4F59A

Triple mutant src sh2 domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
DSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETVKGAYALSVSDFDNAKGLNVKHYLIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Superbinder SH2 Domains Act as Antagonists of Cell Signaling.
pubmed doi rcsb
molecule keywords Proto-oncogene tyrosine-protein kinase Src
molecule tags Protein binding
source organism Homo sapiens
total genus 29
structure length 108
sequence length 108
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4f59A00
1SHBA 3CBLA 4GWFA 4EIHA 3S8OA 1AYBA 1LUNA 1BLKA 3VS2A 2EYZA 2LCTA 2PNAA 1A07A 1SPRA 1UUSA 4H1OA 5EHPA 3CXLA 4F5AA 1GHUA 2FCIA 3PSJA 2HUWA 1QG1E 2EKXA 1R1PA 2FO0A 1R1QA 4JGHA 4WWQA 1AYCA 1O45A 2IUIA 1CWDL 3ZNIA 1O47A 3M7FA 1O4CA 1B47A 2Y1MA 3OB1B 5HKZA 1RJAA 4DGPA 1SPSA 2MQIA 4F5BA 2AOBA 4QSYA 3OV1A 3US4A 2QMSA 2HMHA 1O4EA 3BUNB 2ABLA 3VRYA 4FL2A 1KC2A 1Z3KA 5AULA 2KK6A 3TKZA 5DC4A 1O4BA 2YU7A 3VS6A 4H34A 1NRVA 3MXCA 3UYOA 1BHHA 1O4AA 3VS1A 2Y1NA 2K79B 2RVFA 1CJ1A 2LNXA 4OHHA 1GRIA 2C9WA 1TCEA 1H9OA 3PS5A 1BHHB 2IUGA 2B3OA 1BLJA 5DC0B 1BM2A 1KA7A 4OHIA 3IMDA 4JEGA 3VS4A 4U17A 2DVJA 1HCTB 2AOAA 1O4NA 1O4PA 3MAZA 3PQZA 2CRHA 1X27A 3MXYA 1YVLA 2RMXA 3VS3A 3PJPA 5KAZA 1PICA 5D0JA 1BKLA 5AXIA 2H8HA 3GXWA 1CSYA 2BBUA 3C7IA 4GPLB 5CDWA 1OPKA 3IN7A 2DCRA 4NWGA 2K7AB 3VS5A 4OHDA 1RQQC 2SRCA 2CR4A 1BMBA 4A4BA 4K44A 1JYQA 1G83A 3HIZB 5DC9A 1MW4A 2MRJA 1MILA 3BUMB 2DX0A 2HDVA 5DF6A 2L4KA 4K11A 2HDXA 3GQIB 4XZ1A 2C0TA 1R1SA 2MRKA 3VS0A 1O43A 2OQ1A 2XP1A 2KNOA 3K2MA 1O4OA 1BG1A 1K9AA 1JU5A 3PFVA 1M61A 2EYVA 1KA6A 4P9VA 4OHLA 1JYUA 1M27A 5IBSA 1D1ZA 2H5KA 1JYRA 1O46A 3T04A 3CD3A 3N7YA 5EHRA 4EY0A 5IBMA 4FL3A 1QCFA 3VRZA 1LUMA 3QWYA 1A81A 1FBZA 3UF4A 2PLDA 1KSWA 2DLZA 1A08A 1FHSA 3S8NA 2VIFA 1IJRA 1X0NA 2L3TA 4LUDA 2LNWA 2GE9A 1CWEA 1D4TA 3GXXA 4ROJA 3VGOA 1O49A 5EEQA 3IN8A 1LUKA 1FMKA 4L1BB 1BFJA 2HCKA 3WA4A 3BUOB 1P13A 2C0OA 2CBLA 3VRQA 2PNBA 4E68A 1X6CA 3BUWB 1LKLA 3OB2B 4GL9E 3PSKA 4TZIA 3VRNA 1O42A 1AB2A 1SHAA 4A4CA 1O4QA 1O4KA 3TL0A 1IS0A 4OHEA 1AYAA 2CS0A 1O4JA 5HKYA 3OVEA 2EOBA 1CSZA 3OP0A 3S9KA 2H46E 4XZ0A 4M4ZA 2EU0A 2AUGA 3KFJA 1O4DA 2ECDA 4FBNA 3NHNA 1A1EA 1OPLA 1JWOA 3VROA 3VRRA 1XA6A 2YSXA 1O4FA 2C0IA 2SHPA 1BFIA 3HHMB 2GSBA 2EO6A 1O4HA 1BF5A 5J3XA 1UURA 1FYRA 2IUHA 2PTKA 3HCKA 1A1AA 2DLYA 1O44A 