4F01A

Crystal structure of an artificial dimeric dnak complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
GRHMVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
molecule keywords Chaperone protein DnaK
total genus 67
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4f01A02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4f01A01
4R5JA 4R5GA 4PO2A 4R5KA 3T48A 3DPPA 4F01A 4F00A 4H6HA 5TKYA 4EZPA 4JWCA 3C7NA 3D2EA 4H6IA 3T46A 4E81A 2OP6A 1YUWA 3DOBA 1DKXA 1DKYA 4B9QA 7HSCA 4EZOA 4EZVA 4EZQA 3L3OM 3QNJA 4WV7A 4HY9A 4EZRA 1DG4A 4EZSA 4JWDA 4R5IA 1BPRA 3T4AG 1CKRA 3H0XA 4JWIA 3T47A 2BPRA 3DQGA 1U00A 4EZZA 2V7YA 4WV5A 4HYBA 2KHOA 4FL9A 2WINM 3OHXM 4EZUA 3DPOA 4EZNA 4JNFA 5E84A 4EZXA 3C7NB 4EZYA 3N8EA 4R5LA 2QFFA 1Q5LA 4JNEA 3D2FA 2QXLA 3DPQA 4EZWA 4JWEA 4EZTA 4JN4A 1DKZA 3T49A
chains in the Genus database with same CATH superfamily
4R5GA 4PO2A 3PLTA 4F01A 3VKHA 2F7QA 1I49A 3BVTA 2ELBA 2F7RA 3BVWA 4IM3A 1SU7A 3T46A 2WYIA 4UDXX 1ZWWA 1DKYA 4B9QA 4MQDA 4EZOA 3BVVA 1UPXA 1R5EA 2F1BA 2EFKA 2GAFD 3BUPA 3I01A 4AZHA 4WV7A 2Z0OA 4HY9A 3SBTB 1TQWA 1QWUA 1E9VA 2ND1A 2YIBA 4AZ5A 4M0MA 1OA0A 1PS3A 2YI9A 3T47A 1U00A 4ILHB 3EJSA 3CZNA 2YI8A 2YL9A 2KHOA 3RV1A 3HAHA 3QE6A 2OW6A 2WINM 4IW0A 1X04A 2LM0A 2RAIA 3CAZA 1E1DA 1O7DC 3DPOA 1HTYA 3EJRA 4IWPA 4JNFA 4NSWA 4UDYX 4WPEA 4JLCA 3CV5A 3N8EA 1Q5LA 3DX2A 2MI7A 2QXLA 1I4TA 4BNEA 1R33A 3FD9A 3ZEFA 1JQKA 2OW7A 2YL5A 4JN4A 2RAJA 3UITA 4R5JA 2YKTA 4R5KA 4HR1B 3DPPA 2PMRA 4AKVA 1GN9A 2C08A 3A98A 4AZCA 2LXYA 4H6HA 3M3WA 2FYVA 1URUA 2OO2A 3DDFA 3G9GA 4FZSA 3L3PA 5FIGA 1HWWA 3Q84A 1Y2OA 1DKXA 5KBPA 4KIKB 4EZQA 4ILIA 1O7DB 4HR1A 4IWQA 4DCNC 4EZSA 1WDZA 1QWNA 2ND0A 2Q13A 3SYVA 2EFLA 4E3CA 3H0XA 1HXKA 1R34A 3KAVA 3I04A 2BPRA 4FZOA 5C5BB 2EX3B 2V7YA 3DQGA 2OBLA 2FICA 4WV5A 3QNIA 3DX3A 4IM0A 2GA9D 3C7NB 2D4CA 4D8JA 2OP6A 4AZCB 2YIVX 1SU8A 1X03A 2F7PA 2O0I1 2PY6A 2YL6A 2NCZA 2QFFA 2YL8A 3EJUA 3KAWA 4I1QA 1OA1A 4R5LA 3DX0A 5C5BA 