4EZZA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the designer peptide elplvki
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
218
structure length
218
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
molecule keywords Chaperone protein DnaK
total genus 69
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezzA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezzA01
4R5GA 4EZRA 2WINM 3D2FA 4E81A 3T49A 4R5IA 3DPPA 4WV7A 3DPOA 2BPRA 4R5LA 4EZVA 4HYBA 1BPRA 4WV5A 3L3OM 4JN4A 4EZTA 2KHOA 4HY9A 3QNJA 4JWDA 4JWEA 3T46A 3H0XA 4EZWA 2OP6A 4PO2A 2QXLA 4JWCA 3OHXM 3T4AG 2QFFA 3DPQA 4EZPA 3DOBA 4F00A 4FL9A 3D2EA 4JWIA 1Q5LA 2V7YA 1DG4A 4JNEA 4JNFA 4R5JA 4EZNA 1DKXA 4EZUA 4H6IA 7HSCA 3C7NB 3T48A 3T47A 1DKYA 1U00A 4R5KA 3DQGA 4H6HA 1CKRA 5E84A 4EZOA 4EZZA 4EZXA 4EZQA 3C7NA 4EZSA 1YUWA 3N8EA 4B9QA 4EZYA 5TKYA 4F01A 1DKZA
chains in the Genus database with same CATH superfamily
4DCNC 3QNIA 3CAZA 3SYVA 4E81A 3UITA 3ABHA 4NSWA 3SOGA 3F7WA 2ALWA 2JNSA 3DPOA 3DX3A 4EZVA 4D8JA 2Q13A 2BPRA 4ILHB 2F1BA 4HYBA 3I01A 1X03A 1HTYA 3L3OM 4EZTA 3CKDA 3T46A 3OWGA 1BPRA 2EX3B 4WV5A 3LMFA 3O3MB 4PO2A 4G6QA 3ERCC 3DOBA 3DX2A 1HXKA 3DPQA 4F00A 1OAOA 1TQSA 1TQWA 1O7DC 3BVVA 3BUBA 3D2EA 3D4ZA 2OW7A 3HAJA 3D4YA 1OA1A 1SU6A 4R5JA 4EZNA 2X3VA 7HSCA 4H6IA 3LVTA 3T48A 2F7OA 1O7DB 2PY6A 4FM3A 4MQDA 4AZBA 1I4TA 4JL9A 3CV5A 2WYHA 4R5KA 1CKRA 1R5EA 2YL8A 2OBMA 3HAIA 3QWEA 3RPMA 1YUWA 2X3WA 4B9QA 1E1DA 3B51X 2RT6A 3BVWA 5KBPA 1I4DA 3ZEDA 2OW6A 2YIBA 2X3XA 3DX4A 3Q84A 2FICA 2OZNB 4JLCA 2Q12A 4R5LA 4AZCA 3ER8C 4IWOA 4JN4A 3BVTA 5FLEX 3QNJA 2LXYA 5C5BB 4AKVA 2QXLA 1TQUA 2YIAA 4JWCA 4EZPA 2MI7A 4ILIA 1SU8A 3A98A 3BUPA 3DDFA 2ELBA 1MJGA 2OO2A 3GI7A 1W9MA 3M3WA 2OBLA 2YI9A 2RAJA 4JNFA 4M0MA 3I04A 3VEBA 1I49A 4AZHA 2EWFA 4H8SA 4ILGA 2O0I1 1ZWWA 5C5BA 4DYLA 2YL6A 3DQGA 4UDYX 4I43A 5E84A 4AZCB 4EZOA 1E9VA 2RAKA 3D50A 2Z0OA 3KAVA 1GNLA 4EZYA 1SU7A 4KIKB 3KDRA 3EJPA 3BVUA 4AZGA 4NPHA 2EFLA 1R34A 