1HCSB 2CIAA 1Y1UA 1O4GA 1YVHA 3EAZA 4X6SA 2PLEA 1NZVA 5GJIA 3QWXX 1SHDA 4K45A 1F2FA 1O41A 2DM0A 4NWFA 2LQNA 3EACA 5GJHA 1WQUA 5EG3B 2RORA 2MC1A 2ETZA 1O4RA 2MK2A 2JYQA 5HKWA 1LCKA 3BUXB 2EL8A 1QADA 5EELA 4U1PA 5BO4A 4K2RA 1OO4A 1O4IA 1F1WA 2IZVA 3VRPA 1AD5A 1AYDA 1BHFA 1FBVA 4LUEA 1SKJA 3CWGA 1I3ZA 4D8KA 3N8MA 1O4LA 1Y57A 2LQWA 2Y3AB 2L6KA 3PLFB 2CI9A 4E93A 1D4WA 1AOTF 1FU5A 1AOUF 1ZFPE 1BKMA 5I6VA 4P9ZA 4F59A 1LKKA 3IMJA 1A1CA 1O4MA 1FU6A 3VS7A 1LCJA 1TZEE 4DGXA 3BKBA 1RPYA 2OZOA 2RSYA 4JE4A 2CI8A 2EO3A 1OO3A 3N84A 1A09A 1A1BA 1LUIA 2EYYA 3S8LA 1O48A 1NZLA
chains in the Genus database with same CATH superfamily
1SHBA 3CBLA 4GWFA 4EIHA 3S8OA 1AYBA 1LUNA 1BLKA 3VS2A 2EYZA 3K2TA 2LCTA 2PNAA 1A07A 1SPRA 1UUSA 4H1OA 5EHPA 3CXLA 4F5AA 1GHUA 2FCIA 3PSJA 2HUWA 1QG1E 2EKXA 1R1PA 2FO0A 1R1QA 4JGHA 4WWQA 1AYCA 1O45A 2IUIA 1CWDL 3ZNIA 1O47A 3M7FA 1O4CA 1B47A 2Y1MA 3OB1B 5HKZA 1RJAA 4DGPA 1SPSA 2MQIA 4F5BA 2AOBA 4QSYA 3OV1A 3US4A 2QMSA 2HMHA 1O4EA 2LRAA 3BUNB 2ABLA 3VRYA 4FL2A 1KC2A 1Z3KA 5AULA 2KK6A 3TKZA 5DC4A 1O4BA 2YU7A 3VS6A 4H34A 1NRVA 3MXCA 3UYOA 1BHHA 1O4AA 3VS1A 2Y1NA 2K79B 2RVFA 1CJ1A 2LNXA 4OHHA 1GRIA 2C9WA 1TCEA 1H9OA 3PS5A 1BHHB 2IUGA 2B3OA 1BLJA 5DC0B 1BM2A 1KA7A 4OHIA 3IMDA 4JEGA 3VS4A 4U17A 2DVJA 1HCTB 2AOAA 1O4NA 1O4PA 3MAZA 3PQZA 2CRHA 1X27A 3MXYA 1YVLA 2RMXA 3VS3A 3PJPA 5KAZA 1PICA 5D0JA 1BKLA 5AXIA 2H8HA 3GXWA 1CSYA 2BBUA 3C7IA 4GPLB 5CDWA 1OPKA 3IN7A 2DCRA 4NWGA 2K7AB 3VS5A 4OHDA 1RQQC 2SRCA 2CR4A 1BMBA 4A4BA 4K44A 1JYQA 1G83A 3HIZB 5DC9A 1MW4A 2MRJA 1MILA 3BUMB 2DX0A 2HDVA 5DF6A 2L4KA 4K11A 2HDXA 3GQIB 4XZ1A 2C0TA 1R1SA 2MRKA 3VS0A 1O43A 2OQ1A 2XP1A 2KNOA 3K2MA 1O4OA 1BG1A 1K9AA 1JU5A 3PFVA 1M61A 2EYVA 1KA6A 4P9VA 3LYVA 4OHLA 1JYUA 1M27A 5IBSA 1D1ZA 2H5KA 1JYRA 1O46A 3T04A 3CD3A 3N7YA 5EHRA 4EY0A 5IBMA 4FL3A 1QCFA 3VRZA 1LUMA 3QWYA 1A81A 1FBZA 3UF4A 2PLDA 1KSWA 2DLZA 1A08A 1FHSA 3S8NA 2VIFA 1IJRA 1X0NA 2L3TA 4LUDA 2LNWA 2GE9A 1CWEA 1D4TA 3GXXA 4ROJA 3VGOA 1O49A 5EEQA 3IN8A 1LUKA 1FMKA 4L1BB 1BFJA 2HCKA 3WA4A 3BUOB 1P13A 2C0OA 2CBLA 3VRQA 2PNBA 4E68A 1X6CA 3BUWB 1LKLA 3OB2B 4GL9E 3PSKA 4TZIA 3VRNA 1O42A 1AB2A 1SHAA 4A4CA 1O4QA 1O4KA 3TL0A 1IS0A 4OHEA 1AYAA 2CS0A 1O4JA 5HKYA 3OVEA 2EOBA 1CSZA 3OP0A 3S9KA 2H46E 4XZ0A 4M4ZA 2EU0A 2AUGA 3KFJA 1O4DA 2ECDA 4FBNA 3NHNA 1A1EA 1OPLA 1JWOA 3VROA 3VRRA 2KGYA 1XA6A 2YSXA 