4F4IA

Crystal structure of thymidylate kinase from staphylococcus aureus in apo-form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
204
structure length
193
Chain Sequence
b'MSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIDQEDLKFHEKVIEGYQEIIHSQRFKSVNADQPLENVVEDTYQTIIKYLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in apo-form
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
total genus 74
structure length 193
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4f4iA00
2FZ4A 1N0VC 2KBFA 2QGZA 3LVQE 4QL3A 4Q1AA 1CKEA 2A2ZA 2QAJA 2DY1A 2CEAA 2GBLC 4H9GA 1COWA 1BS1A 2RCNA 1FMLA 1PUIA 1E2HA 5DHFA 2VA8A 3FFAA 2P5TB 4URXR 4M21A 2EVWX 1A7JA 3ZZ0A 1R8QA 3TR0A 3CF2A 4LY6A 1G8PA 4XWOA 4HB3A 1XXHB 2ZI3A 1ELOA 3K0FA 1IQPA 2RGNA 4WA7A 3IDQA 2O0HA 4B44A 2D7CA 3MSXA 3U3KA 1AIPA 3RRNA 2ZVQX 3ND9A 4Q4AB 1AS0A 3SNHA 3U44A 4DDTA 1E1QA 4LSGA 2OLJA 1LV7A 4QG7A 5DNYB 2XXAA 5C46F 3EC1A 4D82A 1N6RA 3LXXA 5AUQA 1C4OA 4CZ2A 1KOFA 3RVBA 4HLCA 1GG2A 1TX4B 5JCZA 2F55A 3QKRB 4YONB 4KSCA 1KK3A 2BMDA 1II0A 2H92A 2RB4A 2CLCX 4M9ZA 2CDNA 1CXZA 4DSOA 5KDDA 3NTUA 2GDJA 721PA 4ARZA 2C99A 2GBLA 3OEED 2ZI7A 1G21E 4JZKA 3GLHB 2P6RA 1IN5A 4OL0A 3OIWA 2QG6A 3FMOB 5FFMA 2QT0A 3KQUA 2HF9A 2BV3A 4TYNA 1OJLA 1GNRA 1HTWA 4M1SA 4MRRA 2PJZA 2JJ2A 4CW7A 3SZRA 2GWHA 2VLIA 3JVUA 3TKLA 1OW3B 3NIBA 4MGZR 3IQXA 4JL6A 1NN0A 2PCJA 2FPMA 4JKYA 5A0FA 4MGIR 3AUYA 1E2EA 1G5TA 2GJ9A 2RGDA 2WAXA 2GJKA 5FOSA 1G64A 1AZSC 1ZUIA 1R7RA 2BMJA 2EFGA 2PT5A 3LY5A 4L16A 5BW8A 2F1IA 1KMQA 2AD1A 2ZAMA 4TLBA 4LJ4A 3WBJA 4QXAA 3N2EA 3DEFA 3CNOA 4OQFA 3G5UA 3BH7A 4PXAA 2VHQA 2D2EA 5J4VA 1NN5A 2JLSA 2AD5A 5EUQB 5FBRB 2R8RA 4DB4A 4I1OA 3WRXC 4FI3C 2BM1A 1X3SA 1XBTA 2NO0A 4WVFA 1EESA 5EE0A 3VU9A 2J87A 1DARA 2HJVA 4BFSA 4W5JA 1II9A 2IYRA 4GNKA 3O47A 3PV0A 1Z0JA 3REFA 5FPSA 2IS2A 1WF3A 3W6OA 1IM2A 5JEDA 1YZNA 4NKRA 4YMSA 2R44A 2ZYWX 2REBA 3F5FA 4YDSA 3WMEA 1D2EA 4MKIA 1I4LD 2ZS9A 4IEIA 1WB9A 1JQJC 5B57C 1J70A 2F3RA 1TQ6A 2ZUCA 3RRMA 2AKYA 1GVNB 2GAOA 2NG1A 4DSTA 3KQLA 1TQ2A 4TL7A 3TNFA 4DLZA 2QQ0A 1XPOA 1PV4A 2WKPA 2BOVA 4Q7JB 3V00A 4RD6A 3NG1A 3Q72A 2XOKA 2ZE7A 5LPNA 4GL2A 1KKLA 2H17A 3E2IA 5TARA 3NC1C 4US2R 3TE6A 4QGAA 4LJ9A 2FA9A 1XWIA 1AGPA 2QT1A 3ZS8A 4EPRA 3ZZUA 1W0JA 3NH9A 1XTJA 2PMKA 3A1WA 3DZ8A 4B76A 2IW3A 2IYXA 3R9WA 1NJFA 2QRZA 4A82A 1ZCBA 3LD9A 4LHVA 2W83A 1E0JA 1ESMA 4WIAA 3SI7A 2FOLA 4I4LA 3U61B 2J9RA 5GADl 1DTSA 5TMPA 1BIFA 1V43A 2W0SA 1QHSA 2G3YA 4Z1MA 2FE4A 3I61A 2F43B 2DFTA 1EFCA 2R9VA 4PAMA 1W36B 2XNDA 1Z6YA 2EU8A 4OI4A 3SEAA 3THXA 1E9RA 1YZGA 4A0GA 4B33A 4TMTA 3UMRA 2JLVA 4JLVA 1G18A 2WVJA 2XZOA 4ACAA 3DM5A 3FMIA 4TT3D 5CITA 1VHTA 1A2BA 4EPTA 1ZNYA 3SU8A 1JBKA 1DG1G 1OF1A 5EXSA 3ADBA 1XTKA 2F7SA 4IDNA 5FTLA 4ZKDA 3PEVA 4Q4HA 4PSAA 4IJMA 3H4MA 1OKKD 1QG4A 5L3QB 1T9HA 4MYUA 3WXMA 4BGDA 1KSHA 2JAQA 4JKIA 1E2QA 3GFOA 4DDWA 1DAEA 3GPLA 2V6IA 1ZCAA 3SN6A 3DDCA 3V4RA 4FIDA 2X2FA 1T4GA 2Z5FA 3MWYW 2GXQA 4P4TA 1Z6GA 4HB0A 3CRQA 4MYCA 2IS4A 1LVGA 4Q9IA 1R0YA 4KI0A 4TQUS 4PZYA 3MWJA 3NBZC 1XNJA 2BHRA 4B2PA 4C2TA 3UWOA 1Q12A 3LNCA 3I62A 3FDIA 1OHHA 3GLIE 2ZUDA 3MRSA 4Q1EA 3LV8A 3NBFA 2IYVA 3IO5A 1WBBA 1XPUA 2E9SA 4LBZA 4DT1A 4D4JA 1P3JA 3W90A 1W2GA 4KLNA 4LGMA 1Z6XA 2FG5A 4QOSA 4TZ0A 1OH6A 4CIDA 1IXSB 4LJ7A 3PVSA 4OHWA 3GMTA 3RS2A 3GEEA 2G0TA 2BWJA 4FMDF 1E0KA 1AK2A 1EFTA 4JLKA 3GJ5A 3OESA 4BZQA 1RRGA 3TQCA 1G3MA 1GILA 1E4YA 4W5HA 1T3HA 2FFBA 2GKSA 2QSZA 1DVRA 5D3MB 1S1MA 2V9PA 2FEMA 4PR0A 2A7QA 2H7VA 1NY5A 2NO6A 3AF1A 1KO7A 3W34A 2ZJ8A 4ZIRA 2G1JA 2ZRJA 1HH4A 2B7BA 4K46A 4PSVA 5KSOA 5L8VA 1EG7A 1M7HA 3L0SA 4ZCMA 2B92A 2QRNA 1SHKA 4EPWA 4E07A 3W3AA 4D4LA 4BFUA 2J0UA 4WW0A 3VNVA 3Q5EA 3UG7A 1MT0A 3FMPB 4XVUA 3BB1A 4C4PA 4F38A 3ZS9A 4NCJA 4RCZA 4UXHA 3B60A 1Z06A 3BFXA 1CJKC 4B6FA 1RJ9A 2KWIA 3TVDA 5A4JA 2DFKB 5D3QA 1ONBA 1SZPA 4IXMA 2NIPA 1KYIA 2I4IA 2Z4RA 3BWDD 3CH5A 4US1R 1NVXQ 5EP1A 5GJBA 3MAAC 4A0FA 2HF8A 2HYIC 3RC8A 2Z0MA 4NCIA 1M6NA 4B71A 2YWGA 4NYJR 1KJWA 1G7CA 3M6AA 4DCUA 3X1DA 1GNPA 2IX3A 1F2UB 1VG9B 3Q85A 4JBWA 1FW6A 1ZMXA 4D26A 2ZR9A 5LD2B 4KAXA 3I73A 1Z6AA 4A0HA 3WYAA 5F2EA 2ZITA 1SXJD 2KE5A 4QBFA 1S3SA 1QHIA 4H1VA 2V1UA 1OXSC 3TQFA 3F8TA 3L2OB 3Q9LA 4II7A 5HE8A 2GNOA 2A78A 1F3OA 4IOLA 3K70D 1IN6A 1Q44A 1V5WA 2IHBA 1JJVA 1US8B 3AKEA 4JVLA 4ZKEA 1Q3HA 3K0EA 3GQBA 4QC2A 2ZRDA 3MD0A 3EXAA 2B8TA 1P75A 4F4CA 3RDPA 4TZ6A 1H65A 1N6PA 3U2QA 2GVZC 1X1SA 3QNUA 1ZUNB 3THYB 2G1KA 4QFMA 5J4KA 3RHFA 4GBMA 1TL7C 5GVSA 4DLRA 4PC1A 2P65A 3BE4A 2EFEB 1D6JA 4G5RA 1Q0UA 4GZLA 3IGFA 2EW1A 4LJ5A 4TTRA 3RS4A 1YR9A 3W9YA 2IXFA 3SR0A 3BC1A 5FBQB 4URWR 1KO5A 3IEUA 5DN6A 3NBXX 4PO1A 1RRCA 1SXJE 2BM0A 1DAGA 3SQWA 2D7DA 3TUIC 5JLJA 4AKIA 2CL0X 5DISB 3BOSA 2CNWD 3KL4A 3GLGB 3R8FA 1OH8A 2RKOA 4QGFA 1HQCA 2NO7A 4HDCA 5JBQA 1NKTA 1XEXA 4TQ9A 5CLLA 3BBPA 1DS6A 5H70A 2NOAA 3ZD6A 1CU1A 1VYTA 2C8VA 4S35A 4XTCS 5JRZA 4EFLA 1MH1A 4TYQA 1M34E 1BYIA 2CLSA 1W1WA 1N2CE 3U4QA 2NTYC 2ODNA 2HLDD 4EQ6B 1XD8A 3SFVA 1OFTA 1XB2A 1IHUA 4DUGD 1XMJA 3WBKA 2VP0A 4A92A 3K0SA 2DWPA 4TYPA 2VIIA 3UPUA 5K8LA 2DR3A 3DVLA 