3BUDA 2YIAA 4JWEA 1DKZA 3B52X 4JL9A 2ALWA 3T49A 3T48A 3KDRA 4F00A 4I43A 3BUIA 3C7NA 4JWCA 4H6IA 4AZIA 3D52A 2JNKA 1TQSA 1I4LA 2ZXQA 3LVTA 4IM2A 1YWMA 4WPCA 3VEAA 3DYTA 3EJTA 4AVMA 1TQTA 1ZYLA 2F18A 1OAOA 2Z8YA 4FZPA 4R5IA 3O3MB 1W9MA 1QX1A 2RT6A 2N3KA 3T4AG 1BPRA 4ILGA 2V0OA 3OK8A 2X3XA 3ACOA 1CKRA 3BUBA 3D4ZA 3O3NB 3OWGA 1GNLA 1SU6A 2WYHA 3HAIA 5FLEX 3RPMA 4EZZA 3ER8C 4HYBA 2F1AA 2X5CA 2YLLA 1TQVA 4EZNA 1E2UA 3B51X 4H8SA 4AZ7A 1I4DA 3DX1A 4NQIA 3I2WA 4JNEA 3D2FA 3O3OB 3ERCC 1SUFA 3DPQA 4FL9A 2OZNB 2Z0VA 4IWOA 2X3WA 3DX4A 2GF4A 3QA8A 3BUQA 4AZGA 4NPHA 5TKYA 2OBMA 2Z0NA 4KIKA 3D2EA 3HAJA 4EZPA 4E81A 3DOBA 1YUWA 3SBSA 4AZBA 3D50A 3D51A 3ABHA 7HSCA 2F7OA 3CVRA 4EZVA 3L3OM 2YLAA 1MJGA 3QNJA 4EZRA 1DG4A 3EJPA 3BVUA 4JWDA 3ER9B 3Q0KA 2EWFA 4JWIA 3EJQA 4G6QA 3B53X 3QWEA 4ATMA 3LMFA 1TQUA 3I39X 3VEBA 4AZ6A 2Q12A 3LLLA 3D4YA 3CKDA 2D1LA 3GI7A 3OHXM 4FM3A 3RV0A 5E84A 4EZUA 4EZXA 4DYLA 3ZEDA 2X3VA 3F7WA 1LQ7A 1GNTA 2JNSA 2RAKA 3SOGA 4EZYA 3BVXA 3BLBA 2QKWA 4EZWA 4EZTA 3CZSA 3DDGA
chains in the Genus database with same CATH topology
4R5GA 4PO2A 4F01A 3VKHA 4IM3A 1SU7A 3T46A 4UDXX 1DKYA 4B9QA 4MQDA 4EZOA 1UPXA 3I01A 2GAFD 4WV7A 4HY9A 1E9VA 2ND1A 2YIBA 4M0MA 1OA0A 3T47A 2YI9A 4ILHB 1U00A 2YI8A 2KHOA 3RV1A 4IW0A 2WINM 3DPOA 2LM0A 3RV0A 4JNFA 1E1DA 4E3CA 3VEAA 4IWPA 4UDYX 4JLCA 3N8EA 1Q5LA 2QXLA 3ZEFA 3FD9A 1JQKA 4JN4A 3UITA 4R5JA 4R5KA 4HR1B 3DPPA 1GN9A 3A98A 4H6HA 2OP6A 5FIGA 1DKXA 4KIKB 4EZQA 4ILIA 4HR1A 4IWQA 4EZSA 2ND0A 3H0XA 3KAVA 2BPRA 3I04A 2V7YA 3DQGA 2EX3B 4WV5A 2OBLA 4IM0A 2GA9D 3C7NB 4D8JA 2YIVX 1SU8A 2PY6A 3KAWA 3ZEDA 4R5LA 2NCZA 2QFFA 1OA1A 4JWEA 2YIAA 3B52X 1DKZA 4JL9A 3T49A 3T48A 3KDRA 4F00A 4I43A 4JWCA 3C7NA 4H6IA 4IM2A 1ZYLA 1OAOA 2Z8YA 4R5IA 3O3MB 1W9MA 2RT6A 3T4AG 2N3KA 1BPRA 1CKRA 4ILGA 3SBTB 3O3NB 3OWGA 1GNLA 1SU6A 4EZZA 5FLEX 3ER8C 4HYBA 2X5CA 4EZNA 1E2UA 3B51X 4JNEA 3D2FA 3O3OB 3ERCC 1SUFA 3DPQA 4FL9A 4IWOA 3QA8A 4NPHA 5TKYA 2OBMA 4KIKA 4EZPA 3D2EA 