1O4FA 2C0IA 2SHPA 1BFIA 3HHMB 2GSBA 2EO6A 1O4HA 1BF5A 5J3XA 1UURA 1FYRA 2IUHA 2PTKA 3HCKA 1A1AA 2DLYA 1O44A 1HCSB 2CIAA 1Y1UA 1O4GA 1YVHA 3EAZA 4X6SA 2PLEA 1NZVA 5GJIA 3QWXX 1SHDA 4K45A 1F2FA 1O41A 2DM0A 4NWFA 2LQNA 3EACA 5GJHA 1WQUA 5EG3B 2RORA 2MC1A 2ETZA 1O4RA 2MK2A 2JYQA 5HKWA 1LCKA 3BUXB 2EL8A 1QADA 5EELA 4U1PA 5BO4A 4K2RA 1OO4A 1O4IA 1F1WA 2IZVA 3VRPA 1AD5A 1AYDA 1BHFA 1FBVA 4LUEA 1SKJA 3CWGA 1I3ZA 4D8KA 3N8MA 1O4LA 1Y57A 2LQWA 2Y3AB 2L6KA 3PLFB 2CI9A 4E93A 1D4WA 1AOTF 1FU5A 1AOUF 1ZFPE 1BKMA 5I6VA 4P9ZA 4F59A 1LKKA 3IMJA 1A1CA 1O4MA 1FU6A 3VS7A 1LCJA 1TZEE 4DGXA 3BKBA 1RPYA 2OZOA 2RSYA 4JE4A 2CI8A 2EO3A 1OO3A 3N84A 1A09A 1A1BA 1LUIA 2EYYA 3S8LA 1O48A 1NZLA
chains in the Genus database with same CATH topology
1SHBA 3CBLA 4GWFA 4EIHA 3S8OA 1AYBA 1LUNA 1BLKA 3VS2A 2EYZA 2LCTA 2PNAA 1A07A 1SPRA 1UUSA 4H1OA 5EHPA 3CXLA 4F5AA 1GHUA 2FCIA 3PSJA 2HUWA 1QG1E 2EKXA 1R1PA 2FO0A 1R1QA 4JGHA 4WWQA 1AYCA 1O45A 2IUIA 1CWDL 3ZNIA 1O47A 3M7FA 1O4CA 1B47A 2Y1MA 3OB1B 5HKZA 1RJAA 4DGPA 1SPSA 2MQIA 4F5BA 2AOBA 4QSYA 3OV1A 3US4A 2QMSA 2HMHA 1O4EA 3BUNB 2ABLA 3VRYA 4FL2A 1KC2A 1Z3KA 5AULA 2KK6A 3TKZA 5DC4A 1O4BA 2YU7A 3VS6A 4H34A 1NRVA 3MXCA 3UYOA 1BHHA 1O4AA 3VS1A 2Y1NA 2K79B 2RVFA 1CJ1A 2LNXA 4OHHA 1GRIA 2C9WA 1TCEA 1H9OA 3PS5A 1BHHB 2IUGA 2B3OA 1BLJA 5DC0B 1BM2A 1KA7A 4OHIA 3IMDA 4JEGA 3VS4A 4U17A 2DVJA 1HCTB 2AOAA 1O4NA 1O4PA 3MAZA 3PQZA 2CRHA 1X27A 3MXYA 1YVLA 2RMXA 3VS3A 3PJPA 5KAZA 1PICA 5D0JA 1BKLA 5AXIA 2H8HA 3GXWA 1CSYA 2BBUA 3C7IA 4GPLB 5CDWA 1OPKA 3IN7A 2DCRA 4NWGA 2K7AB 3VS5A 4OHDA 1RQQC 2SRCA 2CR4A 1BMBA 4A4BA 4K44A 1JYQA 1G83A 3HIZB 5DC9A 1MW4A 2MRJA 1MILA 3BUMB 2DX0A 2HDVA 5DF6A 2L4KA 4K11A 2HDXA 3GQIB 4XZ1A 2C0TA 1R1SA 2MRKA 3VS0A 1O43A 2OQ1A 2XP1A 2KNOA 3K2MA 1O4OA 1BG1A 1K9AA 1JU5A 3PFVA 1M61A 2EYVA 1KA6A 4P9VA 4OHLA 1JYUA 1M27A 5IBSA 1D1ZA 2H5KA 1JYRA 1O46A 3T04A 3CD3A 3N7YA 5EHRA 4EY0A 5IBMA 4FL3A 1QCFA 3VRZA 1LUMA 3QWYA 1A81A 1FBZA 3UF4A 2PLDA 1KSWA 2DLZA 1A08A 1FHSA 3S8NA 2VIFA 1IJRA 1X0NA 2L3TA 4LUDA 2LNWA 2GE9A 1CWEA 1D4TA 3GXXA 4ROJA 3VGOA 1O49A 5EEQA 3IN8A 1LUKA 1FMKA 4L1BB 1BFJA 2HCKA 3WA4A 3BUOB 1P13A 2C0OA 2CBLA 3VRQA 2PNBA 4E68A 1X6CA 3BUWB 1LKLA 3OB2B 4GL9E 3PSKA 4TZIA 3VRNA 1O42A 1AB2A 1SHAA 4A4CA 1O4QA 1O4KA 3TL0A 1IS0A 4OHEA 1AYAA 2CS0A 1O4JA 5HKYA 3OVEA 2EOBA 1CSZA 3OP0A 3S9KA 2H46E 4XZ0A 4M4ZA 