4LBWA 2LWIA 1DPFA 1VIAA 4DXAA 3P32A 2PX3A 5JSZA 2LKCA 4MKHA 2XGJA 2XJ4A 1KGDA 1UBFA 2RH5A 4P33A 3R7WA 1I4DD 1U94A 3AKDA 1P2TA 2CK3D 4B3BA 3GFTA 4ACBA 2V8OA 4RD0A 1MOZA 1CBUA 1YHNA 1NI3A 4D2IA 2D62A 1XZQA 2ZI5A 1E79D 3PUWA 4G01B 4Z8YA 1G8FA 4KHZA 4LC1A 1E94E 2CBZA 1HE8B 3I4LA 2C78A 3QG1A 4R7ZA 3ZIAD 1IY1A 2A5DA 4C3ZA 4HEJA 1GUAA 5EE3A 1GTVA 1U8AA 4ESHA 3R8CA 1OXUA 2G0NA 4AC9A 2O8BB 2ZRIA 1JEEA 4EAQA 1F60A 2ZRKA 4G5QA 1UKVY 3W5IA 1H8ED 2WPDA 2ODWA 1RRFA 2F6RA 4FMBB 3ZLJA 4RD4A 2PLFA 4BECA 2ZI6A 5KSZA 5CYPA 1R5NA 3VR4A 1JPJA 4A6PA 3RLFA 3BRWD 1II8B 1P5ZB 2VF7A 3LW7A 4JLAA 3DM9B 1FNMA 1GRNA 2QAGC 2W6ID 1P4SA 3K0FB 3RWOA 821PA 5DHAA 3GLIA 1HE1C 1P2UA 2ZRNA 4M22A 4X8LA 4XH9B 4OQNA 4TSFD 5JCPA 3CX8A 3OEHA 3U44B 1JECA 1ZP6A 3AKYA 4HATA 5EQTA 1GZSA 3WHLA 4OHZA 5K8IA 2XXAB 1GKYA 4BWYA 4HUQA 2R62A 1JQLB 4PHFA 3QIAA 4EFMA 4A2PA 1HEIA 2GESA 3PEWA 2AN9A 4F91B 2ERYA 3LBHA 5L3SA 4TL6A 1J2JA 3V9PA 3QE0A 1NIJA 1SGWA 1FP6A 1OKKA 2EWWA 1KKMA 5CJ2A 3DHWC 1XD2A 3KJGA 3OE7D 4NTZA 5FUYA 2V4ZA 3LRPA 4M2LA 4CEJB 4LUCA 1XP8A 1GKUB 1MO6A 4D0NA 5C2JB 1ZBDA 2QAGA 5FR1A 1E2PA 5J40A 4F4JA 3GP8A 2DHRA 3B6EA 3DMDA 3C41J 4LJYA 5FUWA 1RE0A 3L0PA 4NBSA 1G7TA 2O8CB 1YR7A 1PUJA 3T5GA 3B9PA 5UKDA 3OFND 4LK2A 2E87A 2OZEA 5JHHB 3I8SA 3T1OA 1KAOA 1F2TB 4G5OA 1G7RA 2A5FA 2WICA 2ZRLA 3ADKA 3TH5A 2P6UA 1KAGA 3A1TA 4HDOB 2QGNA 5IHPA 1HUQA 4MQBA 1PVOA 2IEYA 1OV4A 2OXRA 4QJ3A 3ZDQA 5FBWB 1TU4A 3TGPA 1XCMA 1X6VA 3IHLA 1JXMA 2WZQA 4OJKA 1OH7A 4TL9A 1NKSA 1WQ1R 2GCOA 4C0QC 3AGQA 3BH0A 1PLLA 2XX3A 4OK5A 2A5YB 2C04A 3E5HA 4B48A 3LX8A 2O8DA 3IBYA 3FGNA 4B74A 4DKXA 1NLYA 2I3BA 3J81k 1JAHA 5J4HA 1BOFA 1KSFX 5EXXA 5C4GB 1NSTA 5JECA 1ZIPA 2G6BA 2FZLA 4O0MA 1SHZA 2IYLD 4ASUD 3EPHA 2YNMA 2GZHA 2K5UA 1MO3A 5EP3A 1P62B 4FWTA 2HYDA 1YZTA 4EPVA 4JL5A 4KBGA 1SXJC 3AVTA 4M53A 1K6MA 4IXNA 2O8EA 3KZ1E 1UBCA 1ZAKA 2QA5A 3QVVA 1P7CA 3QQ5A 2ZS7A 1FUUA 4X8MA 3K70C 2FV8A 4CEIA 1XTRA 2WWHA 4IOJA 4DCNA 4IVPA 4HSEA 1YZKA 4JVNA 5DO9A 2QUZA 3U7GA 2BKEA 5KSYA 2GZAA 2DPXA 3TRFA 1ZM9A 2YC4C 2ZEJA 4FMDB 1KY2A 3DL0A 1ZD8A 5FUVA 4P4SB 3QXXA 2X77A 4TMZA 1PLJA 2WWYA 1ZM4A 4LZZA 1KJYA 2AFHE 1J99A 3KJIA 4HB4A 1AN0A 3D6TB 4KFRA 4A8JC 4JLMA 3THXB 3SBEA 1OIWA 1U98A 4M4SA 3RS7A 2OCAA 3AGPA 4AWXA 4GP6A 1S9HA 3C14C 1HQYE 2CCJA 2ZRHA 5HE9A 3CUEF 2ZQ5A 1K5GA 1T3SA 2W00A 4Q1CA 4UKDA 5BXQC 2XZPA 2YHSA 3M1IA 4FCTA 5CDFE 2QY9A 3B1VA 2ZE5A 5HPYB 1SVSA 4O3MA 1IOZA 1NMYA 1Z0AA 3REGA 4Q4HB 3DPUA 4RFVA 5KDOA 1MABB 4LHXA 4LHZA 1QHGA 3LFUA 2IA5A 3TSZA 1WP9A 1LY1A 1W48A 4KFSA 1C1YA 4LPSA 3TK1A 5TB5A 4D4KA 1KJZA 3P27A 1DAFA 2A5JA 3AM1A 1JAIA 3GFPA 4RY2A 5LDDC 4NZYA 2B8WA 3VR5A 4M1KA 4WXRA 2VQSA 1ZM3A 4NYIQ 5HKKA 2FFQA 1LB1B 4HAXA 1G6HA 4NP6A 2WSSD 4C0HA 1WXQA 4JVSB 3T34A 4XD7D 2Q0HA 2JJ1D 1D8TA 1J8YF 4KSBA 1P60A 2ZTSA 4Y0VA 1E99A 5FTMA 3RABA 2NO1A 4TLDA 1ZNXA 4XVQA 4Z8XA 1R0XA 2Z83A 4PO9A 1EXMA 2J1LA 5GJWC 3K8YA 3LDAA 3SYKA 4DC9A 1NRJB 2YV5A 3FOZA 4FMCB 2GA8A 1JXOA 2OBMA 1Z07A 3AH8A 3K0AB 4AYTA 5CB6A 2GCPA 1ANKA 1DELA 1OYWA 2BBTA 4PC6A 4LYFA 3SS8A 2Q6TA 2PEYA 3K9HA 4U02A 5JRJA 2OO7A 3QKSA 1PZNA 1OIVA 4UJ5A 2UKDA 2IWHA 1JI0A 2CK3A 2A5GA 4U5XA 5EP2A 4ZIRB 1G5RA 1E2KA 1OIXA 5KTYA 2OT3B 4ABYA 4DIEA 3C5HA 3R9IA 5CM9C 1H8HA 3NKVA 3FHTA 4PZZA 4WXPA 4JYCA 4YMUA 3ZIAA 1E2DA 3EZFA 5H68A 3EARA 1XFAA 4FD2A 1G291 1E2FA 3PEUA 2ZR0A 4PFSA 4TMWA 5JZVA 3SJBA 5E95A 2A9KA 2ZI4A 5EJEA 5IK2D 5EUMA 2XB2A 3ONWA 4XVRA 2CVHA 4LYJA 2D3WA 1XXHE 2Q21A 3A37A 4O2LA 3X1XA 1N6NA 3QEJA 3LX5A 2C9CA 1TF2A 3P4XA 4Z54A 3SOPA 3S1AA 4BEJA 2J0VA 3EZ9A 2JDID 3F0TA 1Z29A 2BDTA 2LCFA 1D2MA 2W6IA 1E9DA 3I1FA 1I4TD 3IILA 3TR5A 1G7SA 3PUVA 2DB3A 1ZM2A 4JMPA 3E70C 4BLSA 5GVRA 2HJGA 1LF5A 3BB4A 4I1UA 1XZPA 3MWLA 4TN1A 4YXWD 5JHGB 4KO8A 3THWA 3SC3A 1Q21A 1Z83A 1P6XA 4FXPA 3B1YA 3VTKA 3GLHE 4ILEA 4MGYR 1XJ0A 2W2XA 1CEEA 4LJ6A 3DOFA 4PC7A 4UNPA 3P20A 1VIYA 2ZRMA 5SZJA 4NE2A 3T1QA 4KV9A 1N5LA 2J41A 4NHOA 1GL6A 4M1YA 3TAUA 3U6BA 1NNEA 1KMHA 2WJVA 1E6CA 4NCKA 1KNQA 4P3YA 1G5PA 1UJ2A 1NF3A 3NC0C 1D9XA 1OSNA 2CL6X 3I92A 2QP9X 4JLJA 4PO8A 5KYKA 5B30A 2BC9A 2GXAA 4CGZA 5KHOC 2RMKA 1EGAA 1SVMA 3CH4B 2VP4A 4PHTA 3SFZA 1D2NA 4K8OA 3D8BA 3CRW1 2IT1A 3Q5DA 2ZU6A 3RSLA 3OIUA 1ODFA 2QBYA 2FH5B 3KTAB 1TADA 3OFNA 2OESA 4N3NA 1XPRA 4ON9A 4UJ3A 3VX3A 5B2ZA 2HXSA 5FPHA 4IVRA 5FR2A 5HCIA 4D80A 2PH1A 3ZVRA 3IQWA 5KUTA 2NMVA 1T8TA 2GETA 2N46A 4DLSA 3WYGA 1TAGA 4KU4A 3NDPA 4LV8B 5K8TA 1Z63A 4AKGA 1P2SA 4A9AA 1XD9A 1T8UA 5JI3E 3A1VA 3ZVNA 4DB2A 2F1HA 2OCYC 4YLGA 3I32A 1X8KA 2XJ9A 5G53C 1W36D 5FL7D 2UVQA 1KSGA 3AP3A 3B82A 2V7QD 4OQXA 4E5UA 1QVAA 1E0SA 3FFBA 4PX9A 2KI5A 5FOWA 3AF0A 1YVDA 4LYHA 5JSZB 4M9QA 1E0AA 2Z6VA 5E7MA 2QSYA 2XZLA 3L0OA 5H8WA 3CX7A 3U6KA 2NGRA 1OB5A 1QHNA 3R7WB 1UKYA 4UXIA 3B1WA 3ZD7A 2VEDA 3LH5A 4ASUA 1EX7A 2VH5R 2FDCA 1DAMA 3X1WA 2N1BA 4JLDA 2XITA 2ZM5A 4DDVA 1S9DA 3RRZA 5DIFA 3W6PA 1WE2A 5CDFA 1KDRA 2PT7A 1CR2A 3SHWA 4BLOA 3MJHA 2QU8A 2WBLC 3X1ZA 2AFIE 4OHYA 3RSOA 3FKQA 3OIVA 4HZUA 3VKHA 2MSDB 2QM7A 4OYHA 5KSPA 1E2IA 1N6LA 4KCGA 3RNLA 2ERXA 3O8RA 4LBYA 1F6BA 2C96A 1GOTA 3HPRA 4EDHA 