2RAIA 3CZSA 3O3OB 3QA8A 3DX0A 2WINM 4I1QA 4R5GA 2EFKA 4EZRA 4FL9A 3SBTB 1DG4A 4WV7A 3B52X 4AVMA 4WPCA 1PS3A 2F1AA 2GA9D 1URUA 2YLLA 3H0XA 2KHOA 5FIGA 1Q5LA 4EZWA 4IWPA 3DX1A 4AZ6A 2OP6A 1WDZA 3I39X 2NCZA 2QFFA 2YIVX 3EJSA 4JWIA 3Q0KA 4E3CA 2V7YA 4JNEA 1TQVA 1DKXA 2X5CA 2YLAA 2YI8A 3C7NB 1JQKA 1R33A 3ACOA 3CZNA 3EJRA 1GNTA 4IM3A 1OA0A 2LM0A 2YL5A 2D4CA 2WYIA 2Z0VA 2GF4A 3EJUA 3C7NA 4EZSA 3VKHA 3BUDA 3D52A 3SBSA 1HWWA 1QWNA 1E2UA 4HR1B 5TKYA 4FZOA 4NQIA 1TQTA 3RV0A 1Y2OA 2D1LA 1YWMA 3D2FA 3BLBA 4R5IA 3HAHA 1UPXA 2V0OA 3DPPA 3T49A 2GAFD 2F7RA 4ATMA 3KAWA 4IM0A 3D51A 3LLLA 2N3KA 2F18A 3DYTA 1LQ7A 3CVRA 3DDGA 2Z0NA 3EJQA 3BVXA 2F7QA 3EJTA 2ZXQA 4HY9A 4JWDA 4JWEA 1I4LA 1QWUA 1SUFA 4FZPA 2JNKA 4IM2A 3ZEFA 2PMRA 3OHXM 3RV1A 4HR1A 2QKWA 2ND1A 3T4AG 2C08A 4WPEA 4IWQA 4KIKA 3PLTA 4BNEA 3B53X 3FD9A 3QE6A 4EZUA 3OK8A 4AZ5A 2F7PA 1QX1A 3VEAA 3BUQA 4UDXX 3T47A 4AZ7A 1DKYA 3BUIA 1U00A 4FZSA 2Z8YA 4H6HA 1ZYLA 1GN9A 2YKTA 1X04A 3I2WA 4IW0A 3G9GA 2ND0A 3L3PA 4AZIA 2FYVA 4EZZA 3O3NB 4EZXA 4EZQA 3N8EA 3ER9B 2YL9A 4F01A 1DKZA
chains in the Genus database with same CATH topology
4E81A 3UITA 3F7WA 2JNSA 3DPOA 4D8JA 4ILHB 2BPRA 4WV5A 4EZVA 4HYBA 3I01A 1BPRA 3L3OM 4EZTA 3T46A 3OWGA 2EX3B 3LMFA 3O3MB 4PO2A 4G6QA 3ERCC 3DOBA 3DPQA 4F00A 1OAOA 4FL9A 3D2EA 4ILIA 1OA1A 1SU6A 4R5JA 4EZNA 7HSCA 4H6IA 3T48A 2PY6A 4FM3A 4MQDA 4JL9A 4R5KA 1CKRA 2OBMA 1YUWA 4B9QA 1E1DA 3B51X 2RT6A 3ZEDA 2YIBA 4JLCA 4R5LA 3ER8C 4IWOA 4JN4A 5FLEX 3QNJA 2QXLA 4JWCA 2YIAA 4EZPA 1SU8A 3A98A 1Q5LA 1MJGA 3GI7A 4E3CA 1W9MA 1DG4A 2OBLA 2YI9A 4JNFA 3VEBA 4M0MA 3I04A 4ILGA 2EWFA 3DQGA 4UDYX 4I43A 5E84A 4EZOA 1E9VA 3KAVA 1GNLA 4EZYA 1SU7A 4KIKB 3KDRA 4NPHA 4R5GA 3O3OB 3QA8A 4EZRA 2WINM 3SBTB 4WV7A 3B52X 2GA9D 3H0XA 2KHOA 5FIGA 4EZWA 4IWPA 2OP6A 3I39X 2NCZA 2QFFA 2YIVX 4JWIA 2V7YA 4JNEA 1DKXA 2X5CA 2YI8A 3C7NB 1JQKA 1GNTA 4IM3A 1OA0A 2LM0A 3VKHA 3C7NA 4EZSA 1E2UA 4HR1B 5TKYA 3RV0A 3D2FA 3T49A 4R5IA 1UPXA 3DPPA 2GAFD 3KAWA 4IM0A 2N3KA 