2EU0A 2AUGA 3KFJA 1O4DA 2ECDA 4FBNA 3NHNA 1A1EA 1OPLA 1JWOA 3VROA 3VRRA 1XA6A 2YSXA 1O4FA 2C0IA 2SHPA 1BFIA 3HHMB 2GSBA 2EO6A 1O4HA 1BF5A 5J3XA 1UURA 1FYRA 2IUHA 2PTKA 3HCKA 1A1AA 2DLYA 1O44A 1HCSB 2CIAA 1Y1UA 1O4GA 1YVHA 3EAZA 4X6SA 2PLEA 1NZVA 5GJIA 3QWXX 1SHDA 4K45A 1F2FA 1O41A 2DM0A 4NWFA 2LQNA 3EACA 5GJHA 1WQUA 5EG3B 2RORA 2MC1A 2ETZA 1O4RA 2MK2A 2JYQA 5HKWA 1LCKA 3BUXB 2EL8A 1QADA 5EELA 4U1PA 5BO4A 4K2RA 1OO4A 1O4IA 1F1WA 2IZVA 3VRPA 1AD5A 1AYDA 1BHFA 1FBVA 4LUEA 1SKJA 3CWGA 1I3ZA 4D8KA 3N8MA 1O4LA 1Y57A 2LQWA 2Y3AB 2L6KA 3PLFB 2CI9A 4E93A 1D4WA 1AOTF 1FU5A 1AOUF 1ZFPE 1BKMA 5I6VA 4P9ZA 4F59A 1LKKA 3IMJA 1A1CA 1O4MA 1FU6A 3VS7A 1LCJA 1TZEE 4DGXA 3BKBA 1RPYA 2OZOA 2RSYA 4JE4A 2CI8A 2EO3A 1OO3A 3N84A 1A09A 1A1BA 1LUIA 2EYYA 3S8LA 1O48A 1NZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHB A;  3CBL A;  4GWF A;  4EIH A;  3S8O A;  1AYB A;  1LUN A;  1BLK A;  3VS2 A;  2EYZ A;  2LCT A;  2PNA A;  1A07 A;  1SPR A;  1UUS A;  4H1O A;  5EHP A;  3CXL A;  4F5A A;  1GHU A;  2FCI A;  3PSJ A;  2HUW A;  1QG1 E;  2EKX A;  1R1P A;  2FO0 A;  1R1Q A;  4JGH A;  4WWQ A;  1AYC A;  1O45 A;  2IUI A;  1CWD L;  3ZNI A;  1O47 A;  3M7F A;  1O4C A;  1B47 A;  2Y1M A;  3OB1 B;  5HKZ A;  1RJA A;  4DGP A;  1SPS A;  2MQI A;  4F5B A;  2AOB A;  4QSY A;  3OV1 A;  3US4 A;  2QMS A;  2HMH A;  1O4E A;  3BUN B;  2ABL A;  3VRY A;  4FL2 A;  1KC2 A;  1Z3K A;  5AUL A;  2KK6 A;  3TKZ A;  5DC4 A;  1O4B A;  2YU7 A;  3VS6 A;  4H34 A;  1NRV A;  3MXC A;  3UYO A;  1BHH A;  1O4A A;  3VS1 A;  2Y1N A;  2K79 B;  2RVF A;  1CJ1 A;  2LNX A;  4OHH A;  1GRI A;  2C9W A;  1TCE A;  1H9O A;  3PS5 A;  1BHH B;  2IUG A;  2B3O A;  1BLJ A;  5DC0 B;  1BM2 A;  1KA7 A;  4OHI A;  3IMD A;  4JEG A;  3VS4 A;  4U17 A;  2DVJ A;  1HCT B;  2AOA A;  1O4N A;  1O4P A;  3MAZ A;  3PQZ A;  2CRH A;  1X27 A;  3MXY A;  1YVL A;  2RMX A;  3VS3 A;  3PJP A;  5KAZ A;  1PIC A;  5D0J A;  1BKL A;  5AXI A;  2H8H A;  3GXW A;  1CSY A;  2BBU A;  3C7I A;  4GPL B;  5CDW A;  1OPK A;  3IN7 A;  2DCR A;  4NWG A;  2K7A B;  3VS5 A;  4OHD A;  1RQQ C;  2SRC A;  2CR4 A;  1BMB A;  4A4B A;  4K44 A;  1JYQ A;  1G83 A;  3HIZ B;  5DC9 A;  1MW4 A;  2MRJ A;  1MIL A;  3BUM B;  2DX0 A;  2HDV A;  5DF6 A;  2L4K A;  4K11 A;  2HDX A;  3GQI B;  4XZ1 A;  2C0T A;  1R1S A;  2MRK A;  3VS0 A;  1O43 A;  2OQ1 A;  2XP1 A;  2KNO A;  3K2M A;  1O4O