3DOBA 4E81A 3SBSA 1YUWA 7HSCA 4EZVA 3L3OM 3QNJA 1MJGA 4EZRA 1DG4A 4JWDA 3ER9B 2EWFA 4JWIA 4G6QA 3B53X 3LMFA 3I39X 3VEBA 4EZUA 3GI7A 3OHXM 4FM3A 4EZXA 5E84A 3F7WA 4EZYA 1GNTA 2JNSA 4EZWA 4EZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R5J A;  4R5G A;  4PO2 A;  4R5K A;  3T48 A;  3DPP A;  4F01 A;  4F00 A;  4H6H A;  5TKY A;  4EZP A;  4JWC A;  3C7N A;  3D2E A;  4H6I A;  3T46 A;  4E81 A;  2OP6 A;  1YUW A;  3DOB A;  1DKX A;  1DKY A;  4B9Q A;  7HSC A;  4EZO A;  4EZV A;  4EZQ A;  3L3O M;  3QNJ A;  4WV7 A;  4HY9 A;  4EZR A;  1DG4 A;  4EZS A;  4JWD A;  4R5I A;  1BPR A;  3T4A G;  1CKR A;  3H0X A;  4JWI A;  3T47 A;  2BPR A;  3DQG A;  1U00 A;  4EZZ A;  2V7Y A;  4WV5 A;  4HYB A;  2KHO A;  4FL9 A;  2WIN M;  3OHX M;  4EZU A;  3DPO A;  4EZN A;  4JNF A;  5E84 A;  4EZX A;  3C7N B;  4EZY A;  3N8E A;  4R5L A;  2QFF A;  1Q5L A;  4JNE A;  3D2F A;  2QXL A;  3DPQ A;  4EZW A;  4JWE A;  4EZT A;  4JN4 A;  1DKZ A;  3T49 A; 
#chains in the Genus database with same CATH topology
 4R5G A;  4PO2 A;  3PLT A;  4F01 A;  3VKH A;  2F7Q A;  1I49 A;  3BVT A;  2ELB A;  2F7R A;  3BVW A;  4IM3 A;  1SU7 A;  3T46 A;  2WYI A;  4UDX X;  1ZWW A;  1DKY A;  4B9Q A;  4MQD A;  4EZO A;  3BVV A;  1UPX A;  1R5E A;  2F1B A;  2EFK A;  2GAF D;  3BUP A;  3I01 A;  4AZH A;  4WV7 A;  2Z0O A;  4HY9 A;  3SBT B;  1TQW A;  1QWU A;  1E9V A;  2ND1 A;  2YIB A;  4AZ5 A;  4M0M A;  1OA0 A;  1PS3 A;  2YI9 A;  3T47 A;  1U00 A;  4ILH B;  3EJS A;  3CZN A;  2YI8 A;  2YL9 A;  2KHO A;  3RV1 A;  3HAH A;  3QE6 A;  2OW6 A;  2WIN M;  4IW0 A;  1X04 A;  2LM0 A;  2RAI A;  3CAZ A;  1E1D A;  1O7D C;  3DPO A;  1HTY A;  3EJR A;  4IWP A;  4JNF A;  4NSW A;  4UDY X;  4WPE A;  4JLC A;  3CV5 A;  3N8E A;  1Q5L A;  3DX2 A;  2MI7 A;  2QXL A;  1I4T A;  4BNE A;  1R33 A;  3FD9 A;  3ZEF A;  1JQK A;  2OW7 A;  2YL5 A;  4JN4 A;  2RAJ A;  3UIT A;  4R5J A;  2YKT A;  4R5K A;  4HR1 B;  3DPP A;  2PMR A;  4AKV A;  1GN9 A;  2C08 A;  3A98 A;  4AZC A;  2LXY A;  