2H5EA 4L15A 1E98A 1R5BA 4Q4JB 1N5IA 1DOAA 4JLBA 4NPHA 1AZTA 2REOA 3BIFA 4I1SA 5AJWA 3UKDA 1GRQA 1A1VA 4R2HA 3CNLA 3C16C 2W2TA 1KIMA 1N6HA 2XSZD 3CM0A 1NVWQ 1YJ5A 3FKSD 3T1TA 2F1JA 4AKHA 1G3QA 3X1YA 1UBEA 3K0CC 5CYOA 2V54A 4HAWA 3AVOA 1LS6A 3EIQA 4W7SA 3SJCA 1W47A 2MSEB 1B23P 2Q3FA 4DCTA 2X1VA 5AUNB 3SQXA 3GLFA 2O8FA 4AKEA 1U99A 2ZPTX 1KI4A 3CZQA 4LHWA 2IEZA 4NYMR 1WA5A 4HUQB 4C0BA 2ZSFA 3KKPA 4G3XA 2OCBA 2RAPA 5CK4A 4DJTA 3KX2A 5FPKA 2PMDA 2ZETA 4HLUC 1NJGA 2ZU0C 5SZIA 4V03A 3ASYA 4C30A 2ZIAA 5L3SB 2O0JA 4PHGA 1L4YA 1ZC4A 2GILA 1J90A 5CM8B 5K8UA 3UK6A 4D0LB 4PZLA 2EWVA 1SULA 2ZRBA 3ADCA 5IDVA 2HT6A 2VTKA 2IYUA 3AB3A 5LB2A 4TQAA 3JVVA 2QZ4A 4C7OB 1SKQA 3K0CA 4OI1A 4MKFA 1E2LA 4HAZA 3K9NA 2Q9AA 2VSFA 1Z28A 3A1SA 3QJYA 5G3ZA 3WYFA 2QP4A 3IHWA 2ZRAA 1TNDA 2WIBA 1DEKA 4YMTA 3FPAA 5KNCA 2O5VA 2NPIA 2GJAA 2Z43A 4PC2A 3RYTC 2XAUA 3TW8B 4TL8A 2FFHA 3LAWA 421PA 3EZ7A 2YC2C 2GCNA 1ZINA 2QTFA 1J8MF 4R71A 3W8NA 1JEDA 2YJTD 5G40A 2HXYA 4ZCLA 4P0TA 3K09C 1VYVA 2PCLA 1L7VC 4FW9A 3VR6A 3KFXA 2AWNA 3KKOA 1HY3A 1HYQA 2Y8EA 1XXHA 3NEJA 1N25A 2OSBA 2OEPA 4Q5IA 4B3FX 4GRAA 3PQCA 4ZDIA 3H0KA 2XEXA 4PTLA 5FOUA 2J3EA 3W6NA 4HI0E 5LB4A 4BLQA 5EE1A 2VSXA 3HPQA 1XMVA 1U8ZA 1Z0IA 2H18A 2R6FA 3AVPA 5FTKA 2ZJBA 3QKRA 3HU1A 1CULC 1X8LA 1S8FA 5BN5A 3TMKA 1DAIA 3N2IA 4L4UA 4KXFB 2C03A 4N1AA 3K09A 2GVDC 2P6NA 2O8EB 3VNUA 4D25A 1G4UR 2BCJQ 4DBLC 2AX4A 2IYTA 3EX7C 2V3CC 4TYYA 1R0ZA 2DCUA 1AS3A 2H57A 3BFVA 4FMCF 4KVGA 4B35A 4CEIB 5IK2A 4M9XA 2JLZA 4EJSB 5J5CA 1KZ7B 2UZ3A 2FGKA 1NSFA 4XOIA 3OEEA 3AVXA 3GJ4A 3AVYA 4CEHB 2C95A 3P1JA 2VP9A 3FHCB 2CJWB 3IIMA 3QXSA 5FH9A 2JDIA 2OM2A 1TF5A 3EG5A 5KPJA 1CLUA 5A5GA 2NO9A 1KI2A 4MRSA 5EZ6B 1Q1ZA 2QE7D 3RWMB 2F9LA 1VPLA 2JLRA 8OHMA 2VP6A 3TVTA 1MR3F 3AV0B 2O0KA 2JIZD 5EE5B 2OILA 1GM5A 4JBXA 2WSMA 5TXGA 3ND8A 4JYBA 4Q9JA 4YXWA 1GL7A 5AWFC 4BPBA 2QI9C 2YZ2A 3BJIC 4IRUB 5HCNA 1R2QA 2DFNA 3G82C 4DLTA 4DLYA 1Z8FA 2FPLA 1YR6A 4DSUA 3A36A 1E1RD 1FX0B 2RGGA 2ZJAA 3CWZA 4HAYA 1KI9A 1VDZA 1KNXA 5BYJA 3CX6A 1E9EA 4BFWA 4E22A 1YRBA 4V0LA 2BCGY 4XIGS 2ZSBA 1SKYB 4XSGA 3NHAA 2BEKA 3CRVA 2ODEA 2ZJ5A 2ZRFA 2QPTA 4KODA 3NH6A 1LNZA 1E96A 1ZD1A 2EYUA 3K9GA 4LV6A 1CTQA 5BN3A 1U8YA 1YU9A 1DE0A 1VG1A 2BVNA 4PQFA 1NBMD 1ZJ6A 3GLGE 1G19A 1Z08A 4EKDA 1W36C 1G41A 2J0SA 2IK8A 2IUTA 4FCVA 1KI3A 3K1JA 2MSCB 3GD7A 1VG8A 1FZQA 1I2MA 2ATXA 1KK2A 2CL7X 4GMDA 1Q57A 1UPTA 4GFDA 1JR3D 1MV5A 4YDHB 2FF7A 3C8UA 2RHMA 4JS0A 2QPOA 2R6DA 4MA4A 2ZREA 1LTQA 3LVRE 4LJ8A 1YE8A 3IIKA 4UXJA 4D4MA 1DAHA 3EPJA 1GNQA 1QZXA 4BFZA 3ICQB 1B0UA 4IDOA 4NL4H 3H2YA 5F3WB 4IOKA 1N6KA 3MLEA 3UXMA 1COWD 3WY9A 1P61B 2YOGA 2ZJZA 3T1VA 1ZIOA 3TW4A 1VMAA 3NHBA 4P4UA 5B58C 2F43A 3IPYA 1Z2CA 3CRMA 1M7GA 4YQFA 3B1XA 5FL7A 1FP7A 2V7QA 4LJAA 3P4YA 1NBME 1E3MA 2ZI9A 1YKSA 3QEOA 2IYYA 3U5ZB 3AF4A 1KI7A 1RYFA 3T12A 3QKSB 3CIOA 2OBNA 2B21A 4G5GA 2O52A 4G5SA 5G41A 5IRCD 1YZQA 1UDWA 1XJQA 2FMXA 4GT1A 1JR3E 3WMFA 1Z22A 4OHVA 1I2DA 4DCSA 4HZIA 4BZXA 4UNSA 5HTKA 2GF9A 4TT3A 4DLUA 5DI9A 3IBGA 1G4AE 4OI2A 3N5CA 3ZZTA 1UEJA 5DYIA 3L43A 3NBYC 1W4CA 3LW8A 3CWQA 4M0LA 1HT2E 2J0QA 3U3MA 4Q47A 1OXXK 2IYZA 2J7KA 3QBTA 3MUFA 4M8NE 2ORVA 4PANA 4ARZB 3QPUA 2F1RA 3Q7PA 4TYWA 2ONKA 3BH6A 2ZANA 2QTHA 3AF2A 1UF9A 5CIQA 5KNDA 2GHIA 4KFUA 3C7KA 1UADA 1Z0KA 2WWXA 2G9NA 2ZROA 3S1AB 1Q1EA 4P31A 4BZPA 4IDPA 2JATA 2DWOA 5FOTA 5ANRB 1FQKA 1GIAA 2FSHA 3C4JA 4LRWA 1UKEA 4Q9HA 2IF2A 4LHYA 4BFVA 5TDHA 4WAUA 3THWB 4QM6A 1G8YA 1P73A 1R8SA 3C5CA 1XU4A 2P3SA 4NCNA 2YOFA 2XB4A 4URYR 5DH9A 1Q1QA 2C9OA 2RHDA 4QNMA 5FOXA 3HU2A 4J0QA 3PXGA 1VHLA 3B78A 5D3MA 2CLDX 5CB8A 3FTQA 4CVNA 4NONA 1G8GA 3CF0A 1W5TA 2DYKA 4QBIA 3LLMA 4RD3A 4RZUA 3UIEA 3W5JA 4DEYA 4MDFA 1XJCA 4BE7B 4PC3A 1FUKA 3QXJA 3VU9B 2WTUA 5JJLA 3N70A 1YR8A 4A6XA 3B1ZA 5LD2C 4MUBA 1JB1A 1SVIA 4UNQA 5JWOA 1ZU5A 1KY3A 3FWYA 3I5XA 4Z51A 1IXZA 4GP7A 2RGBA 2BBSA 2ZRGA 1ZW6A 2XOKD 5SZKB 4XTRA 2WWIA 4NU0A 2JLUA 2JA1A 3A6PC 1RRPA 3KXLA 4Q66C 3WP1B 1XTIA 4DHEA 5BN4A 1L2TA 3U3JA 1Q1BA 4V0OA 4B6EA 4ZDKA 3O8CA 1XEFA 2VPPA 4NYMQ 5M04A 1YZLA 3VQTA 4XWAA 4QHYA 5FOVA 4YMVA 1Z5ZA 1NLZA 4ZDJA 2XNSA 5AJXA 4MUAA 3L82B 4Y0AA 4AK9A 4LDJA 4LI0A 4MITA 5TVKA 4Z1MD 2EFDB 4GPTA 2AKAB 3X2SA 1K5DA 2XNDD 1JPNA 4QNRA 2CHGA 3QXHA 4WBSA 4KITB 4N0EA 2QM8A 3GJ7A 1E9CA 2CE7A 3MFYA 3CRRA 1OB2A 2F9MA 1S4QA 1NMZA 1RKBA 5JWRA 4QBHA 2HCJB 3KUCA 3IO3A 3O8DA 2A30A 1US8A 3KQHA 1ZVQA 4Q02A 1SXJA 2ORWA 3CBQA 1E2GA 5GJVC 4QHSA 3SJZA 2WJHA 2BBOA 1W49A 1QF9A 4K81B 3EIHA 2OLKA 3THYA 1TUEA 3CB4A 2AXNA 4OK6A 4Q9KA 4A2WA 2WKRA 5CJPA 1CRPA 2ONJA 2OFWA 4L9SA 2XTZA 4JBYA 1GITA 4B3DA 3VHXA 4QKQA 2QTVB 3IIJA 1R4AA 1M74A 4OBEA 2CHVA 1A5TA 3OIYA 4W5WA 3KKQA 4ESVA 1GRRA 3ZVMA 4V02A 4A0RA 5E7IA 5BWMA 1OHHD 4MKGA 2WV9A 4BLPA 3D3QA 4V0NA 3GLGA 4DLWA 3QKTA 4A8JA 2QE7A 3FMFA 1TUIA 5LBIA 4B75A 2NPFA 4TMKA 4NYJQ 2ZYUX 3R20A 4KBFA 3M4YA 1OFIA 2Z4SA 1U90A 1AKYA 3BXZA 4TWZA 2H8KA 2CNWA 1CIPA 2C5LA 1G17A 2O8FB 3GLFB 1E69A 2EYQA 3HYRA 3KDSE 3TUJC 3FYHA 4EQ6A 1N0UA 3OAAD 4RZ3A 1UKZA 5CLQA 4B47A 4AY2A 1BMFD 4PQYA 3CPJB 1FTNA 3PFIA 4DT1B 3QF4A 5AUOB 