A;  1BG1 A;  1K9A A;  1JU5 A;  3PFV A;  1M61 A;  2EYV A;  1KA6 A;  4P9V A;  4OHL A;  1JYU A;  1M27 A;  5IBS A;  1D1Z A;  2H5K A;  1JYR A;  1O46 A;  3T04 A;  3CD3 A;  3N7Y A;  5EHR A;  4EY0 A;  5IBM A;  4FL3 A;  1QCF A;  3VRZ A;  1LUM A;  3QWY A;  1A81 A;  1FBZ A;  3UF4 A;  2PLD A;  1KSW A;  2DLZ A;  1A08 A;  1FHS A;  3S8N A;  2VIF A;  1IJR A;  1X0N A;  2L3T A;  4LUD A;  2LNW A;  2GE9 A;  1CWE A;  1D4T A;  3GXX A;  4ROJ A;  3VGO A;  1O49 A;  5EEQ A;  3IN8 A;  1LUK A;  1FMK A;  4L1B B;  1BFJ A;  2HCK A;  3WA4 A;  3BUO B;  1P13 A;  2C0O A;  2CBL A;  3VRQ A;  2PNB A;  4E68 A;  1X6C A;  3BUW B;  1LKL A;  3OB2 B;  4GL9 E;  3PSK A;  4TZI A;  3VRN A;  1O42 A;  1AB2 A;  1SHA A;  4A4C A;  1O4Q A;  1O4K A;  3TL0 A;  1IS0 A;  4OHE A;  1AYA A;  2CS0 A;  1O4J A;  5HKY A;  3OVE A;  2EOB A;  1CSZ A;  3OP0 A;  3S9K A;  2H46 E;  4XZ0 A;  4M4Z A;  2EU0 A;  2AUG A;  3KFJ A;  1O4D A;  2ECD A;  4FBN A;  3NHN A;  1A1E A;  1OPL A;  1JWO A;  3VRO A;  3VRR A;  1XA6 A;  2YSX A;  1O4F A;  2C0I A;  2SHP A;  1BFI A;  3HHM B;  2GSB A;  2EO6 A;  1O4H A;  1BF5 A;  5J3X A;  1UUR A;  1FYR A;  2IUH A;  2PTK A;  3HCK A;  1A1A A;  2DLY A;  1O44 A;  1HCS B;  2CIA A;  1Y1U A;  1O4G A;  1YVH A;  3EAZ A;  4X6S A;  2PLE A;  1NZV A;  5GJI A;  3QWX X;  1SHD A;  4K45 A;  1F2F A;  1O41 A;  2DM0 A;  4NWF A;  2LQN A;  3EAC A;  5GJH A;  1WQU A;  5EG3 B;  2ROR A;  2MC1 A;  2ETZ A;  1O4R A;  2MK2 A;  2JYQ A;  5HKW A;  1LCK A;  3BUX B;  2EL8 A;  1QAD A;  5EEL A;  4U1P A;  5BO4 A;  4K2R A;  1OO4 A;  1O4I A;  1F1W A;  2IZV A;  3VRP A;  1AD5 A;  1AYD A;  1BHF A;  1FBV A;  4LUE A;  1SKJ A;  3CWG A;  1I3Z A;  4D8K A;  3N8M A;  1O4L A;  1Y57 A;  2LQW A;  2Y3A B;  2L6K A;  3PLF B;  2CI9 A;  4E93 A;  1D4W A;  1AOT F;  1FU5 A;  1AOU F;  1ZFP E;  1BKM A;  5I6V A;  4P9Z A;  4F59 A;  1LKK A;  3IMJ A;  1A1C A;  1O4M A;  1FU6 A;  3VS7 A;  1LCJ A;  1TZE E;  4DGX A;  3BKB A;  1RPY A;  2OZO A;  2RSY A;  4JE4 A;  2CI8 A;  2EO3 A;  1OO3 A;  3N84 A;  1A09 A;  1A1B A;  1LUI A;  2EYY A;  3S8L A;  1O48 A;  1NZL A; 
#chains in the Genus database with same CATH topology