4HY9A 4JWEA 4JWDA 3SBSA 3ZEFA 1SUFA 4IM2A 3OHXM 3RV1A 4HR1A 3T4AG 2ND1A 4IWQA 4KIKA 3B53X 3FD9A 4EZUA 3VEAA 4UDXX 3T47A 1DKYA 1U00A 2Z8YA 4H6HA 1ZYLA 1GN9A 4IW0A 4EZXA 4EZZA 4EZQA 2ND0A 3N8EA 3O3NB 3ER9B 4F01A 1DKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R5G A;  4EZR A;  2WIN M;  3D2F A;  4E81 A;  3T49 A;  4R5I A;  3DPP A;  4WV7 A;  3DPO A;  2BPR A;  4R5L A;  4EZV A;  4HYB A;  1BPR A;  4WV5 A;  3L3O M;  4JN4 A;  4EZT A;  2KHO A;  4HY9 A;  3QNJ A;  4JWD A;  4JWE A;  3T46 A;  3H0X A;  4EZW A;  2OP6 A;  4PO2 A;  2QXL A;  4JWC A;  3OHX M;  3T4A G;  2QFF A;  3DPQ A;  4EZP A;  3DOB A;  4F00 A;  4FL9 A;  3D2E A;  4JWI A;  1Q5L A;  2V7Y A;  1DG4 A;  4JNE A;  4JNF A;  4R5J A;  4EZN A;  1DKX A;  4EZU A;  4H6I A;  7HSC A;  3C7N B;  3T48 A;  3T47 A;  1DKY A;  1U00 A;  4R5K A;  3DQG A;  4H6H A;  1CKR A;  5E84 A;  4EZO A;  4EZZ A;  4EZX A;  4EZQ A;  3C7N A;  4EZS A;  1YUW A;  3N8E A;  4B9Q A;  4EZY A;  5TKY A;  4F01 A;  1DKZ A; 
#chains in the Genus database with same CATH topology
 4DCN C;  3QNI A;  3CAZ A;  3SYV A;  4E81 A;  3UIT A;  3ABH A;  4NSW A;  3SOG A;  3F7W A;  2ALW A;  2JNS A;  3DPO A;  3DX3 A;  4EZV A;  4D8J A;  2Q13 A;  2BPR A;  4ILH B;  2F1B A;  4HYB A;  3I01 A;  1X03 A;  1HTY A;  3L3O M;  4EZT A;  3CKD A;  3T46 A;  3OWG A;  1BPR A;  2EX3 B;  4WV5 A;  3LMF A;  3O3M B;  4PO2 A;  4G6Q A;  3ERC C;  3DOB A;  3DX2 A;  1HXK A;  3DPQ A;  4F00 A;  1OAO A;  1TQS A;  1TQW A;  1O7D C;  3BVV A;  3BUB A;  3D2E A;  3D4Z A;  2OW7 A;  3HAJ A;  3D4Y A;  1OA1 A;  1SU6 A;  4R5J A;  4EZN A;  2X3V A;  7HSC A;  4H6I A;  3LVT A;  3T48 A;  2F7O A;  1O7D B;  2PY6 A;  4FM3 A;  4MQD A;  4AZB A;  1I4T A;  4JL9 A;  3CV5 A;  2WYH A;  4R5K A;  1CKR A;  1R5E A;  2YL8 A;  2OBM A;  3HAI A;  3QWE A;  3RPM A;  1YUW A;  2X3W A;  4B9Q A;  1E1D A;  3B51 X;  2RT6 A;  3BVW A;  5KBP A;  1I4D A;  3ZED A;  2OW6 A;  2YIB A;  2X3X A;  3DX4 A;  3Q84 A;  2FIC A;  2OZN B;  4JLC A;  2Q12 A;  4R5L A;  