2ZVPX 1FL9A 1W4AA 5FPTA 1IN4A 1AGRA 1MO4A 1OXVA 4DRZA 2HCBA 2HLDA 4Q9LA 3L8ZA 1AQYA 2B6HA 2ODBA 4DUGA 3GEHA 1CS4C 2VHTA 3BD9A 1IXRC 2BMFA 1NMXA 1M7BA 2V1XA 4R2IA 3TJZA 4HUTA 3W3ZB 2WMNB 2OXCA 4KFTA 4V0ME 3PENA 4AYWA 2CMKA 1J7KA 1JNYA 1JR3A 2BMEA 2WKQA 1IJFA 4U00A 4BRUA 4JLOA 3QSYA 1F48A 3GJ6A 3PR1A 2WJJA 4Q7MB 4BQSA 4MH0R 2Q9BA 1E79A 2ZRPA 2J0UB 2ZYTX 1WMSA 1QHHA 5HR5A 3WNDA 3A4NA 5TV2A 1ZNWA 4RKEA 2GF0A 4ZI2A 3QXCA 2WWFA 1NLFA 4ZPXA 1ZD9A 2VSOA 1G8HA 1II8A 3WMGA 1LS1A 5DSZA 3SHFA 4Q00A 1RJ9B 1W0KD 1E9AA 2ZSEA 3GJXC 4HAUA 1O3YA 4DSNA 1KSJA 1H8EA 2VBCA 2H1LA 1XMSA 3RC3A 1NG1A 4LX0A 4B73A 5E3HA 3DKPA 2CVFA 4D6PA 3PG5A 5JS8A 5C4MA 5AJYA 3SE0A 3IPXA 1RPZA 5CK5A 3W8RA 3KQNA 4B43A 3R9XA 4JIMA 5E7JA 1M1YE 4B3XA 2NZ8A 4OK3A 5DI3A 3QPWA 1OE0A 2HV8A 3ZJYA 1NP6A 3EASA 1XEWX 3AQ4A 2OHFA 4JJKA 4C2UA 5BQ5A 3HWSA 5J4YA 2QEQA 3VKGA 4M1TA 5L3VA 3TBKA 4TSFA 4IVQA 1P9NA 1UFQA 1E9BA 4JT4A 4F92B 5JJKA 1X8JA 4LV5B 4CEJA 2QNRA 3H1TA 1E9FA 3VKWA 3HJNA 3P26A 5FTNA 5DLQC 2J7PD 2ZJYA 3AEZA 5ELXA 4R98A 2XTNA 1S2MA 4B34A 4XWKA 4W9MC 3ASZA 2EFCB 3D7MA 1G3UA 5KOYA 2ECKA 2O8CA 1NVVR 1FMJA 3OE7A 5TY0A 4GI7A 1W5SA 2DBYA 3AKCA 1D5CA 4MYTA 2KBEA 1VCIA 1CP2A 3QBVA 1DO0A 4WOPA 1KI6A 1OXTA 5DN6D 1HURA 2FNAA 3KKNA 4IFEA 4C0KA 4GDFA 5JEEA 3LQQA 2LKDA 1F2TA 4QJ4A 1S1CA 1LF0A 3CNNA 3VX4A 3WNBA 1KO1A 2FPKA 4S2EA 3UATA 2W6JD 1WBDA 1U0LA 2WMOB 1OPXA 2J59A 1P72A 2JASA 1CJTC 4Q18A 1N3BA 3BGWA 2AXPA 1KDPA 2OBLA 1CR4A 4FINA 4MYHA 2J46A 5KNBA 1IAQA 3KJEA 2P0EA 2PEZA 2JGNA 1XEXB 1G16A 1ZNZA 4TMVA 1TQDA 3BAFA 4Q1DA 5EZ5A 1U2RA 2FJUA 4R9UC 1Z0FA 1IBRA 1Z47A 2D06A 3GCGA 1HT1E 5SZHB 1UAAA 3H84A 3QPVA 3QF7A 3KXIA 3AUXA 3F3YA 1X86B 3E1SA 3U4QB 2NQ2C 3KKMA 4LPKA 2OUKA 4BLTA 3AVUA 2EQBA 5L3RA 1W4BA 4HLQB 1UEIA 4LYAA 3B13B 2JEOA 2BIFA 4A36A 4B3GA 5BYKA 1Z3IX 1TTTA 1QG2A 3GJ3A 4RJLA 1P9WA 1RIFA 1G6OA 1XMIA 5KPDA 3B5JA 2RGAA 2BJWA 3QUSA 4QGGA 3AVVA 2VF8A 2PBRA 1GFIA 2VHJA 2WJGA 5JI2E 1QHYA 1EWRA 2ZSAA 4MRNA 4NCHA 4CRWB 1W7AA 1UM8A 2WPDD 3HU3A 1M2OB 2XTMA 3EPLA 2AL7A 4M1MA 3SBDA 1W46A 2C9YA 3EWSA 3OHMA 4IEEA 4P4SA 4G1UC 4PSKA 2IF0A 2PZGA 3MGCA 1OLOA 1TF7A 1FQJA 4I1VA 2VRWA 2X8AA 2RGEA 4WZBE 4CT5A 4RFSA 4GSYA 2WWGA 4FCWA 1JALA 1MRNA 2ASEA 4Q7LA 4P32A 5CIWA 4C9BA 2B7CA 2ZXUA 2OFOA 4TLAA 2RGCA 2VHCA 3OEHD 4L8GA 1Q20A 3T5DA 4ERNA 2IUSA 5DYGA 3A4MA 1T0HB 2FSIA 5AUPB 3SDZA 3Q7QA 2J5XA 4POAA 3U7FB 2W2VA 4PAQA 2CCGA 4L9WA 1L8QA 2GXSA 1SVOA 4A2QA 3GLIB 3G0HA 2C77A 2H16A 5FL3A 4PQRA 4QHTA 5E4FA 1RYHA 1R6BX 4RZ2A 1OH5A 3HR7A 1W4RA 1MABA 2IHYA 1DG3A 3OF5A 2QROA 3FE2A 4LBVA 4M1OA 1Y3AA 4Q7KA 2Q3HA 3T35A 3PEYA 5AK0A 3QOFA 1BKDR 2CCKA 3ZYCA 3UWKA 3BK7A 1G3IA 1U0JA 2VP5A 5AR1A 3EAQA 2QMEA 1RW4A 3EC2A 1ZC3A 1LFDB 1IY2A 2AR7A 2PLRA 3LLUA 4IKEA 4X8OA 3HDTA 1XD2B 4B3CA 4XSHA 121PA 5GJCA 2GZDA 2QAGB 2GTPA 2FU5C 5F98A 3EPKA 1TMKA 1SVWA 2GEDA 4M9SA 4QRHA 2IYQA 3ADDA 1DADA 4C0JA 1WDTA 1DO2A 4V0MA 3CF6R 4N0DA 1CJUC 1G20E 1N5JA 2GJSA 5HZHA 1KK0A 1QRAA 1OFUX 3BS4A 2HDNB 2NZJA 2JCSA 3VFDA 2WSSA 2YINC 3QENA 2PX0A 3OAAA 2CHQA 4XD7A 1XX6A 1MO5A 4HLUA 2JJ1A 3UG6A 2GK7A 2ZAOA 3UMSA 4C0SA 1BMFA 3K0AA 621PA 1AA9A 2R6GA 1Q3TA 2KJQA 4UNRA 2YWFA 2ZRCA 4FN5A 1E9SA 2QQEA 1E2MA 3DZDA 1DBSA 4OJQA 4BUJA 3DMNA 1XEWY 1U9IC 4LC0A 1QVRA 3VMFA 3LQRA 4QM7A 1BH2A 2OFXA 4DWJA 2VHUA 4O25A 3AP2A 1R10A 2IYWA 1Z0DA 2IYSA 2L0XA 3BORA 3EW9A 3QG5A 3FB4A 4YC7A 2QP3A 3HP1A 3PUYA 3TAHA 2GCOB 1AJEA 2IC5A 1EFHA 2REXB 4JSTA 4Q4AA 3A58B 2O8DB 1OT3A 3VHLB 2W0MA 2V55B 4JSYA 4ZV4A 1JR6A 1ZU4A 2VYFA 4JJZA 5JFGA 3B8HA 3NWJA 5FPYA 3BERA 2P2LA 2YWHA 2OAQ1 4C0AC 2X2EA 4ZCIA 3U7HB 1ZYUA 3C15C 2WIAA 3LBNA 4ZI3A 1IJEA 4F7WA 4KVAA 2QN6A 3U3OA 1K8RA 1QHXA 2DFLA 2IXEA 4IFBA 1EFUA 4URZR 3RAPR 4BEBA 1UBGA 1NG9A 1QDEA 1VYUA 2I1VB 3EIEA 3GLHA 4JVMA 2A3RA 2PZFA 1U9IA 5G3YA 4F93B 1EK0A 1GDDA 2CE2X 3TIFA 4PHHA 1AQUA 3EA0A 1W0KA 1N6IA 5EXPA 4KLZA 1CF4A 4NYIR 4CDGA 2FX3A 4DCVA 3GJ0A 4RCYA 1IY0A 3TSOA 2WJIA 1E2JA 4RSGA 2ZR7A 3V4FA 2ZSDA 4E03A 1X1RA 3CO5A 4HYYA 5KDLA 3ZQ6A 3RANA 4DVGA 3BFKA 1IN8A 4C0LA 2D2FA 4EIWA 2QORA 3FHOA 5EP4A 2R6AA 4OQLA 2IWRA 2G88A 1EFRD 4AI6A 1CJMA 1GAJA 1SXJB 2FGJA 2IS6A 2V6JA 3Q3JB 1G3RA 1VCNA 2Q9CA 2F3TA 2SHKA 3CLVA 1A82A 1T5LA 1KDTA 3HYTA 4IDQA 4LOAA 4PAOA 3WP0A 1CR1A 1ESNA 3TLXA 4DLVA 3K70B 3RS0A 4EPXA 5FBLB 5EE9A 3OZXA 2J7PA 1E4VA 1NN3A 1SVLA 3U60B 4Q03A 1P9RA 4ZDWA 4AD8A 3LA6A 4HDQB 3UMFA 3DO6A 3SYNA 1F5NA 2QMUA 4OKSA 3ZQJA 4PPQA 1VCOA 1WCV1 5EXTA 2IUUA 1VCMA 3KTAA 4LWZA 4Q21A 2P5SA 5HKKD 5HZKA 3VAAA 1NL3A 1RVDA 3A8TA 2QMOA 4TLEA 2PJRA 4A8JB 2OCPA 4B2IA 3PITA 2WM9B 4BFXA 1RC8A 3PUZA 4MDEA 1N5KA 2W6JA 4IOMA 4YMWA 5KU1A 1KDOA 4G0NA 3LWNA 2WOJA 1GSIA 4UQOA 1SKYE 1N0WA 2GXUA 2J45A 2OE2A 3VR1A 1T91A 4AYXA 3H86A 3WRYC 3AVQA 3RRYA 4IHQA 4TMXA 1ZUHA 4QGHA 2AWOA 2X19A 5FBVB 3SYLA 3EZ6A 3QF4B 4WZAE 1KK1A 1OYYA 4GMXA 1UDXA 2G83A 1CJVC 1T5IA 4TTQA 1YZUA 4A15A 4O2RA 3KJHA 3WNCA 4A1FA 2ANCA 1JJ7A 3CKLA 3PUXA 3VR3A 1NVVQ 1W2HA 3ZH9B 1KI8A 4BLRA 5B64A 3A4LA 4EFNA 3IEVA 2P67A 2FFAA 3CR8A 4BFTA 3I3SR 1MKYA 3NXSA 1SVKA 4MRVA 5F9HA 5F9FA 5AJZA 3EZ2A 2TMKA 1H8HD 