4H6H A;  3M3W A;  2FYV A;  1URU A;  2OO2 A;  3DDF A;  3G9G A;  4FZS A;  3L3P A;  5FIG A;  1HWW A;  3Q84 A;  1Y2O A;  1DKX A;  5KBP A;  4KIK B;  4EZQ A;  4ILI A;  1O7D B;  4HR1 A;  4IWQ A;  4DCN C;  4EZS A;  1WDZ A;  1QWN A;  2ND0 A;  2Q13 A;  3SYV A;  2EFL A;  4E3C A;  3H0X A;  1HXK A;  1R34 A;  3KAV A;  3I04 A;  2BPR A;  4FZO A;  5C5B B;  2EX3 B;  2V7Y A;  3DQG A;  2OBL A;  2FIC A;  4WV5 A;  3QNI A;  3DX3 A;  4IM0 A;  2GA9 D;  3C7N B;  2D4C A;  4D8J A;  2OP6 A;  4AZC B;  2YIV X;  1SU8 A;  1X03 A;  2F7P A;  2O0I 1;  2PY6 A;  2YL6 A;  2NCZ A;  2QFF A;  2YL8 A;  3EJU A;  3KAW A;  4I1Q A;  1OA1 A;  4R5L A;  3DX0 A;  5C5B A;  3BUD A;  2YIA A;  4JWE A;  1DKZ A;  3B52 X;  4JL9 A;  2ALW A;  3T49 A;  3T48 A;  3KDR A;  4F00 A;  4I43 A;  3BUI A;  3C7N A;  4JWC A;  4H6I A;  4AZI A;  3D52 A;  2JNK A;  1TQS A;  1I4L A;  2ZXQ A;  3LVT A;  4IM2 A;  1YWM A;  4WPC A;  3VEA A;  3DYT A;  3EJT A;  4AVM A;  1TQT A;  1ZYL A;  2F18 A;  1OAO A;  2Z8Y A;  4FZP A;  4R5I A;  3O3M B;  1W9M A;  1QX1 A;  2RT6 A;  2N3K A;  3T4A G;  1BPR A;  4ILG A;  2V0O A;  3OK8 A;  2X3X A;  3ACO A;  1CKR A;  3BUB A;  3D4Z A;  3O3N B;  3OWG A;  1GNL A;  1SU6 A;  2WYH A;  3HAI A;  5FLE X;  3RPM A;  4EZZ A;  3ER8 C;  4HYB A;  2F1A A;  2X5C A;  2YLL A;  1TQV A;  4EZN A;  1E2U A;  3B51 X;  4H8S A;  4AZ7 A;  1I4D A;  3DX1 A;  4NQI A;  3I2W A;  4JNE A;  3D2F A;  3O3O B;  3ERC C;  1SUF A;  3DPQ A;  4FL9 A;  2OZN B;  2Z0V A;  4IWO A;  2X3W A;  3DX4 A;  2GF4 A;  3QA8 A;  3BUQ A;  4AZG A;  4NPH A;  5TKY A;  2OBM A;  2Z0N A;  4KIK A;  3D2E A;  3HAJ A;  4EZP A;  4E81 A;  3DOB A;  1YUW A;  3SBS A;  4AZB A;  3D50 A;  3D51 A;  3ABH A;  7HSC A;  2F7O A;  3CVR A;  4EZV A;  3L3O M;  2YLA A;  1MJG A;  3QNJ A;  4EZR A;  1DG4 A;  3EJP A;  3BVU A;  4JWD A;  3ER9 B;  3Q0K A;  2EWF A;  4JWI A;  3EJQ A;  4G6Q A;  3B53 X;  3QWE A;  4ATM A;  3LMF A;  1TQU A;  3I39 X;  3VEB A;  4AZ6 A;  2Q12 A;  3LLL A;  3D4Y A;  3CKD A;  2D1L A;  3GI7 A;  3OHX M;  4FM3 A;  3RV0 A;  5E84 A;  4EZU A;  4EZX A;  4DYL A;  3ZED A;  2X3V A;  3F7W A;  1LQ7 A;  1GNT A;  2JNS A;  2RAK A;  3SOG A;  4EZY A;  3BVX A;  3BLB A;  2QKW A;  4EZW A;  4EZT A;  3CZS A;  3DDG A; 