4AZC A;  3ER8 C;  4IWO A;  4JN4 A;  3BVT A;  5FLE X;  3QNJ A;  2LXY A;  5C5B B;  4AKV A;  2QXL A;  1TQU A;  2YIA A;  4JWC A;  4EZP A;  2MI7 A;  4ILI A;  1SU8 A;  3A98 A;  3BUP A;  3DDF A;  2ELB A;  1MJG A;  2OO2 A;  3GI7 A;  1W9M A;  3M3W A;  2OBL A;  2YI9 A;  2RAJ A;  4JNF A;  4M0M A;  3I04 A;  3VEB A;  1I49 A;  4AZH A;  2EWF A;  4H8S A;  4ILG A;  2O0I 1;  1ZWW A;  5C5B A;  4DYL A;  2YL6 A;  3DQG A;  4UDY X;  4I43 A;  5E84 A;  4AZC B;  4EZO A;  1E9V A;  2RAK A;  3D50 A;  2Z0O A;  3KAV A;  1GNL A;  4EZY A;  1SU7 A;  4KIK B;  3KDR A;  3EJP A;  3BVU A;  4AZG A;  4NPH A;  2EFL A;  1R34 A;  2RAI A;  3CZS A;  3O3O B;  3QA8 A;  3DX0 A;  2WIN M;  4I1Q A;  4R5G A;  2EFK A;  4EZR A;  4FL9 A;  3SBT B;  1DG4 A;  4WV7 A;  3B52 X;  4AVM A;  4WPC A;  1PS3 A;  2F1A A;  2GA9 D;  1URU A;  2YLL A;  3H0X A;  2KHO A;  5FIG A;  1Q5L A;  4EZW A;  4IWP A;  3DX1 A;  4AZ6 A;  2OP6 A;  1WDZ A;  3I39 X;  2NCZ A;  2QFF A;  2YIV X;  3EJS A;  4JWI A;  3Q0K A;  4E3C A;  2V7Y A;  4JNE A;  1TQV A;  1DKX A;  2X5C A;  2YLA A;  2YI8 A;  3C7N B;  1JQK A;  1R33 A;  3ACO A;  3CZN A;  3EJR A;  1GNT A;  4IM3 A;  1OA0 A;  2LM0 A;  2YL5 A;  2D4C A;  2WYI A;  2Z0V A;  2GF4 A;  3EJU A;  3C7N A;  4EZS A;  3VKH A;  3BUD A;  3D52 A;  3SBS A;  1HWW A;  1QWN A;  1E2U A;  4HR1 B;  5TKY A;  4FZO A;  4NQI A;  1TQT A;  3RV0 A;  1Y2O A;  2D1L A;  1YWM A;  3D2F A;  3BLB A;  4R5I A;  3HAH A;  1UPX A;  2V0O A;  3DPP A;  3T49 A;  2GAF D;  2F7R A;  4ATM A;  3KAW A;  4IM0 A;  3D51 A;  3LLL A;  2N3K A;  2F18 A;  3DYT A;  1LQ7 A;  3CVR A;  3DDG A;  2Z0N A;  3EJQ A;  3BVX A;  2F7Q A;  3EJT A;  2ZXQ A;  4HY9 A;  4JWD A;  4JWE A;  1I4L A;  1QWU A;  1SUF A;  4FZP A;  2JNK A;  4IM2 A;  3ZEF A;  2PMR A;  3OHX M;  3RV1 A;  4HR1 A;  2QKW A;  2ND1 A;  3T4A G;  2C08 A;  4WPE A;  4IWQ A;  4KIK A;  3PLT A;  4BNE A;  3B53 X;  3FD9 A;  3QE6 A;  4EZU A;  3OK8 A;  4AZ5 A;  2F7P A;  1QX1 A;  3VEA A;  3BUQ A;  4UDX X;  3T47 A;  4AZ7 A;  1DKY A;  3BUI A;  1U00 A;  4FZS A;  2Z8Y A;  4H6H A;  1ZYL A;  1GN9 A;  2YKT A;  1X04 A;  3I2W A;  4IW0 A;  3G9G A;  2ND0 A;  3L3P A;  4AZI A;  2FYV A;  4EZZ A;  3O3N B;  4EZX A;  4EZQ A;  3N8E A;  3ER9 B;  2YL9 A;  4F01 A;  1DKZ A; 
