N3K A;  4JLC A;  3N8E A;  3T4A G;  4JWI A;  4R5J A;  4G6Q A;  3B53 X;  1U00 A;  3O3N B;  3RV1 A;  1E9V A;  4JN4 A;  5E84 A;  4IWP A;  3QNJ A;  1DKX A;  1CKR A;  1OA0 A;  1Q5L A;  2KHO A;  3B51 X;  4F01 A;  3KDR A;  1SU8 A;  4EZR A;  4WV5 A;  3F7W A;  4JNE A;  4NPH A;  1GNT A;  2WIN M;  2GAF D;  3L3O M;  1SUF A;  4H6H A;  3DPP A;  3ER8 C;  3I01 A;  4FL9 A;  1W9M A;  2JNS A;  1DKY A;  3I39 X;  4D8J A;  4UDX X;  3KAW A;  4IWO A;  2ND1 A;  3FD9 A;  3D2F A;  3DPO A;  3B52 X;  4M0M A;  3ER9 B;  1E2U A;  1GN9 A;  3A98 A;  4E81 A;  4JNF A;  2YIV X;  4EZN A;  4R5L A;  3VKH A;  2GA9 D;  4EZQ A;  4IM2 A;  4EZS A;  4KIK B;  1MJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...