 1SHB A;  3CBL A;  4GWF A;  4EIH A;  3S8O A;  1AYB A;  1LUN A;  1BLK A;  3VS2 A;  2EYZ A;  3K2T A;  2LCT A;  2PNA A;  1A07 A;  1SPR A;  1UUS A;  4H1O A;  5EHP A;  3CXL A;  4F5A A;  1GHU A;  2FCI A;  3PSJ A;  2HUW A;  1QG1 E;  2EKX A;  1R1P A;  2FO0 A;  1R1Q A;  4JGH A;  4WWQ A;  1AYC A;  1O45 A;  2IUI A;  1CWD L;  3ZNI A;  1O47 A;  3M7F A;  1O4C A;  1B47 A;  2Y1M A;  3OB1 B;  5HKZ A;  1RJA A;  4DGP A;  1SPS A;  2MQI A;  4F5B A;  2AOB A;  4QSY A;  3OV1 A;  3US4 A;  2QMS A;  2HMH A;  1O4E A;  2LRA A;  3BUN B;  2ABL A;  3VRY A;  4FL2 A;  1KC2 A;  1Z3K A;  5AUL A;  2KK6 A;  3TKZ A;  5DC4 A;  1O4B A;  2YU7 A;  3VS6 A;  4H34 A;  1NRV A;  3MXC A;  3UYO A;  1BHH A;  1O4A A;  3VS1 A;  2Y1N A;  2K79 B;  2RVF A;  1CJ1 A;  2LNX A;  4OHH A;  1GRI A;  2C9W A;  1TCE A;  1H9O A;  3PS5 A;  1BHH B;  2IUG A;  2B3O A;  1BLJ A;  5DC0 B;  1BM2 A;  1KA7 A;  4OHI A;  3IMD A;  4JEG A;  3VS4 A;  4U17 A;  2DVJ A;  1HCT B;  2AOA A;  1O4N A;  1O4P A;  3MAZ A;  3PQZ A;  2CRH A;  1X27 A;  3MXY A;  1YVL A;  2RMX A;  3VS3 A;  3PJP A;  5KAZ A;  1PIC A;  5D0J A;  1BKL A;  5AXI A;  2H8H A;  3GXW A;  1CSY A;  2BBU A;  3C7I A;  4GPL B;  5CDW A;  1OPK A;  3IN7 A;  2DCR A;  4NWG A;  2K7A B;  3VS5 A;  4OHD A;  1RQQ C;  2SRC A;  2CR4 A;  1BMB A;  4A4B A;  4K44 A;  1JYQ A;  1G83 A;  3HIZ B;  5DC9 A;  1MW4 A;  2MRJ A;  1MIL A;  3BUM B;  2DX0 A;  2HDV A;  5DF6 A;  2L4K A;  4K11 A;  2HDX A;  3GQI B;  4XZ1 A;  2C0T A;  1R1S A;  2MRK A;  3VS0 A;  1O43 A;  2OQ1 A;  2XP1 A;  2KNO A;  3K2M A;  1O4O A;  1BG1 A;  1K9A A;  1JU5 A;  3PFV A;  1M61 A;  2EYV A;  1KA6 A;  4P9V A;  3LYV A;  4OHL A;  1JYU A;  1M27 A;  5IBS A;  1D1Z A;  2H5K A;  1JYR A;  1O46 A;  3T04 A;  3CD3 A;  3N7Y A;  5EHR A;  4EY0 A;  5IBM A;  4FL3 A;  1QCF A;  3VRZ A;  1LUM A;  3QWY A;  1A81 A;  1FBZ A;  3UF4 A;  2PLD A;  1KSW A;  2DLZ A;  1A08 A;  1FHS A;  3S8N A;  2VIF A;  1IJR A;  1X0N A;  2L3T A;  4LUD A;  2LNW A;  2GE9 A;  1CWE A;  1D4T A;  3GXX A;  4ROJ A;  3VGO A;  1O49 A;  5EEQ A;  3IN8 A;  1LUK A;  1FMK A;  4L1B B;  1BFJ A;  2HCK A;  3WA4 A;  3BUO B;  1P13 A;  2C0O A;  2CBL A;  3VRQ A;  2PNB A;  4E68 A;  1X6C A;  3BUW B;  1LKL A;  3OB2 B;  4GL9 E;  3PSK A;  4TZI A;  3VRN A;  1O42 A;  1AB2 A;  1SHA A;  4A4C A;  1O4Q A;  1O4K A;  3TL0 A;  1IS0 A;  4OHE A;  1AYA A;  2CS0 A;  1O4J A;  5HKY A;  3OVE A;  2EOB A;  1CSZ A;  3OP0 A;  3S9K A;  2H46 E;  4XZ0 A;  4M4Z A;  2EU0 A;  2AUG A;  3KFJ A;  1O4D A;  2ECD A;  4FBN A;  3NHN A;  1A1E A;  1OPL A;  1JWO A;  3VRO A;  3VRR A;  2KGY A;  1XA6 A;  2YSX A;  1O4F A;  2C0I A;  2SHP A;  