4F4IA 1GWNA 4E09A 3T61A 4NMMA 4H1UA 1S96A 4URVR 2HEIA 2QENA 1E1QD 1VG0B 3JZAA 3AP1A 2GJ8A 1TEVA 1XTQA 2WWWA 4RVCA 1XCGB 4RD1A 4BFYA 1LW7A 2C2HA 4PPNA 2VP2A 2DWQA 4RKFA 2YYZA 4ITRC 1U0HC 2AHOA 1HA3A 1KZGB 2FSFA 5L3QA 4AIIA 2IS1A 2YVUA 1QHHB 4Q1BA 4Q4LA 4Q4JA 3AF3A 4JT2A 1FPMA 3K9LA 2OV2A 3KB1A 1OFHA 1N6OA 4I81A 2Q3MA 4EUNA 4Q48A 3T06B 4DIDA 4ZO4A 2G77B 1KTVA 2W58A 2JJ2D 3SJAA 1TPZA 4M1WA 1Y63A 5C1BA 4EPYA 4NH0A 3MJRA 3RS3A 3THOA 1SQ5A 1TQ4A 2IBMA 4KYIB 4XJXA 2FN4A 1XTSA 1KO8A 2QMHA 1NIPA 3Q8XB 5DI3B 1XRJA 2R65A 4MRPA 2XSZA 3QY0A 1PLKA 4KJZA 3FKSA 3FVQA 3K53A 3CPEA 5IF9A 3O8BA 3DOEA 4OI0A 1BO6A 1RZ3A 3PJRA 2OAP1 3U7EB 1KHTA 4HAVA 2ATVA 3CONA 1GKIA 3NDBB 3IKJA 2JLWA 1YQTA 1AKEA 2E1RA 221PA 1FFHA 3MMPA 3I5YA 4C7OA 1A2KC 1NY6A 4NDZA 4PPFA 5H1YA 5JJIA 3I8XA 3UANA 1KMHB 3TSWA 1BYUA 1NVUQ 4QJ5A 1KI6B 4TTPA 3ECCA 1U81A 1Z6TA 4OHXA 5AJVB 2ZE8A 1KO4A 5JMTA 2JJ8A 5FI1B 1L4UA 5J47A 3PCRB 1TU3A 3CW2A 2WAYA 4HB2A 3TUZC 1DAKA 2PZEA 1E32A 5JS7A 5J4LA 5C18A 3QKUA 3ICEA 1QBKC 2FSGA 5P21A 2QBYB 2IXGA 2ANBA 1A4RA 3CPHA 1S3GA 4JL8A 4X8HA 1IN7A 1G9XA 2HUPA 3PIRA 2VL7A 2WOOA 4Q01A 1D9ZA 2D74A 521PA 4QBGB 1W0JD 2YKGA 1E2NA 1VTKA 4EJSC 5FI0B 3GEIA 3CZPA 2ZS8A 3EA5A 2WHXA 4V0KA 1FNNA 6Q21A 1R0WA 1Z2AA 2AK3A 3DKVA 1F2UA 2YWEA 3A1UA 2ZJOA 2GK6A 3KUDA 2ORIA 1P2VA 2KB0A 4A4DA 2BEJA 4IW3B 3D31A 4GZMA 4GOJA 3CR7A 5FTJA 3KXKA 2IL1A 1O87A 3QI2A 2FEOA 1MRSA 2ZYVX 4IDHA 3WHKA 1EX6A 2ZUBA 4GOKA 4KYUA 4RZXA 4GOXA 4US0R 1R5OA 4HLDA 2R6CA 1TEXA 3L0IB 2YOHA 3KB2A 5FUXA 1XF9A 4JLNA 4EJSA 2AK2A 2JLYA 2RGXA 2ZJ2A 5KO2A 5IT5A 1XCPA 1CRQA 4CEHA 2GRJA 1T6NA 1G1MA 4OQMA 1ZM7A 4UNNA 2CJWA 3NVAA 1T0JB 3LXRA 1Q22A 3B7GA 2JLXA 4DZZA 2JLQA 4HZUB 3GJ8A 4I99A 5DGXA 3ZGXA 4BASA 1EWQA 4BRWA 3MG9A 2EFHB 4LCBA 4RFSB 2WJYA 2MMGA 2GAAA 3M0EA 2GEUA 2MMCA 4Q19A 4L5BA 3AVWA 2BJVA 2I1QA 2CXXA 3B2EA 3MCAA 3ZVLA 4B32A 1C9KA 1FX0A 3T15A 3ETLA 1EFRA 3LBIA 2JIZA 1AM4D 5JWHA 3MWKA 4DDUA 4CF7A 2VO1A 4FWIB 4PPGA 4CT4B 3KFVA 1YRAA 3LO5A 5DE3A 1RFLA 4Q1FA 2HT1A 2UZIR 1WRBA 3BB3A 1AS2A 1E1RA 3VR2A 4JLPA 1ZRHA 4D81A 3U3RA 2FWRA 2D4HA 3EWAA 1FTSA 1KI1A 1VKJA 4TLCA 4AG6A 2R2AA 3QVUA 3NEYA 2KSQA 1GL9B 1VECA 4MGKR 2BKUA 1W44A 4D0GA 2QPAA 1S0UA 3KQKA 4DLXA 2C98A 4DEXA 1GP2A 4B2LA 3B85A 1IONA 1PJRA 1XDBA 1NBMA 2QL6A 2GEVA 2PL3A 4CYMA 1HV8A 3GLFE 2BBWA 4RD2A 3L8YA 1FOEB 2RGNC 1M8PA 3HR8A 4WZ6A 4AURA 4AG5A 4U7DA 3JZMA 2N42A 4URUR 1T3LA 3RS5A 3I72A 3B9QA 2O8BA 2ZE6A 2OG2A 1NN1A 3IUYA 1ETUA 1CR0A
chains in the Genus database with same CATH superfamily
4CDGA 2KBFA 2WUVA 2Y1LA 1IUOA 1OTXA 1XQVA 5C8YB 4TV8B 2IY9A 4QL3A 2G36A 1TCVA 3L40A 1PWXA 4RGBA 3BWBA 2OFFA 3SF8B 3T0GA 4EUEA 4MNTA 2HXGA 4W82A 4L8FA 3I5UA 1FYEA 3GLUA 2V9ZA 3LXMA 1E2HA 5HWSA 1Q0QA 1V6AA 4YP0A 2PSJA 1A7JA 2GRUA 2ZTLA 3ZZ0A 3S2YA 4L7QA 1PTKA 4H1TA 1AGYA 2ZI3A 1LCIA 3QJGA 1IQPA 2RGNA 1I24A 2YXNA 3IDQA 4F8JA 5LMUB 3D2CA 1R4MB 2D7CA 3A06A 3OZAA 2G06A 4BVGA 1AQJA 1D2AA 4HGPA 1AS0A 4G26A 4V38A 2ECQA 4EUHA 4DDTA 4Z0HO 5DNYB 2H1WA 2OLJA 2X5OA 3HYSA 4O2AF 2PLWA 4NAUA 4IHKA 1N6RA 4EVQA 2JFGA 3AF5A 1XHFA 4CZ2A 2HBYA 4HLCA 3RVBA 5JCZA 2F55A 1LW6E 2IDJA 3QKRB 1KR2A 4L50A 1Q0TA 1LQUA 1TFUA 3GRRA 2CLCX 1RI5A 3ODPA 2EF1A 3NX4A 3UHPA 3BEOA 2GM3A 4IQGA 4WASA 4IO0A 4OMCA 3BSFA 1LSUA 3OEED 2GBIA 4LQLA 3GLHB 3ICWA 4G85A 2P6RA 2V7GA 3OCXA 2JLBA 3PDCA 4DC0A 3P71T 1SWWA 1RSZA 3BTVA 4FOLA 2RI1A 2VJMA 1GNRA 4DZTA 2H52A 4H6VA 3IBTA 4KB5A 1Z7GA 5DNWA 2JCBA 3ONEA 1OU0A 3RSZA 2VLIA 3WLTA 2X7HA 1EUCB 2ZBUA 3JVUA 3NIWA 4N6OA 1PT6A 4XVHA 3R3VA 1BVUA 2OC9A 3HDJA 2P6PA 3SLKA 3IQXA 4LJLA 1F12A 1NN0A 2OR3A 2FPMA 2QXYA 2WE7A 4JL6A 4JJIA 3JU3A 3QHPA 5IYZF 1E2EA 1JEOA 1VFNA 3DDSA 4K9QA 5FOSA 4RETA 3IMKA 1O9BA 1S89A 2HF7A 3LY5A 2F1IA 4TLBA 2GRAA 1RXSA 5BSVA 2V0NA 2GSWA 3DEFA 2B1QA 3CNOA 1V9SA 2GQ0A 3BH7A 3ELUA 3ZGZA 3L5OA 2GOYA 5FBRB 3SE7A 1W59A 3M9LA 1Q7CA 4MS1B 3U7IA 3FGOA 3L7NA 1JTFA 1FFBA 4KXWA 4KWCA 2OOKA 1RZVA 5BOVA 1C7ZA 2CFOA 3RPEA 4CMEA 1T25A 4PSCA 3VU9A 1QV6A 1R0CA 5T8KA 4MCAA 2HJVA 5J2TF 4D41A 2ILTA 1A9TA 5LQKA 1PO7A 1SG9A 2IYRA 1NXVA 2CDCA 1YS7A 3M5CA 4GNKA 4PW0A 5JCJD 3PV0A 1LNQA 4B8ZA 3REFA 2B3TA 4F3CA 4D9HA 1IM2A 1NNUA 3VC7A 1TK3A 5IVIA 1ZSYA 2CZGA 3WMEA 2J08A 2I66A 4RV9A 3TN7A 4BN0A 3VH2A 3AESB 4KN9S 4MKIA 5BN3B 2QN8A 3GNTA 4DQVA 2ZS9A 4EZIA 5B57C 1VB5A 3KYDB 3TOZA 5EJ5A 4N7BA 1J70A 4ARBA 4Z53A 4Z4IA 1FLAA 2AKYA 3DZGA 4FHEA 2QMZA 2CWDA 2JHFA 1BHJA 3BWXA 4MJXA 4OKIA 4REQB 4TL7A 2YDYA 2X4LA 2ZBEA 4U63A 4BGVA 2WKPA 2BOVA 4Q7JB 1PV4A 1GRCA 1EI9A 3W4KA 2QTTA 1ZWLA 2QSUA 1ORTA 2GSDA 4G0QA 1FSGA 2IVZA 3LOPA 1Y9AA 4TM8A 5EKDA 5TARA 4US2R 3GG2A 4HGQA 1PFGA 3TE6A 5LJLA 1TK9A 1XZCA 5E8RA 1YQ9A 3JQFC 2FA9A 4B7CA 1L1QA 2H11A 3LZDA 4KH0A 2QT1A 4HNVA 1U31A 2PNJA 2R751 4Y6PA 3ZZUA 3BICA 3HCFA 3KQQA 1I30A 5CURA 1NTRA 1ZJ4A 3L18A 2IW3A 3GLVA 3F4BA 1NJFA 3R9WA 1BCRB 1GUFA 4A82A 4NV3A 3DXYA 5C81A 4U2KA 3IOEA 4ARSA 3U49A 1NW6A 5LUBA 1DTSA 2DSNA 5ALKA 1C0PA 4Z1MA 2CUZA 3ENVA 2DFTA 3OOSA 4OYRA 1W36B 3MHPA 2XMRA 3SIPA 3L92A 3SEAA 2DETA 4REOA 3TLBA 2D1FA 4M0CA 4A8TA 3M6XA 1ACJA 2BFFA 3CUUA 3IT2A 