#chains in the Genus database with same CATH homology
 4R5G A;  4PO2 A;  4F01 A;  3VKH A;  4IM3 A;  1SU7 A;  3T46 A;  4UDX X;  1DKY A;  4B9Q A;  4MQD A;  4EZO A;  1UPX A;  3I01 A;  2GAF D;  4WV7 A;  4HY9 A;  1E9V A;  2ND1 A;  2YIB A;  4M0M A;  1OA0 A;  3T47 A;  2YI9 A;  4ILH B;  1U00 A;  2YI8 A;  2KHO A;  3RV1 A;  4IW0 A;  2WIN M;  3DPO A;  2LM0 A;  3RV0 A;  4JNF A;  1E1D A;  4E3C A;  3VEA A;  4IWP A;  4UDY X;  4JLC A;  3N8E A;  1Q5L A;  2QXL A;  3ZEF A;  3FD9 A;  1JQK A;  4JN4 A;  3UIT A;  4R5J A;  4R5K A;  4HR1 B;  3DPP A;  1GN9 A;  3A98 A;  4H6H A;  2OP6 A;  5FIG A;  1DKX A;  4KIK B;  4EZQ A;  4ILI A;  4HR1 A;  4IWQ A;  4EZS A;  2ND0 A;  3H0X A;  3KAV A;  2BPR A;  3I04 A;  2V7Y A;  3DQG A;  2EX3 B;  4WV5 A;  2OBL A;  4IM0 A;  2GA9 D;  3C7N B;  4D8J A;  2YIV X;  1SU8 A;  2PY6 A;  3KAW A;  3ZED A;  4R5L A;  2NCZ A;  2QFF A;  1OA1 A;  4JWE A;  2YIA A;  3B52 X;  1DKZ A;  4JL9 A;  3T49 A;  3T48 A;  3KDR A;  4F00 A;  4I43 A;  4JWC A;  3C7N A;  4H6I A;  4IM2 A;  1ZYL A;  1OAO A;  2Z8Y A;  4R5I A;  3O3M B;  1W9M A;  2RT6 A;  3T4A G;  2N3K A;  1BPR A;  1CKR A;  4ILG A;  3SBT B;  3O3N B;  3OWG A;  1GNL A;  1SU6 A;  4EZZ A;  5FLE X;  3ER8 C;  4HYB A;  2X5C A;  4EZN A;  1E2U A;  3B51 X;  4JNE A;  3D2F A;  3O3O B;  3ERC C;  1SUF A;  3DPQ A;  4FL9 A;  4IWO A;  3QA8 A;  4NPH A;  5TKY A;  2OBM A;  4KIK A;  4EZP A;  3D2E A;  3DOB A;  4E81 A;  3SBS A;  1YUW A;  7HSC A;  4EZV A;  3L3O M;  3QNJ A;  1MJG A;  4EZR A;  1DG4 A;  4JWD A;  3ER9 B;  2EWF A;  4JWI A;  4G6Q A;  3B53 X;  3LMF A;  3I39 X;  3VEB A;  4EZU A;  3GI7 A;  3OHX M;  4FM3 A;  4EZX A;  5E84 A;  3F7W A;  4EZY A;  1GNT A;  2JNS A;  4EZW A;  4EZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...