1BFI A;  3HHM B;  2GSB A;  2EO6 A;  1O4H A;  1BF5 A;  5J3X A;  1UUR A;  1FYR A;  2IUH A;  2PTK A;  3HCK A;  1A1A A;  2DLY A;  1O44 A;  1HCS B;  2CIA A;  1Y1U A;  1O4G A;  1YVH A;  3EAZ A;  4X6S A;  2PLE A;  1NZV A;  5GJI A;  3QWX X;  1SHD A;  4K45 A;  1F2F A;  1O41 A;  2DM0 A;  4NWF A;  2LQN A;  3EAC A;  5GJH A;  1WQU A;  5EG3 B;  2ROR A;  2MC1 A;  2ETZ A;  1O4R A;  2MK2 A;  2JYQ A;  5HKW A;  1LCK A;  3BUX B;  2EL8 A;  1QAD A;  5EEL A;  4U1P A;  5BO4 A;  4K2R A;  1OO4 A;  1O4I A;  1F1W A;  2IZV A;  3VRP A;  1AD5 A;  1AYD A;  1BHF A;  1FBV A;  4LUE A;  1SKJ A;  3CWG A;  1I3Z A;  4D8K A;  3N8M A;  1O4L A;  1Y57 A;  2LQW A;  2Y3A B;  2L6K A;  3PLF B;  2CI9 A;  4E93 A;  1D4W A;  1AOT F;  1FU5 A;  1AOU F;  1ZFP E;  1BKM A;  5I6V A;  4P9Z A;  4F59 A;  1LKK A;  3IMJ A;  1A1C A;  1O4M A;  1FU6 A;  3VS7 A;  1LCJ A;  1TZE E;  4DGX A;  3BKB A;  1RPY A;  2OZO A;  2RSY A;  4JE4 A;  2CI8 A;  2EO3 A;  1OO3 A;  3N84 A;  1A09 A;  1A1B A;  1LUI A;  2EYY A;  3S8L A;  1O48 A;  1NZL A; 
#chains in the Genus database with same CATH homology
 1SHB A;  3CBL A;  4GWF A;  4EIH A;  3S8O A;  1AYB A;  1LUN A;  1BLK A;  3VS2 A;  2EYZ A;  2LCT A;  2PNA A;  1A07 A;  1SPR A;  1UUS A;  4H1O A;  5EHP A;  3CXL A;  4F5A A;  1GHU A;  2FCI A;  3PSJ A;  2HUW A;  1QG1 E;  2EKX A;  1R1P A;  2FO0 A;  1R1Q A;  4JGH A;  4WWQ A;  1AYC A;  1O45 A;  2IUI A;  1CWD L;  3ZNI A;  1O47 A;  3M7F A;  1O4C A;  1B47 A;  2Y1M A;  3OB1 B;  5HKZ A;  1RJA A;  4DGP A;  1SPS A;  2MQI A;  4F5B A;  2AOB A;  4QSY A;  3OV1 A;  3US4 A;  2QMS A;  2HMH A;  1O4E A;  3BUN B;  2ABL A;  3VRY A;  4FL2 A;  1KC2 A;  1Z3K A;  5AUL A;  2KK6 A;  3TKZ A;  5DC4 A;  1O4B A;  2YU7 A;  3VS6 A;  4H34 A;  1NRV A;  3MXC A;  3UYO A;  1BHH A;  1O4A A;  3VS1 A;  2Y1N A;  2K79 B;  2RVF A;  1CJ1 A;  2LNX A;  4OHH A;  1GRI A;  2C9W A;  1TCE A;  1H9O A;  3PS5 A;  1BHH B;  2IUG A;  2B3O A;  1BLJ A;  5DC0 B;  1BM2 A;  1KA7 A;  4OHI A;  3IMD A;  4JEG A;  3VS4 A;  4U17 A;  2DVJ A;  1HCT B;  2AOA A;  1O4N A;  1O4P A;  3MAZ A;  3PQZ A;  2CRH A;  1X27 A;  3MXY A;  1YVL A;  2RMX A;  3VS3 A;  3PJP A;  5KAZ A;  1PIC A;  5D0J A;  1BKL A;  5AXI A;  2H8H A;  3GXW A;  1CSY A;  2BBU A;  3C7I A;  4GPL B;  5CDW A;  1OPK A;  3IN7 A;  2DCR A;  4NWG A;  2K7A B;  3VS5 A;  4OHD A;  1RQQ C;  2SRC A;  2CR4 A;  1BMB A;  4A4B A;  4K44 