5EHNA 3EAGA 4LMPA 2DHCA 4TT3D 2JNWA 2FQXA 4OXNA 1VHTA 4ZVRA 4R16A 2FPOA 1LBSA 2F48A 3SU8A 4FR2A 2VQFB 1VLJA 2R8BA 5CH5A 3RVQA 4XGQA 1X2EA 2W6PA 4BMNA 5EXSA 2FPPA 6REQB 1P2FA 4ZZ1A 2F7SA 4LJRA 3OZRA 2PUEA 2LXNA 4P81A 3PEVA 2QMYA 3AIKA 1JH8A 3DAFA 3VR0A 1JSLA 1OKKD 1WZNA 4MYUA 5L3QB 4BGDA 1O77A 4IDFA 1E2QA 1AO3A 3FFXA 2QR2A 3H9EO 4U8HA 3O9MA 3GPLA 1N92A 1OMOA 2V6IA 1ILWA 1Y8AA 3JX9A 3OPXA 4LXIA 3MWYW 3ZXXA 3GRUA 3KEMA 2WYUA 1Z6GA 3SM3A 3H7AA 4EG3A 2IS4A 2PS9A 3BUSA 1LVGA 4KI0A 4TQUS 1YB4A 4PZYA 1R15A 4XCQA 2DC1A 1YDWA 2XMQA 1XNJA 3MWJA 4J49A 1OA1A 5G0SA 4B2PA 2C3MA 4JD5A 4C2TA 1N5DA 3LNCA 4BNKA 3I62A 3FDIA 1NUAA 4OKNA 1SQ0A 2HMSA 2ZUDA 4ZMSA 2WWYA 1P19A 4RTNA 1EEXB 5D5QA 3RVDA 4IDGA 2FMIA 3FJYA 3I6ZA 1JIVA 3IO5A 2RB5A 2W71A 3IUJA 2HM7A 3A7DA 4ZU6X 1WBBA 5ALSA 5KWJA 1N32B 3B3JA 3H18A 2WJZB 1ZH6A 3KQPA 1VKHA 2Z8YA 3FW1A 1CF2O 4LBZA 1NMQA 2C7GA 2NZUG 5CNJA 4BGIA 5F35A 4DT1A 3LX4A 1W2GA 2VUUA 3LLVA 4LGMA 1DQSA 1TJNA 3WIBA 4TZ0A 4AZ3A 1L7OA 4B6OA 3PVSA 3TLMA 1CUHA 1PFQA 2ZUWA 3ZJ5A 1M10A 4Q6WA 2NSHA 3GO4A 4KI7A 4JLKA 3W7BA 2XHEA 3N53A 3RHZA 5EMHA 1Q95A 2HN9A 1RRGA 2PRSA 3DDNA 3TQCA 3UUFA 1UXJA 3TD9A 1G66A 4ZV9A 3WWOA 2FFBA 3BFJA 2OCIA 5JJ5A 3ZXUB 3NT2A 4EELA 2GKSA 4RTRA 4HK4A 4PVDA 1DVRA 3HH8A 4JJFA 2IRWA 3WZMA 3WIUA 2X8BA 1BA3A 1KMCA 2GF2A 5LP6F 4IGEA 3W34A 2ZJ8A 2XB9A 4DCVA 1ZMBA 4M7OA 1YTUA 2OFPA 1NU6A 1HDEA 3GT0A 1EG7A 1MD9A 3L0SA 2JH9A 3NHZA 3FPKA 4PRKA 2QRNA 4Y8VA 5T3YA 3ZOZA 3IP3A 2NN3C 3G2OA 2TYSB 3QE2A 3W3AA 3SXUA 4BFUA 4D4LA 2HA2A 3C0KA 1XXLA 4WW0A 3UG7A 1MT0A 2H4ZA 3K72B 2AZDA 3O8NA 4MTLA 4ZVVA 3KVRA 1ZGBA 3SS9X 4HN9A 1YMQA 1F0NA 4C4PA 3QEMA 5EJMA 3UB3A 1E3EA 3ZS9A 4RCZA 3B60A 1Z06A 1KIAA 2BFDA 3NNNA 1CJKC 4KACA 2WT8A 4WA8A 4CKCA 1U6IA 3BXFA 3F90A 3JQPA 2YBDA 2IH2A 1ONBA 1SZPA 1JSCA 2Z4RA 1KYIA 4UVGA 5D86A 2QLMA 5EP1A 1GPAA 1QJCA 3L7DA 5BT8A 4A6EA 4M8SA 2JHPA 3Q1LA 4RH1A 2YX1A 2Z3VA 1M6NA 3EZYA 4B71A 1B1CA 3E23A 4WQMA 5IJ0B 3GVPA 1ARZA 3TTYA 4A5SA 3PTLA 1G7CA 1X38A 4LYGA 4YASA 2H2WA 5B7PA 1F2UB 3HV0A 1H2WA 1ZMXA 1Q2XA 2E6UX 2PD3A 3Q3GE 4KAXA 5I51A 5HF5A 4BJ1A 2XH8A 4WUVA 3E9MA 3OTQA 4MPTA 3A14A 3PI6A 2GK3A 2HH9A 3S2IA 1T4CB 2A0WA 2AIRA 3QLTA 1DBPA 3F47A 1E77A 1L5OA 4QBFA 1QHIA 3CEHA 3TQFA 4II7A 4BV2A 4E2WA 1MVOA 2GNOA 5DXJA 2WF8A 3K70D 3FOEC 3FYTA 4L8LA 1IN6A 4E11A 4RHCA 1EWTA 3ORHA 1EIZA 3BULA 1JJVA 4CCSA 4PG8A 2PZBA 4E15A 4OUKX 3GQBA 4KVFA 5DBEX 1PFKA 1C3OA 2JI9A 2QJTA 1AXRA 4TRMA 3JQDA 2HNAA 3PFKA 3NMUF 4TZ6A 2JFNA 1N6PA 2NT4A 2GVZC 4IJQA 4XLTA 2QJFA 2LCQA 3TLYA 2HEGA 3U2QA 3ZCVA 3THYB 2B4YA 1QP0A 1TL7C 4FHGA 1ACLA 1OZAA 4XLLA 3F7TA 1I2ZA 1Y8QB 2YJZA 4L72A 1D6JA 3UGQA 3TLAA 1Q0UA 1D0IA 2XB6A 1RHJA 1TRKA 2FX5A 4MVJD 2HGSA 5FT9A 1P2DA 3FCUB 2HPHA 2PS3A 4E2FA 1T2EA 4EI8A 1GD1O 1X8XA 4ZQGA 3QEBZ 4F2DA 4XARA 2CHFA 2DQYA 2SKEA 3NBXX 2PUTA 4OSPA 3TUIC 5JLJA 1X87A 2KLBA 4P83A 4DJJA 4FE3A 4UCWA 3IPAA 4P7JA 3R77A 2WVGA 4EARA 2YY5A 5GMOA 1EVZA 1HQCA 1OH8A 1DJOA 5JYEA 2Z09A 2HA7A 4PLWA 3DBHA 1VJRA 3OBIA 3BBPA 3F73A 4XM2A 1F0PA 5H70A 2FMUA 2NOAA 5EIHA 3ZD6A 1E1CA 2ENWA 1W88B 2VYQA 4Y1RA 3DE2X 2HREA 3DTTA 4JNKA 4N5HX 1UP4A 3I5MA 4R2LA 3KO8A 1M34E 4TYQA 4CKYA 1IXKA 4XKJA 1I7NA 2NTYC 1RBZA 1XD8A 2EZ9A 3TQHA 3I83A 1OFTA 1U4NA 1W5FA 3HU5A 2VP0A 4EZEA 3HNRA 4I6GA 4A92A 3A9SA 4EL5A 3EBPA 4E4YA 3QWBA 3M1LA 4B3HA 1RQ2A 1RT9A 3C5EA 4QBTA 1FRFS 4DQUA 2PUCA 3AI2A 4LBWA 1BWPA 1DPFA 2I4LA 2LWIA 4MVJE 2PX3A 1QH1B 3JRWA 2LKCA 4H08A 2XT9A 5JSZA 2XGJA 3OF3A 4KAAA 4MICA 4O8CA 1UBSB 3R7WA 4ZYXA 5DM2A 2NV6A 2NACA 1IH8A 1JEQA 1LXCA 5EHZA 5I7RA 1D2RA 1PE0A 2VWQA 3GD5A 4OHRA 3STVA 3U16A 2BLNA 5TQ2A 3ORQA 3MWEB 1CBUA 3BTOA 4GM1A 5IBPA 4ZXPA 4HNHA 2AE1A 5LA6A 2BDEA 4IHJA 5C8XA 5HIAA 1O96A 4GC9A 2X42A 5DV9A 4XX1A 2BFAA 1G8FA 3A2NA 4RQAA 2CBZA 3QG1A 4TUYF 1GYPA 3ZIAD 3TGLA 5CCBA 4BO5A 1GUAA 1N5MA 3IERA 4I55B 1NP3A 1U8AA 1OASA 3L4EA 1P77A 5BPFA 2PHZA 5K3BA 3HCDA 1TYZA 1AOXA 1Z7EA 4MPRA 4R8SA 4D79A 2HUNA 2IGBA 4NBTA 3GPBA 3TSCA 2WPDA 4UU0A 1RRFA 5BNTA 1MBZA 4RD4A 2Q3EA 5K6AA 3DEJA 2ZI6A 4BECA 4F6CA 2BFNA 4Z7QB 2VRBA 7AT1A 1E5LA 2P1ZA 1HNNA 1ZN7A 3VR4A 4FSDA 4PZ9A 3BRWD 3MBIA 3T3GA 2DVMA 1LLCA 1P5ZB 3CLHA 5FWYB 3DM9B 1FNMA 2W6ID 3CV3A 4XOUA 1P4SA 3K0FB 3LSTA 3AFNA 4AS3A 1E3QA 1P2UA 2CW5A 4O0LA 4M22A 4XH9B 5BWCA 2EBWA 3EVBA 3W8DA 2HSEA 4LZLA 2P9JA 4RK1A 1RXVA 5B4TA 1GZSA 4RDCA 2BI7A 3YASA 2C92A 2FCAA 3A31A 1P5HA 1GPDG 2JFVA 4HUQA 4M99A 4QXPA 4XAQA 5EGNA 3SQLA 4PHFA 5BWOA 1HYGA 2ZAGA 3QIAA 1F06A 4EFMA 1EFLA 1PCXA 4K6FA 1MG5A 1BN7A 1RABA 3LBHA 3T95A 3K05A 2AMLA 1PZXA 1J2JA 4LECA 3LDUA 5HRUA 1FP6A 2FUG1 1TYCA 3IA2A 3WL4A 5AQ1A 3W5VA 1ZRSA 2C07A 3R6TA 3KJGA 5FUYA 3PICA 3F5QA 2F8MA 3LRPA 4JFRA 5LM3A 3UMJA 1X9IA 1JZQA 1E8NA 1ZBDA 2NSJA 2QAGA 4COKA 3GP8A 4LJYA 3DXFA 3OA2A 5FUWA 3ZE6A 3L49A 2H0QA 1G7TA 3NWOA 4GPBA 2O8CB 1GT6A 2CNLA 3GIWA 1U7XA 1X7YA 4RESA 4M36A 3G0DA 3T5GA 1N9GB 1QC5B 1QRSA 2O07A 1FX1A 3CURA 3GGCA 1L4HA 1Q0HA 1O9GA 3OFND 1XDSA 4UOQA 4ENPA 5IARA 1DSSG 2CY0A 1UFVA 2AN5A 3EMVA 1TM3E 3T1OA 3VOBA 1F2TB 1QV9A 1DTWA 2O7VA 1YL5A 2Z6UA 2P6UA 1KAGA 1TCAA 4HDOB 