#chains in the Genus database with same CATH homology
 4E81 A;  3UIT A;  3F7W A;  2JNS A;  3DPO A;  4D8J A;  4ILH B;  2BPR A;  4WV5 A;  4EZV A;  4HYB A;  3I01 A;  1BPR A;  3L3O M;  4EZT A;  3T46 A;  3OWG A;  2EX3 B;  3LMF A;  3O3M B;  4PO2 A;  4G6Q A;  3ERC C;  3DOB A;  3DPQ A;  4F00 A;  1OAO A;  4FL9 A;  3D2E A;  4ILI A;  1OA1 A;  1SU6 A;  4R5J A;  4EZN A;  7HSC A;  4H6I A;  3T48 A;  2PY6 A;  4FM3 A;  4MQD A;  4JL9 A;  4R5K A;  1CKR A;  2OBM A;  1YUW A;  4B9Q A;  1E1D A;  3B51 X;  2RT6 A;  3ZED A;  2YIB A;  4JLC A;  4R5L A;  3ER8 C;  4IWO A;  4JN4 A;  5FLE X;  3QNJ A;  2QXL A;  4JWC A;  2YIA A;  4EZP A;  1SU8 A;  3A98 A;  1Q5L A;  1MJG A;  3GI7 A;  4E3C A;  1W9M A;  1DG4 A;  2OBL A;  2YI9 A;  4JNF A;  3VEB A;  4M0M A;  3I04 A;  4ILG A;  2EWF A;  3DQG A;  4UDY X;  4I43 A;  5E84 A;  4EZO A;  1E9V A;  3KAV A;  1GNL A;  4EZY A;  1SU7 A;  4KIK B;  3KDR A;  4NPH A;  4R5G A;  3O3O B;  3QA8 A;  4EZR A;  2WIN M;  3SBT B;  4WV7 A;  3B52 X;  2GA9 D;  3H0X A;  2KHO A;  5FIG A;  4EZW A;  4IWP A;  2OP6 A;  3I39 X;  2NCZ A;  2QFF A;  2YIV X;  4JWI A;  2V7Y A;  4JNE A;  1DKX A;  2X5C A;  2YI8 A;  3C7N B;  1JQK A;  1GNT A;  4IM3 A;  1OA0 A;  2LM0 A;  3VKH A;  3C7N A;  4EZS A;  1E2U A;  4HR1 B;  5TKY A;  3RV0 A;  3D2F A;  3T49 A;  4R5I A;  1UPX A;  3DPP A;  2GAF D;  3KAW A;  4IM0 A;  2N3K A;  4HY9 A;  4JWE A;  4JWD A;  3SBS A;  3ZEF A;  1SUF A;  4IM2 A;  3OHX M;  3RV1 A;  4HR1 A;  3T4A G;  2ND1 A;  4IWQ A;  4KIK A;  3B53 X;  3FD9 A;  4EZU A;  3VEA A;  4UDX X;  3T47 A;  1DKY A;  1U00 A;  2Z8Y A;  4H6H A;  1ZYL A;  1GN9 A;  4IW0 A;  4EZX A;  4EZZ A;  4EZQ A;  2ND0 A;  3N8E A;  3O3N B;  3ER9 B;  4F01 A;  1DKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...