A;  1JYQ A;  1G83 A;  3HIZ B;  5DC9 A;  1MW4 A;  2MRJ A;  1MIL A;  3BUM B;  2DX0 A;  2HDV A;  5DF6 A;  2L4K A;  4K11 A;  2HDX A;  3GQI B;  4XZ1 A;  2C0T A;  1R1S A;  2MRK A;  3VS0 A;  1O43 A;  2OQ1 A;  2XP1 A;  2KNO A;  3K2M A;  1O4O A;  1BG1 A;  1K9A A;  1JU5 A;  3PFV A;  1M61 A;  2EYV A;  1KA6 A;  4P9V A;  4OHL A;  1JYU A;  1M27 A;  5IBS A;  1D1Z A;  2H5K A;  1JYR A;  1O46 A;  3T04 A;  3CD3 A;  3N7Y A;  5EHR A;  4EY0 A;  5IBM A;  4FL3 A;  1QCF A;  3VRZ A;  1LUM A;  3QWY A;  1A81 A;  1FBZ A;  3UF4 A;  2PLD A;  1KSW A;  2DLZ A;  1A08 A;  1FHS A;  3S8N A;  2VIF A;  1IJR A;  1X0N A;  2L3T A;  4LUD A;  2LNW A;  2GE9 A;  1CWE A;  1D4T A;  3GXX A;  4ROJ A;  3VGO A;  1O49 A;  5EEQ A;  3IN8 A;  1LUK A;  1FMK A;  4L1B B;  1BFJ A;  2HCK A;  3WA4 A;  3BUO B;  1P13 A;  2C0O A;  2CBL A;  3VRQ A;  2PNB A;  4E68 A;  1X6C A;  3BUW B;  1LKL A;  3OB2 B;  4GL9 E;  3PSK A;  4TZI A;  3VRN A;  1O42 A;  1AB2 A;  1SHA A;  4A4C A;  1O4Q A;  1O4K A;  3TL0 A;  1IS0 A;  4OHE A;  1AYA A;  2CS0 A;  1O4J A;  5HKY A;  3OVE A;  2EOB A;  1CSZ A;  3OP0 A;  3S9K A;  2H46 E;  4XZ0 A;  4M4Z A;  2EU0 A;  2AUG A;  3KFJ A;  1O4D A;  2ECD A;  4FBN A;  3NHN A;  1A1E A;  1OPL A;  1JWO A;  3VRO A;  3VRR A;  1XA6 A;  2YSX A;  1O4F A;  2C0I A;  2SHP A;  1BFI A;  3HHM B;  2GSB A;  2EO6 A;  1O4H A;  1BF5 A;  5J3X A;  1UUR A;  1FYR A;  2IUH A;  2PTK A;  3HCK A;  1A1A A;  2DLY A;  1O44 A;  1HCS B;  2CIA A;  1Y1U A;  1O4G A;  1YVH A;  3EAZ A;  4X6S A;  2PLE A;  1NZV A;  5GJI A;  3QWX X;  1SHD A;  4K45 A;  1F2F A;  1O41 A;  2DM0 A;  4NWF A;  2LQN A;  3EAC A;  5GJH A;  1WQU A;  5EG3 B;  2ROR A;  2MC1 A;  2ETZ A;  1O4R A;  2MK2 A;  2JYQ A;  5HKW A;  1LCK A;  3BUX B;  2EL8 A;  1QAD A;  5EEL A;  4U1P A;  5BO4 A;  4K2R A;  1OO4 A;  1O4I A;  1F1W A;  2IZV A;  3VRP A;  1AD5 A;  1AYD A;  1BHF A;  1FBV A;  4LUE A;  1SKJ A;  3CWG A;  1I3Z A;  4D8K A;  3N8M A;  1O4L A;  1Y57 A;  2LQW A;  2Y3A B;  2L6K A;  3PLF B;  2CI9 A;  4E93 A;  1D4W A;  1AOT F;  1FU5 A;  1AOU F;  1ZFP E;  1BKM A;  5I6V A;  4P9Z A;  4F59 A;  1LKK A;  3IMJ A;  1A1C A;  1O4M A;  1FU6 A;  3VS7 A;  1LCJ A;  1TZE E;  4DGX A;  3BKB A;  1RPY A;  2OZO A;  2RSY A;  4JE4 A;  2CI8 A;  2EO3 A;  1OO3 A;  3N84 A;  1A09 A;  1A1B A;  1LUI A;  2EYY A;  3S8L A;  1O48 A;  1NZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...