4YRFA 1U4OA 1OFUA 3KALA 5C53B 1A0OA 2IEYA 1RXUA 1OV4A 3A1NA 1HORA 3F4LA 3IOYA 3NYWA 1JDUA 1TT7A 1LEHA 3E22B 3ZDQA 1TU4A 1BRMA 4D9JA 3TGPA 2SECE 2IOHA 3JQ8A 3FNIA 1DNPA 1WNTA 4WK2B 3N86A 5JAPA 1N5OX 3MJ4A 2Q28A 2WZQA 1WL8A 3LQ1A 4HO1X 5KJFA 2B9EA 1N2EA 3GVIA 1P33A 2GN6A 4E5VA 2PUFA 4E94A 2I34A 4EKGA 4OK5A 2A5YB 3E5HA 4BNDA 4ARAA 3IBYA 4ZYVA 1NFFA 1ODSA 2WKWA 3MW8A 1GKLA 3CYFA 3MXTA 1MLDA 3EFEA 3E1KA 1WVMA 1QGUB 5CNKA 5C4GB 1ES9A 1ULTA 3MWDB 4OJYA 3VVCA 4O4JA 1ZIPA 2FZLA 4D02A 2RI0A 1I3LA 3WIOA 1SHZA 4NE7A 3EPHA 3R2JA 4B81A 2GZHA 2PS0A 3LVFO 5EP3A 1GN8A 1P62B 3HB0A 2FRVA 3IAUA 3OJXA 4J9VA 3KSBC 4EPVA 4JL5A 1XAJA 4KBGA 3S44A 4M89A 1CZUA 3TM5A 4YAUA 4M53A 3P2OA 4ERNA 3OPYA 3HA3A 2RE8A 2O8EA 2NQ8A 1NX6A 1UBCA 1ZAKA 2MSKA 5DRTA 5AVUA 3QVVA 1NYRA 1P7CA 1WB5A 3CSUA 3DHNA 3UAXA 4C6SA 1L5YA 1WD7A 4OFWA 2IHUA 2FR1A 2X3UA 1J49A 1WDWB 2COEA 1L5FA 3QUBA 1P0CA 2QUZA 4YJ3B 3FM9A 3IB3A 3ICPA 5ALOA 2DPXA 2HD4A 3T3HA 1U8EA 4HMOA 4PG5A 1ZM9A 2G82A 4FMDB 3ZV5A 5U9CA 1GLNA 1RXCA 3P0HA 1ZD8A 1UBHS 2G9UA 4YIKA 3OFVA 1YO6A 1ZM4A 1QLWA 4LTNA 3EDOA 4LZZA 1KJYA 2AFHE 1SG6A 3VR4H 1AN0A 4FHDA 3AI7A 4WXEA 2X5KO 4BP9A 3A6ZA 2K2WA 4WKOA 4ZV7A 1OIWA 3E6AA 3G49A 2IBSA 1M1NA 2CFRA 3EVTA 3PHHA 4GP6A 1QIIA 2QZSA 3C14C 4WNIA 4AWXA 3T5PA 3SMQA 3QU9A 1ESCA 3LM8A 1S3FA 3WYEA 1BJRE 4PCLA 4UKDA 4ZT5A 2BTQB 3W2GA 1GSHA 3LDHA 4FCTA 4INZA 2QY9A 3B1VA 3NVMB 3NWEA 2GDZA 4KAJA 2QD1A 2Y1CA 1Z0AA 3REGA 3TZBA 3O82A 1NFQA 4NOLA 2X6TA 4RFVA 1MABB 4LHXA 4KRGA 1QHGA 3LFUA 1HT0A 4DNPA 4YRPA 3DBRA 3WL6A 2OZPA 4PLCA 4U6NA 2Z2IA 4CM1A 2J5BA 4ZT3A 4JI4B 2XHZA 1DAFA 2A5JA 2XUAA 3GEMA 4L1KA 1RAGA 1Z8DA 5KCMA 3NFRA 5KNDH 4RY2A 5DGIA 2P8SA 4MIYA 2VT3A 3NP7A 4CCWA 1GPNA 5KX5F 2B8WA 3VR5A 3OO1A 4QU9A 2OXEA 4G1VA 5AW2A 4JUFA 4NYIQ 4LGVA 1ZIYA 1LB1B 1QH9A 4ZVNA 4C0HA 4NS4A 3MMZA 3WXBA 2JVJA 3FCXA 5JD3A 4J1NA 3OA0A 4HPWA 3RQIA 3PEFA 1E6EA 1W85B 3V8QA 4MWDA 1D8TA 4JN6B 4RJIA 1P60A 2ZTSA 1IXYA 1IZ9A 1VPDA 4E7PA 4EG8A 2E4XA 5E1BA 3RABA 4QSMA 3SZUA 4TLDA 4MV3A 1DJLA 1ZNXA 5EESA 2WT4A 1HL3A 1ZX1A 5JNSA 1T9DA 4PO9A 3K2EA 1EXMA 5F5XA 5FD8A 1G63A 2FEXA 1JH9A 1T5HX 5DWQA 1Z0ZA 4IYJA 4AYTA 2J5RA 1O03A 1Z07A 2YBEA 2P3LA 3H1FA 3K0AB 3X1KA 3A6EA 5CB6A 2GCPA 1LA2A 1ZK2A 4H7IA 1ANKA 1DELA 2PPVA 3L79A 4IWYA 4PC6A 3JD0A 3L0ZA 4YDRA 3SS8A 1XYVA 3HB5X 2FK8A 4FYXA 4NZZA 3GI1A 5IW8A 2OO7A 4XYEA 5K2MA 3SYRA 4YAKA 3MSCA 2X58A 2ZAIA 4GPAA 4AU1A 3KSRA 2E4AA 1PZNA 1N3IA 2Q3LA 2VP3A 4UJ5A 4W8OA 4UNNA 3ZZ1A 3AW8A 5EP2A 3RSGA 5JYDA 3H2SA 3SP1A 3I2HA 3LKDA 3P45A 3KQSA 4TKLA 1RC1A 3FWPA 1DDGA 4ABYA 3DSRA 3O90A 2W2MA 5CM9C 3AI3A 4EHIA 2ONZA 2AYZA 3E48A 3KSDO 4G25A 4PZZA 4C3OB 2XZTA 2X1MA 4O33A 2UZ4A 2EERA 3O4IA 1U28C 4GX0A 3HMKA 2F8TA 3INRA 4FD2A 5JG7A 2SICE 1G291 1B2RA 3H6KA 3K9WA 2VPIA 4J0IA 3GEBA 2P4HX 4ZWNA 2A9KA 2GB4A 1OI2A 4K6HA 4F45A 5EUMA 3I4FA 1PJ8A 2C2YA 2KYRA 1VSBA 1W1IA 2D3WA 2IHVA 3A37A 3X1XA 1Z4JA 3U26A 2RGRA 3OJFA 3BJEA 2AYXA 3IJ5A 4KXYA 1M6YA 3LX5A 3ZI0A 4TRNA 3VSDA 3SOPA 1H93A 4FP9A 3S1AA 3T7RA 2G4VA 3W9BA 2AZXA 3F0TA 1OQAA 2Y0PA 3NNSA 5IAGA 1HE2A 1KVRA 4N39A 5ICCA 3TR5A 3I1FA 1N2ZA 3I1IA 1NXSA 1G7SA 4H7KA 4JMPA 4BE7B 4DLNA 2I3GA 2HJGA 1LF5A 3KLMX 5DP1A 1SOMA 4TN1A 3U09A 4GLJA 4MIEA 1SVUA 2IV2X 3SC3A 1ABEA 4LWOA 2AVNA 5DTEA 1R50A 2A0KA 5ITVA 4QOHA 1K8QA 1U8UA 4JFAA 3B1YA 1CVIA 4NJEA 2ZUFA 2WUEA 1FS4A 4HV4A 4IJVA 5CLGA 2W2XA 1AK9A 1IEVA 2ACKA 2GARA 3ACCA 3DEZA 1PZHA 3LBYA 4KMMA 4JBLA 1BFKA 4GWLA 4UNPA 4AP6A 5KYYA 3EVFA 4CKWA 3DPIA 2VAVA 3AVVA 4KV9A 2YW9A 1VA5A 3MB8A 1R9NA 1GL6A 4TT8A 4R68A 4LF5B 1OY1A 2AI2A 3FTEA 3TCKA 2RHRA 4WXYB 1XRRA 3G2QA 3GAAA 1C7RA 2NWQA 3JD2A 2C4HA 2QUBA 2VQDA 3NC0C 3OPNA 4L0MA 3T7IA 4PO8A 3FSEA 4HS9A 4EX7A 5KYKA 5CW1A 1OLSB 2AJCA 2VP4A 2GTIA 4PHTA 4XFKA 1AKMA 3FYCA 3CRW1 1CS0B 5J63A 4G24A 1Y6QA 2ZU6A 4MGHA 4TV9B 1ODFA 2K6GA 3JCZA 4CLOB 5JI2E 2FH5B 4X44A 4DKJA 2EG5A 1TADA 2JGIA 2N3ZA 1XPRA 2I2XB 1UC9A 5ELLA 2C3YA 3WGUA 3RYHB 3E27A 3VKUA 2Z2KA 3VR5H 2HXSA 4YCJA 4D3ZA 3V48A 2D2XA 3DEAA 4Q9DA 1WUJS 3Q3VA 4IVRA 1A9PA 4PSUA 1ORIA 3VPBA 3IMFA 3NDPA 4KU4A 3CZRA 1Z63A 2V65A 2Q8NA 4UZFA 2E6KA 5JCOA 4EKIA 3MB5A 3OC6A 2Q2QA 3A1VA 4U2FA 4DB2A 1GGEA 2QY6A 2F1HA 4HBZA 1JSRA 4WKNA 4G0VA 1GN9A 2NW6A 2OD7A 2XJ9A 4X64B 4GOND 1POWA 3SEQA 1CUDA 4DSAA 1CUFA 3AP3A 4QODA 3GHHA 4JROA 1L5RA 2ADMA 2IOYA 2WFLB 3TX2A 3WR5A 3U4QB 3RARA 1E0AA 3AJEA 2I6XA 1PR0A 3L0OA 1NF8A 1XC7A 2BHLA 2YS7A 3EF0A 3PDJA 4WZBB 3RKUA 4E13A 3NAQA 1ZHHA 5L4LA 4MUKA 1GDTA 1Y6GA 4LZJA 2WIFA 4P08A 3DE3X 3LK7A 1UWCA 1T1SA 1EX7A 1R9JA 4N9QA 2HHAA 4TZKA 3UK1A 2BSQA 1FFCA 1U3UA 4HSGA 3EQ8A 4JBIA 2XA9A 2XITA 1O89A 2ES4A 4NBNA 5EIWA 3KU4A 5I7AA 3SOZA 3WIEA 2XGOA 3Q7EA 4PG6A 5T6MA 3RH0A 1BC5A 3RRZA 3VSEA 4YT2A 2BKLA 3W6PA 1HOTA 5CDFA 2G1AA 1CR2A 3GRKA 5A1TA 2Q6LA 4EABA 4WN9A 1QLHA 3MJHA 1VKNA 3ZI7A 3MELA 1F8GA 2AFIE 3FPHA 3OG9A 5G0UA 3RSOA 4ZI7A 4JDPA 2MSDB 2QM7A 4MROA 3SR3A 1E2IA 2O1SA 1CDOA 4KCGA 4LXYA 1LDMA 5GZ3A 1YRWA 2C5GA 3WSTA 1F6BA 2QYTA 2C96A 4FFOA 4J7UA 2H1OA 1GOTA 4BY9E 3RD5A 2H5EA 1V7PC 4R2WA 1E98A 2HLNA 5CRIA 3BF8A 1H9AA 3PC3A 5CNMA 4NPHA 1AZTA 3VAZA 1AV6A 4P3PA 1H4SA 2QLBA 3G2KA 4KQFA 4EJ0A 4QT4A 4ZYTA 2PX4A 1P81A 5C3MA 2REQB 5C8DA 5HCUA 1G38A 1YJ5A 3E7XA 5D2CA 4ROSA 1ESZA 4AKHA 2O2ZA 3SHTA 1G3QA 3EMKA 1UBEA 3JWJA 4RKQA 2V54A 4HAWA 3X1YA 4BQQA 4QVIA 3JZIA 5T57A 2I76A 1W47A 4P92A 1B23P 4F1WA 2Q3FA 1KE2A 5AUNB 1DDOA 4ZTZB 3SQXA 1K8YB 1K7YA 3EXG1 4KXMA 4AKEA 3UXEA 3DTVA 1CWUA 4NYMR 1F9AA 4MA0A 4C0BA 3JYQA 1ST3A 1T9CA 1Y4UA 3KKPA 1G20B 1LK0A 2RAPA 4PLZA 1RWXA 3KX2A 4AJ2A 5JFOA 1E3TA 4C7BA 2ZU0C 3PRKE 4RA6B 4V03A 4C30A 4GYJA 5L3SB 4WEQA 1D1PA 4XDZA 1L4YA 2B36A 1DKLA 2I6QA 3PDIB 1KOJA 2GILA 4OOEA 5CM8B 3RTCA 1TTHA 1Y3BE 2CLHB 3QUQA 1ODKA 4LCJA 2A9PA 4K6CA 4F2PA 1JLLA 1IUPA 4RY0A 1WZIA 1YAHA 1KYZA 3C39A 4RK0A 3ZE0B 1VRVA 3K0CA 4MVJM 3DL4A 4QQKA 4C5CA 4MKFA 3TD6A 4EF4A 4HAZA 3WDMA 3RAGA 3QJYA 2H4YA 3IHWA 2C5SA 1WCXA 2ZRAA 2VZ8A 4EHAA 1WSWA 4YP6A 2Y27A 3COSA 2B61A 4OQQA 1KZHA 3GFQA 1XYGA 4YMTA 1A50B 1PR5A 3LUBA 4UM7A 4BLWA 5F7OA 3E1GA 5KNCA 4UFOA 2PL1A 3E3LA 3ZGLA 2O4UX 4PV7A 3RYTC 2F9FA 3DAHA 1CCWA 3TW8B 4JELA 3RUHA 2QL7A 4CF3A 4MRMA 3P52A 4HEA6 2X6RA 5H3CA 4U2BA 5BYAA 1JLRA 3EZ7A 2GCNA 2JVIA 3O94A 2OZKA 3BXGA 2PMBA 4R71A 3W8NA 2YJTD 5FIUA 1GTG1 2B4AA 3O95A 4WLEA 1PIWA 4BAUA 4P0TA 1VYVA 1TKBA 1ZHFA 2PCLA 1L7VC 2VDUE 2OGWA 3VR6A 3W6ZA 4AZSA 1P8JA 4Q4CA 1T5DX 3DWIA 2Y8EA 5JNRA 4JX9A 3ZX5A 3GR6A 3LUKA 3KHTA 4KKXB 4Q5IA 3ED5A 4GRAA 5EKUA 3PQCA 4QXRA 4A27A 4ZDIA 3WLKX 1NP7A 3D4IA 3KLPX 4PTLA 2QTRA 5FOUA 1UBKS 2J3EA 1ICIA 1V2HE 1M6EX 2CF5A 4WKCA 5EZQA 1QUEA 3MAJA 2VSXA 1QE0A 3L8EA 1XMVA 2E82A 4M37A 1NVGA 1H0HA 3IB6A 4AJ9A 4FK8A 4YUVA 4TS3A 1ZPDA 3QKRA 3HU1A 1UXOA 1X8LA 1S8FA 1ZN8A 5BN5A 1VZ3A 3TMKA 4G9EA 1U2GC 1YVEI 5L95A 1VL8A 3VO9A 4CUZA 2OBBA 5LYYA 2I2FA 4L5AA 2R0QC 4FUQA 2ACVA 5CLJA 2B1JA 3JR7A 1YE5A 2JGLA 4Z49A 1JVNA 4D25A 4RA9B 4DBLC 2AX4A 4RIFA 3KKLA 3EX7C 1R0ZA 2DCUA 2H57A 4FMCF 3TF5A 4CEIB 1JEJA 1V7QA 3OFJA 3QXGA 3DH0A 3I42A 1SUEA 4YMHA 3F3SA 4EJSB 2VWHA 1FNBA 5F76A 5ADUS 3AVXA 4UHDA 1EUCA 1ESDA 1OBFO 4CTMA 3AVYA 5FJJA 3VSCA 2A92A 3QU5A 3LIIA 2YXPX 5AOAA 1XVVA 2WT9A 4MQ6A 4V3BA 1L5LA 3TZKA 4UQLA 3MOGA 1RWOA 2JDIA 3Q7RA 1QXSA 5ALEA 2VXOA 1CLUA 1H22A 2AUTA 4QUJA 3W5UA 1I6MA 5CTAA 5CM2Z 2UV8A 1VPLA 1FSFA 3KVYA 2WU8A 1ZAYA 3K16A 1L4BA 2O0KA 1IWPB 1U02A 2JIZD 1GPUA 2OILA 5TXGA 2H08A 4JYBA 4Y2PA 4TTJA 4R3UC 4CLRB 2QI9C 5BSKA 1Y3HA 1EDDA 3CO0S 3G82C 4B3IA 1LPOA 2CGEA 1MB3A 1G5FA 1NW7A 1Z8FA 1VSTA 3A36A 3FUCA 1K4MA 3CWZA 3HXOA 3PE4A 1RE1A 1EP1B 1KNXA 1QX3A 1UJCA 1Z4MA 4L07A 4H31A 5INTA 1ZKDA 3HJGA 2Q5CA 1ISRA 1HLDA 4R9SA 2ZSBA 3WNVA 3KPWA 4KAFA 1BGVA 1KMIY 2OXFA 3BXHA 3PQEA 2OK8A 4XSGA 3RC7A 1Y0BA 4KDRA 2BEKA 5BVGB 3LQ2A 3NC4A 3ZWCA 2ZJ5A 1Z62A 2RK4A 4MQ4A 1I3MA 4BMCA 1CEXA 1J0XO 4NDAA 3NH6A 1AH2A 1CTQA 3AESA 1FRZA 2C2OA 1WY5A 5BN3A 5IC4A 5JY6A 5JASA 2BVNA 1C14A 5ALDA 1QF7A 1T29A 1VE3A 2FDXA 3PUHA 3GLGE 5JZOA 4REQA 1X7ZB 2W6CX 3BM5A 4ND4A 3RBVA 1G41A 2QW0X 4IV8A 4C0XA 1RKVA 1NUHA 1E8MA 1OZHA 1ECCA 2JK0A 3G2MA 4ZAFA 5FF9A 3GD7A 1WMBA 2C54A 1I2MA 5K51A 1EDOA 4GMDA 4BVJA 3GN2A 5CFQA 1JR3D 3WLJA 1GDHA 3PXBA 3T3NA 1GAWA 4YRIA 1XDUA 4JCOA 5L9AA 4ARCA 1K0FA 1P74A 4FX5A 1LTQA 2OO5C 3AIIA 4MA4A 5F3RA 3BMCB 2HHJA 4CLEA 5KKNB 2YUIA 1ZQ9A 1KZ6A 4M0UA 1UOPA 2PM8A 2X8JB 3GUVA 4NL4H 1J22A 3L0YA 4IDOA 2DERA 3ICQB 3H2YA 1BCRA 5CFZA 1N6KA 1L8AA 2WYWA 3E82A 1S2OA 3MLEA 4M7WA 3WY9A 3DBVO 2YIMA 4H7HA 4MPPA 4CDMA 2EIHA 8ATCA 5IT9A 1VMAA 1P9OA 1HDZA 1YJQA 1OOEA 3L7CA 4P4UA 1EBUA 5LVAA 3P9ZA 5FHRA 4MHTA 1NQOA 3G9QA 5FL7A 3KAPA 4MQLA 4O6VA 1JPVA 3VR6H 2HHCA 2OQ2A 2QL9A 2O7SA 4DMHA 5D3ZA 2FVYA 3WGYA 2IYYA 1X0VA 4K9NA 1O94C 2ICAA 3L4JA 2CFSA 3AF4A 5D5HA 1RDFA 3PXEA 1FTQA 1DOHA 1U1EA 1NI5A 1R4NB 4LRQA 2WWVD 3VJLA 2O52A 4G5SA 4MVXA 5IRCD 1YZQA 1UDWA 2VZLA 2PRZA 2XV1A 1HDCA 1JR3E 6REQA 4BNVA 1L0BA 2J9YB 3NPMA 4C6TB 5WRFA 5KOJA 3QHQA 4HZIA 5CAEB 4UNSA 1NDHA 4IQ4A 4IUDS 4V1CI 1SM4A 1G1AA 1XT6A 4QU0A 1CZHA 4N65A 3GDOA 4NOKA 3HLYA 4XZ3A 1Q83A 3AHGA 3Q0IA 1UEJA 4YCAA 3O91A 3L43A 2J30A 2O0MA 3NBYC 3PU6A 2IBTA 1J5XA 2VRNA 3CWQA 3LCMA 3ZHCA 1HT2E 2J0QA 4KE8A 2J31A 3R24A 1ZGCA 2J7KA 4Q47A 4F11A 5A5VA 3GH1A 3MUFA 2ORVA 4M9RA 3C7CB 4I4TA 4PANA 5EAIA 2DKNA 3QPUA 4QATA 5JFTA 4TYWA 4MP8A 2Q5FA 1VL6A 1J0EA 2XE6A 3IS3A 5IT4A 2ZANA 2QTHA 3ZJTA 3AF2A 5H4HA 5K0BA 2J6CA 4BWGA 5KYNA 3OOWA 3C7KA 3LC2O 4R1TA 3NTLA 5JO9A 1R0KA 1GQFA 3HBNA 3I53A 4P31A 1J0AA 2IYPA 2DWOA 4GUDA 4MI1A 4PQEA 4V2IA 5TGTA 3ZWYA 5FOTA 2EBUA 2CHUA 1EFKA 2P79A 1GIAA 2JH3A 4ND6A 4ND3A 2PZAA 2X0EA 5LA6F 2DTDA 4IHJF 5KWIA 2D0PB 2FSHA 2GN4A 4LRWA 3W77A 2X0NA 5A05A 4C03A 4DR6B 3THWB 4AQDA 2IPLA 1IVSA 5FUBA 2G07A 4YI3A 3ZHYA 1P73A 3C5CA 4DV3B 5JNUA 4PGHA 4NCNA 2UYGA 1AHPA 3N2KB 1FXUA 4AF6A 2H6EA 2YOFA 2C5AA 5EZSA 4CL8A 3M89A 4MEBA 1WB6A 2C57A 1VHLA 2WK1A 2WZCA 3PXGA 1K88A 2B82A 2OCLA 3JWHA 3R0VA 4FX2A 2HZ7A 3ZDRA 2LCIA 2NUPA 3DGFC 4C6HA 1JHQA 4DXHA 3LCUA 4UE2A 1UMBB 4FNAA 5LZ9A 4KDCA 2DYKA 1C4WA 3LZCA 4QA9A 1WD5A 3W5JA 4XUDA 3FWHA 1NF9A 1IZ7A 2YVAA 5FULA 4C4ZA 4D9CA 4HGYA 1LX7A 4OX9B 3HJAA 3I6BA 3LBFA 3NJ8A 4B85A 2XE7A 4G07A 1UOOA 4FYYA 4RY8A 1N2BA 2ZCJA